data_8AH4 # _entry.id 8AH4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.385 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8AH4 pdb_00008ah4 10.2210/pdb8ah4/pdb WWPDB D_1292124240 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-03-08 2 'Structure model' 1 1 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 2 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 3 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 5 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 6 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 7 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 8 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8AH4 _pdbx_database_status.recvd_initial_deposition_date 2022-07-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email acamara@ual.es _pdbx_contact_author.name_first Ana _pdbx_contact_author.name_last Camara-Artigas _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2197-726X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Camara-Artigas, A.' 1 ? 'Salinas Garcia, M.C.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Crystals _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2073-4352 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'pH-Driven Polymorphic Behaviour of the Third PDZ Domain of PSD95: The Role of Electrostatic Interactions' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/cryst13020218 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Salinas-Garcia, M.C.' 1 ? primary 'Plaza-Garrido, M.' 2 ? primary 'Gavira, J.A.' 3 ? primary 'Murciano-Calles, J.' 4 ? primary 'Andujar-Sanchez, M.' 5 ? primary 'Ortiz-Salmeron, E.' 6 ? primary 'Martinez, J.C.' 7 ? primary 'Camara-Artigas, A.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'cDNA FLJ50577, highly similar to Discs large homolog 4' 11148.488 6 ? ? ? ? 2 non-polymer syn 'ACETATE ION' 59.044 6 ? ? ? ? 3 water nat water 18.015 514 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIAL KNAGQTVTIIAQYKPEEYSRFEAK ; _entity_poly.pdbx_seq_one_letter_code_can ;MGLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIAL KNAGQTVTIIAQYKPEEYSRFEAK ; _entity_poly.pdbx_strand_id A,B,C,D,E,F _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ACETATE ION' ACT 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 LEU n 1 4 GLY n 1 5 GLU n 1 6 GLU n 1 7 ASP n 1 8 ILE n 1 9 PRO n 1 10 ARG n 1 11 GLU n 1 12 PRO n 1 13 ARG n 1 14 ARG n 1 15 ILE n 1 16 VAL n 1 17 ILE n 1 18 HIS n 1 19 ARG n 1 20 GLY n 1 21 SER n 1 22 THR n 1 23 GLY n 1 24 LEU n 1 25 GLY n 1 26 PHE n 1 27 ASN n 1 28 ILE n 1 29 VAL n 1 30 GLY n 1 31 GLY n 1 32 GLU n 1 33 ASP n 1 34 GLY n 1 35 GLU n 1 36 GLY n 1 37 ILE n 1 38 PHE n 1 39 ILE n 1 40 SER n 1 41 PHE n 1 42 ILE n 1 43 LEU n 1 44 ALA n 1 45 GLY n 1 46 GLY n 1 47 PRO n 1 48 ALA n 1 49 ASP n 1 50 LEU n 1 51 SER n 1 52 GLY n 1 53 GLU n 1 54 LEU n 1 55 ARG n 1 56 LYS n 1 57 GLY n 1 58 ASP n 1 59 GLN n 1 60 ILE n 1 61 LEU n 1 62 SER n 1 63 VAL n 1 64 ASN n 1 65 GLY n 1 66 VAL n 1 67 ASP n 1 68 LEU n 1 69 ARG n 1 70 ASN n 1 71 ALA n 1 72 SER n 1 73 HIS n 1 74 GLU n 1 75 GLN n 1 76 ALA n 1 77 ALA n 1 78 ILE n 1 79 ALA n 1 80 LEU n 1 81 LYS n 1 82 ASN n 1 83 ALA n 1 84 GLY n 1 85 GLN n 1 86 THR n 1 87 VAL n 1 88 THR n 1 89 ILE n 1 90 ILE n 1 91 ALA n 1 92 GLN n 1 93 TYR n 1 94 LYS n 1 95 PRO n 1 96 GLU n 1 97 GLU n 1 98 TYR n 1 99 SER n 1 100 ARG n 1 101 PHE n 1 102 GLU n 1 103 ALA n 1 104 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 104 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 300 ? ? ? A . n A 1 2 GLY 2 301 ? ? ? A . n A 1 3 LEU 3 302 ? ? ? A . n A 1 4 GLY 4 303 ? ? ? A . n A 1 5 GLU 5 304 ? ? ? A . n A 1 6 GLU 6 305 ? ? ? A . n A 1 7 ASP 7 306 ? ? ? A . n A 1 8 ILE 8 307 ? ? ? A . n A 1 9 PRO 9 308 308 PRO PRO A . n A 1 10 ARG 10 309 309 ARG ARG A . n A 1 11 GLU 11 310 310 GLU GLU A . n A 1 12 PRO 12 311 311 PRO PRO A . n A 1 13 ARG 13 312 312 ARG ARG A . n A 1 14 ARG 14 313 313 ARG ARG A . n A 1 15 ILE 15 314 314 ILE ILE A . n A 1 16 VAL 16 315 315 VAL VAL A . n A 1 17 ILE 17 316 316 ILE ILE A . n A 1 18 HIS 18 317 317 HIS HIS A . n A 1 19 ARG 19 318 318 ARG ARG A . n A 1 20 GLY 20 319 319 GLY GLY A . n A 1 21 SER 21 320 320 SER SER A . n A 1 22 THR 22 321 321 THR THR A . n A 1 23 GLY 23 322 322 GLY GLY A . n A 1 24 LEU 24 323 323 LEU LEU A . n A 1 25 GLY 25 324 324 GLY GLY A . n A 1 26 PHE 26 325 325 PHE PHE A . n A 1 27 ASN 27 326 326 ASN ASN A . n A 1 28 ILE 28 327 327 ILE ILE A . n A 1 29 VAL 29 328 328 VAL VAL A . n A 1 30 GLY 30 329 329 GLY GLY A . n A 1 31 GLY 31 330 330 GLY GLY A . n A 1 32 GLU 32 331 331 GLU GLU A . n A 1 33 ASP 33 332 332 ASP ASP A . n A 1 34 GLY 34 333 333 GLY GLY A . n A 1 35 GLU 35 334 334 GLU GLU A . n A 1 36 GLY 36 335 335 GLY GLY A . n A 1 37 ILE 37 336 336 ILE ILE A . n A 1 38 PHE 38 337 337 PHE PHE A . n A 1 39 ILE 39 338 338 ILE ILE A . n A 1 40 SER 40 339 339 SER SER A . n A 1 41 PHE 41 340 340 PHE PHE A . n A 1 42 ILE 42 341 341 ILE ILE A . n A 1 43 LEU 43 342 342 LEU LEU A . n A 1 44 ALA 44 343 343 ALA ALA A . n A 1 45 GLY 45 344 344 GLY GLY A . n A 1 46 GLY 46 345 345 GLY GLY A . n A 1 47 PRO 47 346 346 PRO PRO A . n A 1 48 ALA 48 347 347 ALA ALA A . n A 1 49 ASP 49 348 348 ASP ASP A . n A 1 50 LEU 50 349 349 LEU LEU A . n A 1 51 SER 51 350 350 SER SER A . n A 1 52 GLY 52 351 351 GLY GLY A . n A 1 53 GLU 53 352 352 GLU GLU A . n A 1 54 LEU 54 353 353 LEU LEU A . n A 1 55 ARG 55 354 354 ARG ARG A . n A 1 56 LYS 56 355 355 LYS LYS A . n A 1 57 GLY 57 356 356 GLY GLY A . n A 1 58 ASP 58 357 357 ASP ASP A . n A 1 59 GLN 59 358 358 GLN GLN A . n A 1 60 ILE 60 359 359 ILE ILE A . n A 1 61 LEU 61 360 360 LEU LEU A . n A 1 62 SER 62 361 361 SER SER A . n A 1 63 VAL 63 362 362 VAL VAL A . n A 1 64 ASN 64 363 363 ASN ASN A . n A 1 65 GLY 65 364 364 GLY GLY A . n A 1 66 VAL 66 365 365 VAL VAL A . n A 1 67 ASP 67 366 366 ASP ASP A . n A 1 68 LEU 68 367 367 LEU LEU A . n A 1 69 ARG 69 368 368 ARG ARG A . n A 1 70 ASN 70 369 369 ASN ASN A . n A 1 71 ALA 71 370 370 ALA ALA A . n A 1 72 SER 72 371 371 SER SER A . n A 1 73 HIS 73 372 372 HIS HIS A . n A 1 74 GLU 74 373 373 GLU GLU A . n A 1 75 GLN 75 374 374 GLN GLN A . n A 1 76 ALA 76 375 375 ALA ALA A . n A 1 77 ALA 77 376 376 ALA ALA A . n A 1 78 ILE 78 377 377 ILE ILE A . n A 1 79 ALA 79 378 378 ALA ALA A . n A 1 80 LEU 80 379 379 LEU LEU A . n A 1 81 LYS 81 380 380 LYS LYS A . n A 1 82 ASN 82 381 381 ASN ASN A . n A 1 83 ALA 83 382 382 ALA ALA A . n A 1 84 GLY 84 383 383 GLY GLY A . n A 1 85 GLN 85 384 384 GLN GLN A . n A 1 86 THR 86 385 385 THR THR A . n A 1 87 VAL 87 386 386 VAL VAL A . n A 1 88 THR 88 387 387 THR THR A . n A 1 89 ILE 89 388 388 ILE ILE A . n A 1 90 ILE 90 389 389 ILE ILE A . n A 1 91 ALA 91 390 390 ALA ALA A . n A 1 92 GLN 92 391 391 GLN GLN A . n A 1 93 TYR 93 392 392 TYR TYR A . n A 1 94 LYS 94 393 393 LYS LYS A . n A 1 95 PRO 95 394 394 PRO PRO A . n A 1 96 GLU 96 395 395 GLU GLU A . n A 1 97 GLU 97 396 396 GLU GLU A . n A 1 98 TYR 98 397 397 TYR TYR A . n A 1 99 SER 99 398 398 SER SER A . n A 1 100 ARG 100 399 399 ARG ARG A . n A 1 101 PHE 101 400 400 PHE PHE A . n A 1 102 GLU 102 401 401 GLU GLU A . n A 1 103 ALA 103 402 ? ? ? A . n A 1 104 LYS 104 403 ? ? ? A . n B 1 1 MET 1 300 ? ? ? B . n B 1 2 GLY 2 301 ? ? ? B . n B 1 3 LEU 3 302 ? ? ? B . n B 1 4 GLY 4 303 ? ? ? B . n B 1 5 GLU 5 304 ? ? ? B . n B 1 6 GLU 6 305 ? ? ? B . n B 1 7 ASP 7 306 ? ? ? B . n B 1 8 ILE 8 307 307 ILE ILE B . n B 1 9 PRO 9 308 308 PRO PRO B . n B 1 10 ARG 10 309 309 ARG ARG B . n B 1 11 GLU 11 310 310 GLU GLU B . n B 1 12 PRO 12 311 311 PRO PRO B . n B 1 13 ARG 13 312 312 ARG ARG B . n B 1 14 ARG 14 313 313 ARG ARG B . n B 1 15 ILE 15 314 314 ILE ILE B . n B 1 16 VAL 16 315 315 VAL VAL B . n B 1 17 ILE 17 316 316 ILE ILE B . n B 1 18 HIS 18 317 317 HIS HIS B . n B 1 19 ARG 19 318 318 ARG ARG B . n B 1 20 GLY 20 319 319 GLY GLY B . n B 1 21 SER 21 320 320 SER SER B . n B 1 22 THR 22 321 321 THR THR B . n B 1 23 GLY 23 322 322 GLY GLY B . n B 1 24 LEU 24 323 323 LEU LEU B . n B 1 25 GLY 25 324 324 GLY GLY B . n B 1 26 PHE 26 325 325 PHE PHE B . n B 1 27 ASN 27 326 326 ASN ASN B . n B 1 28 ILE 28 327 327 ILE ILE B . n B 1 29 VAL 29 328 328 VAL VAL B . n B 1 30 GLY 30 329 329 GLY GLY B . n B 1 31 GLY 31 330 330 GLY GLY B . n B 1 32 GLU 32 331 331 GLU GLU B . n B 1 33 ASP 33 332 332 ASP ASP B . n B 1 34 GLY 34 333 333 GLY GLY B . n B 1 35 GLU 35 334 334 GLU GLU B . n B 1 36 GLY 36 335 335 GLY GLY B . n B 1 37 ILE 37 336 336 ILE ILE B . n B 1 38 PHE 38 337 337 PHE PHE B . n B 1 39 ILE 39 338 338 ILE ILE B . n B 1 40 SER 40 339 339 SER SER B . n B 1 41 PHE 41 340 340 PHE PHE B . n B 1 42 ILE 42 341 341 ILE ILE B . n B 1 43 LEU 43 342 342 LEU LEU B . n B 1 44 ALA 44 343 343 ALA ALA B . n B 1 45 GLY 45 344 344 GLY GLY B . n B 1 46 GLY 46 345 345 GLY GLY B . n B 1 47 PRO 47 346 346 PRO PRO B . n B 1 48 ALA 48 347 347 ALA ALA B . n B 1 49 ASP 49 348 348 ASP ASP B . n B 1 50 LEU 50 349 349 LEU LEU B . n B 1 51 SER 51 350 350 SER SER B . n B 1 52 GLY 52 351 351 GLY GLY B . n B 1 53 GLU 53 352 352 GLU GLU B . n B 1 54 LEU 54 353 353 LEU LEU B . n B 1 55 ARG 55 354 354 ARG ARG B . n B 1 56 LYS 56 355 355 LYS LYS B . n B 1 57 GLY 57 356 356 GLY GLY B . n B 1 58 ASP 58 357 357 ASP ASP B . n B 1 59 GLN 59 358 358 GLN GLN B . n B 1 60 ILE 60 359 359 ILE ILE B . n B 1 61 LEU 61 360 360 LEU LEU B . n B 1 62 SER 62 361 361 SER SER B . n B 1 63 VAL 63 362 362 VAL VAL B . n B 1 64 ASN 64 363 363 ASN ASN B . n B 1 65 GLY 65 364 364 GLY GLY B . n B 1 66 VAL 66 365 365 VAL VAL B . n B 1 67 ASP 67 366 366 ASP ASP B . n B 1 68 LEU 68 367 367 LEU LEU B . n B 1 69 ARG 69 368 368 ARG ARG B . n B 1 70 ASN 70 369 369 ASN ASN B . n B 1 71 ALA 71 370 370 ALA ALA B . n B 1 72 SER 72 371 371 SER SER B . n B 1 73 HIS 73 372 372 HIS HIS B . n B 1 74 GLU 74 373 373 GLU GLU B . n B 1 75 GLN 75 374 374 GLN GLN B . n B 1 76 ALA 76 375 375 ALA ALA B . n B 1 77 ALA 77 376 376 ALA ALA B . n B 1 78 ILE 78 377 377 ILE ILE B . n B 1 79 ALA 79 378 378 ALA ALA B . n B 1 80 LEU 80 379 379 LEU LEU B . n B 1 81 LYS 81 380 380 LYS LYS B . n B 1 82 ASN 82 381 381 ASN ASN B . n B 1 83 ALA 83 382 382 ALA ALA B . n B 1 84 GLY 84 383 383 GLY GLY B . n B 1 85 GLN 85 384 384 GLN GLN B . n B 1 86 THR 86 385 385 THR THR B . n B 1 87 VAL 87 386 386 VAL VAL B . n B 1 88 THR 88 387 387 THR THR B . n B 1 89 ILE 89 388 388 ILE ILE B . n B 1 90 ILE 90 389 389 ILE ILE B . n B 1 91 ALA 91 390 390 ALA ALA B . n B 1 92 GLN 92 391 391 GLN GLN B . n B 1 93 TYR 93 392 392 TYR TYR B . n B 1 94 LYS 94 393 393 LYS LYS B . n B 1 95 PRO 95 394 394 PRO PRO B . n B 1 96 GLU 96 395 395 GLU GLU B . n B 1 97 GLU 97 396 396 GLU GLU B . n B 1 98 TYR 98 397 397 TYR TYR B . n B 1 99 SER 99 398 398 SER SER B . n B 1 100 ARG 100 399 399 ARG ARG B . n B 1 101 PHE 101 400 400 PHE PHE B . n B 1 102 GLU 102 401 401 GLU GLU B . n B 1 103 ALA 103 402 ? ? ? B . n B 1 104 LYS 104 403 ? ? ? B . n C 1 1 MET 1 300 ? ? ? C . n C 1 2 GLY 2 301 ? ? ? C . n C 1 3 LEU 3 302 ? ? ? C . n C 1 4 GLY 4 303 ? ? ? C . n C 1 5 GLU 5 304 ? ? ? C . n C 1 6 GLU 6 305 ? ? ? C . n C 1 7 ASP 7 306 ? ? ? C . n C 1 8 ILE 8 307 ? ? ? C . n C 1 9 PRO 9 308 308 PRO PRO C . n C 1 10 ARG 10 309 309 ARG ARG C . n C 1 11 GLU 11 310 310 GLU GLU C . n C 1 12 PRO 12 311 311 PRO PRO C . n C 1 13 ARG 13 312 312 ARG ARG C . n C 1 14 ARG 14 313 313 ARG ARG C . n C 1 15 ILE 15 314 314 ILE ILE C . n C 1 16 VAL 16 315 315 VAL VAL C . n C 1 17 ILE 17 316 316 ILE ILE C . n C 1 18 HIS 18 317 317 HIS HIS C . n C 1 19 ARG 19 318 318 ARG ARG C . n C 1 20 GLY 20 319 319 GLY GLY C . n C 1 21 SER 21 320 320 SER SER C . n C 1 22 THR 22 321 321 THR THR C . n C 1 23 GLY 23 322 322 GLY GLY C . n C 1 24 LEU 24 323 323 LEU LEU C . n C 1 25 GLY 25 324 324 GLY GLY C . n C 1 26 PHE 26 325 325 PHE PHE C . n C 1 27 ASN 27 326 326 ASN ASN C . n C 1 28 ILE 28 327 327 ILE ILE C . n C 1 29 VAL 29 328 328 VAL VAL C . n C 1 30 GLY 30 329 329 GLY GLY C . n C 1 31 GLY 31 330 330 GLY GLY C . n C 1 32 GLU 32 331 331 GLU GLU C . n C 1 33 ASP 33 332 332 ASP ASP C . n C 1 34 GLY 34 333 333 GLY GLY C . n C 1 35 GLU 35 334 334 GLU GLU C . n C 1 36 GLY 36 335 335 GLY GLY C . n C 1 37 ILE 37 336 336 ILE ILE C . n C 1 38 PHE 38 337 337 PHE PHE C . n C 1 39 ILE 39 338 338 ILE ILE C . n C 1 40 SER 40 339 339 SER SER C . n C 1 41 PHE 41 340 340 PHE PHE C . n C 1 42 ILE 42 341 341 ILE ILE C . n C 1 43 LEU 43 342 342 LEU LEU C . n C 1 44 ALA 44 343 343 ALA ALA C . n C 1 45 GLY 45 344 344 GLY GLY C . n C 1 46 GLY 46 345 345 GLY GLY C . n C 1 47 PRO 47 346 346 PRO PRO C . n C 1 48 ALA 48 347 347 ALA ALA C . n C 1 49 ASP 49 348 348 ASP ASP C . n C 1 50 LEU 50 349 349 LEU LEU C . n C 1 51 SER 51 350 350 SER SER C . n C 1 52 GLY 52 351 351 GLY GLY C . n C 1 53 GLU 53 352 352 GLU GLU C . n C 1 54 LEU 54 353 353 LEU LEU C . n C 1 55 ARG 55 354 354 ARG ARG C . n C 1 56 LYS 56 355 355 LYS LYS C . n C 1 57 GLY 57 356 356 GLY GLY C . n C 1 58 ASP 58 357 357 ASP ASP C . n C 1 59 GLN 59 358 358 GLN GLN C . n C 1 60 ILE 60 359 359 ILE ILE C . n C 1 61 LEU 61 360 360 LEU LEU C . n C 1 62 SER 62 361 361 SER SER C . n C 1 63 VAL 63 362 362 VAL VAL C . n C 1 64 ASN 64 363 363 ASN ASN C . n C 1 65 GLY 65 364 364 GLY GLY C . n C 1 66 VAL 66 365 365 VAL VAL C . n C 1 67 ASP 67 366 366 ASP ASP C . n C 1 68 LEU 68 367 367 LEU LEU C . n C 1 69 ARG 69 368 368 ARG ARG C . n C 1 70 ASN 70 369 369 ASN ASN C . n C 1 71 ALA 71 370 370 ALA ALA C . n C 1 72 SER 72 371 371 SER SER C . n C 1 73 HIS 73 372 372 HIS HIS C . n C 1 74 GLU 74 373 373 GLU GLU C . n C 1 75 GLN 75 374 374 GLN GLN C . n C 1 76 ALA 76 375 375 ALA ALA C . n C 1 77 ALA 77 376 376 ALA ALA C . n C 1 78 ILE 78 377 377 ILE ILE C . n C 1 79 ALA 79 378 378 ALA ALA C . n C 1 80 LEU 80 379 379 LEU LEU C . n C 1 81 LYS 81 380 380 LYS LYS C . n C 1 82 ASN 82 381 381 ASN ASN C . n C 1 83 ALA 83 382 382 ALA ALA C . n C 1 84 GLY 84 383 383 GLY GLY C . n C 1 85 GLN 85 384 384 GLN GLN C . n C 1 86 THR 86 385 385 THR THR C . n C 1 87 VAL 87 386 386 VAL VAL C . n C 1 88 THR 88 387 387 THR THR C . n C 1 89 ILE 89 388 388 ILE ILE C . n C 1 90 ILE 90 389 389 ILE ILE C . n C 1 91 ALA 91 390 390 ALA ALA C . n C 1 92 GLN 92 391 391 GLN GLN C . n C 1 93 TYR 93 392 392 TYR TYR C . n C 1 94 LYS 94 393 393 LYS LYS C . n C 1 95 PRO 95 394 394 PRO PRO C . n C 1 96 GLU 96 395 395 GLU GLU C . n C 1 97 GLU 97 396 396 GLU GLU C . n C 1 98 TYR 98 397 397 TYR TYR C . n C 1 99 SER 99 398 398 SER SER C . n C 1 100 ARG 100 399 399 ARG ARG C . n C 1 101 PHE 101 400 400 PHE PHE C . n C 1 102 GLU 102 401 401 GLU GLU C . n C 1 103 ALA 103 402 ? ? ? C . n C 1 104 LYS 104 403 ? ? ? C . n D 1 1 MET 1 300 ? ? ? D . n D 1 2 GLY 2 301 ? ? ? D . n D 1 3 LEU 3 302 ? ? ? D . n D 1 4 GLY 4 303 ? ? ? D . n D 1 5 GLU 5 304 ? ? ? D . n D 1 6 GLU 6 305 ? ? ? D . n D 1 7 ASP 7 306 ? ? ? D . n D 1 8 ILE 8 307 ? ? ? D . n D 1 9 PRO 9 308 ? ? ? D . n D 1 10 ARG 10 309 309 ARG ARG D . n D 1 11 GLU 11 310 310 GLU GLU D . n D 1 12 PRO 12 311 311 PRO PRO D . n D 1 13 ARG 13 312 312 ARG ARG D . n D 1 14 ARG 14 313 313 ARG ARG D . n D 1 15 ILE 15 314 314 ILE ILE D . n D 1 16 VAL 16 315 315 VAL VAL D . n D 1 17 ILE 17 316 316 ILE ILE D . n D 1 18 HIS 18 317 317 HIS HIS D . n D 1 19 ARG 19 318 318 ARG ARG D . n D 1 20 GLY 20 319 319 GLY GLY D . n D 1 21 SER 21 320 320 SER SER D . n D 1 22 THR 22 321 321 THR THR D . n D 1 23 GLY 23 322 322 GLY GLY D . n D 1 24 LEU 24 323 323 LEU LEU D . n D 1 25 GLY 25 324 324 GLY GLY D . n D 1 26 PHE 26 325 325 PHE PHE D . n D 1 27 ASN 27 326 326 ASN ASN D . n D 1 28 ILE 28 327 327 ILE ILE D . n D 1 29 VAL 29 328 328 VAL VAL D . n D 1 30 GLY 30 329 329 GLY GLY D . n D 1 31 GLY 31 330 330 GLY GLY D . n D 1 32 GLU 32 331 331 GLU GLU D . n D 1 33 ASP 33 332 332 ASP ASP D . n D 1 34 GLY 34 333 333 GLY GLY D . n D 1 35 GLU 35 334 334 GLU GLU D . n D 1 36 GLY 36 335 335 GLY GLY D . n D 1 37 ILE 37 336 336 ILE ILE D . n D 1 38 PHE 38 337 337 PHE PHE D . n D 1 39 ILE 39 338 338 ILE ILE D . n D 1 40 SER 40 339 339 SER SER D . n D 1 41 PHE 41 340 340 PHE PHE D . n D 1 42 ILE 42 341 341 ILE ILE D . n D 1 43 LEU 43 342 342 LEU LEU D . n D 1 44 ALA 44 343 343 ALA ALA D . n D 1 45 GLY 45 344 344 GLY GLY D . n D 1 46 GLY 46 345 345 GLY GLY D . n D 1 47 PRO 47 346 346 PRO PRO D . n D 1 48 ALA 48 347 347 ALA ALA D . n D 1 49 ASP 49 348 348 ASP ASP D . n D 1 50 LEU 50 349 349 LEU LEU D . n D 1 51 SER 51 350 350 SER SER D . n D 1 52 GLY 52 351 351 GLY GLY D . n D 1 53 GLU 53 352 352 GLU GLU D . n D 1 54 LEU 54 353 353 LEU LEU D . n D 1 55 ARG 55 354 354 ARG ARG D . n D 1 56 LYS 56 355 355 LYS LYS D . n D 1 57 GLY 57 356 356 GLY GLY D . n D 1 58 ASP 58 357 357 ASP ASP D . n D 1 59 GLN 59 358 358 GLN GLN D . n D 1 60 ILE 60 359 359 ILE ILE D . n D 1 61 LEU 61 360 360 LEU LEU D . n D 1 62 SER 62 361 361 SER SER D . n D 1 63 VAL 63 362 362 VAL VAL D . n D 1 64 ASN 64 363 363 ASN ASN D . n D 1 65 GLY 65 364 364 GLY GLY D . n D 1 66 VAL 66 365 365 VAL VAL D . n D 1 67 ASP 67 366 366 ASP ASP D . n D 1 68 LEU 68 367 367 LEU LEU D . n D 1 69 ARG 69 368 368 ARG ARG D . n D 1 70 ASN 70 369 369 ASN ASN D . n D 1 71 ALA 71 370 370 ALA ALA D . n D 1 72 SER 72 371 371 SER SER D . n D 1 73 HIS 73 372 372 HIS HIS D . n D 1 74 GLU 74 373 373 GLU GLU D . n D 1 75 GLN 75 374 374 GLN GLN D . n D 1 76 ALA 76 375 375 ALA ALA D . n D 1 77 ALA 77 376 376 ALA ALA D . n D 1 78 ILE 78 377 377 ILE ILE D . n D 1 79 ALA 79 378 378 ALA ALA D . n D 1 80 LEU 80 379 379 LEU LEU D . n D 1 81 LYS 81 380 380 LYS LYS D . n D 1 82 ASN 82 381 381 ASN ASN D . n D 1 83 ALA 83 382 382 ALA ALA D . n D 1 84 GLY 84 383 383 GLY GLY D . n D 1 85 GLN 85 384 384 GLN GLN D . n D 1 86 THR 86 385 385 THR THR D . n D 1 87 VAL 87 386 386 VAL VAL D . n D 1 88 THR 88 387 387 THR THR D . n D 1 89 ILE 89 388 388 ILE ILE D . n D 1 90 ILE 90 389 389 ILE ILE D . n D 1 91 ALA 91 390 390 ALA ALA D . n D 1 92 GLN 92 391 391 GLN GLN D . n D 1 93 TYR 93 392 392 TYR TYR D . n D 1 94 LYS 94 393 393 LYS LYS D . n D 1 95 PRO 95 394 394 PRO PRO D . n D 1 96 GLU 96 395 395 GLU GLU D . n D 1 97 GLU 97 396 396 GLU GLU D . n D 1 98 TYR 98 397 397 TYR TYR D . n D 1 99 SER 99 398 398 SER SER D . n D 1 100 ARG 100 399 399 ARG ARG D . n D 1 101 PHE 101 400 400 PHE PHE D . n D 1 102 GLU 102 401 ? ? ? D . n D 1 103 ALA 103 402 ? ? ? D . n D 1 104 LYS 104 403 ? ? ? D . n E 1 1 MET 1 300 ? ? ? E . n E 1 2 GLY 2 301 ? ? ? E . n E 1 3 LEU 3 302 ? ? ? E . n E 1 4 GLY 4 303 ? ? ? E . n E 1 5 GLU 5 304 ? ? ? E . n E 1 6 GLU 6 305 ? ? ? E . n E 1 7 ASP 7 306 ? ? ? E . n E 1 8 ILE 8 307 ? ? ? E . n E 1 9 PRO 9 308 ? ? ? E . n E 1 10 ARG 10 309 309 ARG ARG E . n E 1 11 GLU 11 310 310 GLU GLU E . n E 1 12 PRO 12 311 311 PRO PRO E . n E 1 13 ARG 13 312 312 ARG ARG E . n E 1 14 ARG 14 313 313 ARG ARG E . n E 1 15 ILE 15 314 314 ILE ILE E . n E 1 16 VAL 16 315 315 VAL VAL E . n E 1 17 ILE 17 316 316 ILE ILE E . n E 1 18 HIS 18 317 317 HIS HIS E . n E 1 19 ARG 19 318 318 ARG ARG E . n E 1 20 GLY 20 319 319 GLY GLY E . n E 1 21 SER 21 320 320 SER SER E . n E 1 22 THR 22 321 321 THR THR E . n E 1 23 GLY 23 322 322 GLY GLY E . n E 1 24 LEU 24 323 323 LEU LEU E . n E 1 25 GLY 25 324 324 GLY GLY E . n E 1 26 PHE 26 325 325 PHE PHE E . n E 1 27 ASN 27 326 326 ASN ASN E . n E 1 28 ILE 28 327 327 ILE ILE E . n E 1 29 VAL 29 328 328 VAL VAL E . n E 1 30 GLY 30 329 329 GLY GLY E . n E 1 31 GLY 31 330 330 GLY GLY E . n E 1 32 GLU 32 331 331 GLU GLU E . n E 1 33 ASP 33 332 332 ASP ASP E . n E 1 34 GLY 34 333 333 GLY GLY E . n E 1 35 GLU 35 334 334 GLU GLU E . n E 1 36 GLY 36 335 335 GLY GLY E . n E 1 37 ILE 37 336 336 ILE ILE E . n E 1 38 PHE 38 337 337 PHE PHE E . n E 1 39 ILE 39 338 338 ILE ILE E . n E 1 40 SER 40 339 339 SER SER E . n E 1 41 PHE 41 340 340 PHE PHE E . n E 1 42 ILE 42 341 341 ILE ILE E . n E 1 43 LEU 43 342 342 LEU LEU E . n E 1 44 ALA 44 343 343 ALA ALA E . n E 1 45 GLY 45 344 344 GLY GLY E . n E 1 46 GLY 46 345 345 GLY GLY E . n E 1 47 PRO 47 346 346 PRO PRO E . n E 1 48 ALA 48 347 347 ALA ALA E . n E 1 49 ASP 49 348 348 ASP ASP E . n E 1 50 LEU 50 349 349 LEU LEU E . n E 1 51 SER 51 350 350 SER SER E . n E 1 52 GLY 52 351 351 GLY GLY E . n E 1 53 GLU 53 352 352 GLU GLU E . n E 1 54 LEU 54 353 353 LEU LEU E . n E 1 55 ARG 55 354 354 ARG ARG E . n E 1 56 LYS 56 355 355 LYS LYS E . n E 1 57 GLY 57 356 356 GLY GLY E . n E 1 58 ASP 58 357 357 ASP ASP E . n E 1 59 GLN 59 358 358 GLN GLN E . n E 1 60 ILE 60 359 359 ILE ILE E . n E 1 61 LEU 61 360 360 LEU LEU E . n E 1 62 SER 62 361 361 SER SER E . n E 1 63 VAL 63 362 362 VAL VAL E . n E 1 64 ASN 64 363 363 ASN ASN E . n E 1 65 GLY 65 364 364 GLY GLY E . n E 1 66 VAL 66 365 365 VAL VAL E . n E 1 67 ASP 67 366 366 ASP ASP E . n E 1 68 LEU 68 367 367 LEU LEU E . n E 1 69 ARG 69 368 368 ARG ARG E . n E 1 70 ASN 70 369 369 ASN ASN E . n E 1 71 ALA 71 370 370 ALA ALA E . n E 1 72 SER 72 371 371 SER SER E . n E 1 73 HIS 73 372 372 HIS HIS E . n E 1 74 GLU 74 373 373 GLU GLU E . n E 1 75 GLN 75 374 374 GLN GLN E . n E 1 76 ALA 76 375 375 ALA ALA E . n E 1 77 ALA 77 376 376 ALA ALA E . n E 1 78 ILE 78 377 377 ILE ILE E . n E 1 79 ALA 79 378 378 ALA ALA E . n E 1 80 LEU 80 379 379 LEU LEU E . n E 1 81 LYS 81 380 380 LYS LYS E . n E 1 82 ASN 82 381 381 ASN ASN E . n E 1 83 ALA 83 382 382 ALA ALA E . n E 1 84 GLY 84 383 383 GLY GLY E . n E 1 85 GLN 85 384 384 GLN GLN E . n E 1 86 THR 86 385 385 THR THR E . n E 1 87 VAL 87 386 386 VAL VAL E . n E 1 88 THR 88 387 387 THR THR E . n E 1 89 ILE 89 388 388 ILE ILE E . n E 1 90 ILE 90 389 389 ILE ILE E . n E 1 91 ALA 91 390 390 ALA ALA E . n E 1 92 GLN 92 391 391 GLN GLN E . n E 1 93 TYR 93 392 392 TYR TYR E . n E 1 94 LYS 94 393 393 LYS LYS E . n E 1 95 PRO 95 394 394 PRO PRO E . n E 1 96 GLU 96 395 395 GLU GLU E . n E 1 97 GLU 97 396 396 GLU GLU E . n E 1 98 TYR 98 397 397 TYR TYR E . n E 1 99 SER 99 398 398 SER SER E . n E 1 100 ARG 100 399 399 ARG ARG E . n E 1 101 PHE 101 400 400 PHE PHE E . n E 1 102 GLU 102 401 401 GLU GLU E . n E 1 103 ALA 103 402 402 ALA ALA E . n E 1 104 LYS 104 403 ? ? ? E . n F 1 1 MET 1 300 ? ? ? F . n F 1 2 GLY 2 301 ? ? ? F . n F 1 3 LEU 3 302 ? ? ? F . n F 1 4 GLY 4 303 ? ? ? F . n F 1 5 GLU 5 304 ? ? ? F . n F 1 6 GLU 6 305 ? ? ? F . n F 1 7 ASP 7 306 ? ? ? F . n F 1 8 ILE 8 307 ? ? ? F . n F 1 9 PRO 9 308 308 PRO PRO F . n F 1 10 ARG 10 309 309 ARG ARG F . n F 1 11 GLU 11 310 310 GLU GLU F . n F 1 12 PRO 12 311 311 PRO PRO F . n F 1 13 ARG 13 312 312 ARG ARG F . n F 1 14 ARG 14 313 313 ARG ARG F . n F 1 15 ILE 15 314 314 ILE ILE F . n F 1 16 VAL 16 315 315 VAL VAL F . n F 1 17 ILE 17 316 316 ILE ILE F . n F 1 18 HIS 18 317 317 HIS HIS F . n F 1 19 ARG 19 318 318 ARG ARG F . n F 1 20 GLY 20 319 319 GLY GLY F . n F 1 21 SER 21 320 320 SER SER F . n F 1 22 THR 22 321 321 THR THR F . n F 1 23 GLY 23 322 322 GLY GLY F . n F 1 24 LEU 24 323 323 LEU LEU F . n F 1 25 GLY 25 324 324 GLY GLY F . n F 1 26 PHE 26 325 325 PHE PHE F . n F 1 27 ASN 27 326 326 ASN ASN F . n F 1 28 ILE 28 327 327 ILE ILE F . n F 1 29 VAL 29 328 328 VAL VAL F . n F 1 30 GLY 30 329 329 GLY GLY F . n F 1 31 GLY 31 330 330 GLY GLY F . n F 1 32 GLU 32 331 331 GLU GLU F . n F 1 33 ASP 33 332 332 ASP ASP F . n F 1 34 GLY 34 333 333 GLY GLY F . n F 1 35 GLU 35 334 334 GLU GLU F . n F 1 36 GLY 36 335 335 GLY GLY F . n F 1 37 ILE 37 336 336 ILE ILE F . n F 1 38 PHE 38 337 337 PHE PHE F . n F 1 39 ILE 39 338 338 ILE ILE F . n F 1 40 SER 40 339 339 SER SER F . n F 1 41 PHE 41 340 340 PHE PHE F . n F 1 42 ILE 42 341 341 ILE ILE F . n F 1 43 LEU 43 342 342 LEU LEU F . n F 1 44 ALA 44 343 343 ALA ALA F . n F 1 45 GLY 45 344 344 GLY GLY F . n F 1 46 GLY 46 345 345 GLY GLY F . n F 1 47 PRO 47 346 346 PRO PRO F . n F 1 48 ALA 48 347 347 ALA ALA F . n F 1 49 ASP 49 348 348 ASP ASP F . n F 1 50 LEU 50 349 349 LEU LEU F . n F 1 51 SER 51 350 350 SER SER F . n F 1 52 GLY 52 351 351 GLY GLY F . n F 1 53 GLU 53 352 352 GLU GLU F . n F 1 54 LEU 54 353 353 LEU LEU F . n F 1 55 ARG 55 354 354 ARG ARG F . n F 1 56 LYS 56 355 355 LYS LYS F . n F 1 57 GLY 57 356 356 GLY GLY F . n F 1 58 ASP 58 357 357 ASP ASP F . n F 1 59 GLN 59 358 358 GLN GLN F . n F 1 60 ILE 60 359 359 ILE ILE F . n F 1 61 LEU 61 360 360 LEU LEU F . n F 1 62 SER 62 361 361 SER SER F . n F 1 63 VAL 63 362 362 VAL VAL F . n F 1 64 ASN 64 363 363 ASN ASN F . n F 1 65 GLY 65 364 364 GLY GLY F . n F 1 66 VAL 66 365 365 VAL VAL F . n F 1 67 ASP 67 366 366 ASP ASP F . n F 1 68 LEU 68 367 367 LEU LEU F . n F 1 69 ARG 69 368 368 ARG ARG F . n F 1 70 ASN 70 369 369 ASN ASN F . n F 1 71 ALA 71 370 370 ALA ALA F . n F 1 72 SER 72 371 371 SER SER F . n F 1 73 HIS 73 372 372 HIS HIS F . n F 1 74 GLU 74 373 373 GLU GLU F . n F 1 75 GLN 75 374 374 GLN GLN F . n F 1 76 ALA 76 375 375 ALA ALA F . n F 1 77 ALA 77 376 376 ALA ALA F . n F 1 78 ILE 78 377 377 ILE ILE F . n F 1 79 ALA 79 378 378 ALA ALA F . n F 1 80 LEU 80 379 379 LEU LEU F . n F 1 81 LYS 81 380 380 LYS LYS F . n F 1 82 ASN 82 381 381 ASN ASN F . n F 1 83 ALA 83 382 382 ALA ALA F . n F 1 84 GLY 84 383 383 GLY GLY F . n F 1 85 GLN 85 384 384 GLN GLN F . n F 1 86 THR 86 385 385 THR THR F . n F 1 87 VAL 87 386 386 VAL VAL F . n F 1 88 THR 88 387 387 THR THR F . n F 1 89 ILE 89 388 388 ILE ILE F . n F 1 90 ILE 90 389 389 ILE ILE F . n F 1 91 ALA 91 390 390 ALA ALA F . n F 1 92 GLN 92 391 391 GLN GLN F . n F 1 93 TYR 93 392 392 TYR TYR F . n F 1 94 LYS 94 393 393 LYS LYS F . n F 1 95 PRO 95 394 394 PRO PRO F . n F 1 96 GLU 96 395 395 GLU GLU F . n F 1 97 GLU 97 396 396 GLU GLU F . n F 1 98 TYR 98 397 397 TYR TYR F . n F 1 99 SER 99 398 398 SER SER F . n F 1 100 ARG 100 399 399 ARG ARG F . n F 1 101 PHE 101 400 400 PHE PHE F . n F 1 102 GLU 102 401 401 GLU GLU F . n F 1 103 ALA 103 402 402 ALA ALA F . n F 1 104 LYS 104 403 403 LYS LYS F . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code G 2 ACT 1 501 501 ACT ACT A . H 2 ACT 1 502 502 ACT ACT A . I 2 ACT 1 501 501 ACT ACT B . J 2 ACT 1 501 501 ACT ACT C . K 2 ACT 1 501 501 ACT ACT D . L 2 ACT 1 501 503 ACT ACT F . M 3 HOH 1 601 519 HOH HOH A . M 3 HOH 2 602 443 HOH HOH A . M 3 HOH 3 603 144 HOH HOH A . M 3 HOH 4 604 436 HOH HOH A . M 3 HOH 5 605 425 HOH HOH A . M 3 HOH 6 606 9 HOH HOH A . M 3 HOH 7 607 303 HOH HOH A . M 3 HOH 8 608 151 HOH HOH A . M 3 HOH 9 609 235 HOH HOH A . M 3 HOH 10 610 408 HOH HOH A . M 3 HOH 11 611 170 HOH HOH A . M 3 HOH 12 612 156 HOH HOH A . M 3 HOH 13 613 116 HOH HOH A . M 3 HOH 14 614 26 HOH HOH A . M 3 HOH 15 615 184 HOH HOH A . M 3 HOH 16 616 119 HOH HOH A . M 3 HOH 17 617 11 HOH HOH A . M 3 HOH 18 618 349 HOH HOH A . M 3 HOH 19 619 146 HOH HOH A . M 3 HOH 20 620 389 HOH HOH A . M 3 HOH 21 621 38 HOH HOH A . M 3 HOH 22 622 28 HOH HOH A . M 3 HOH 23 623 291 HOH HOH A . M 3 HOH 24 624 233 HOH HOH A . M 3 HOH 25 625 213 HOH HOH A . M 3 HOH 26 626 173 HOH HOH A . M 3 HOH 27 627 68 HOH HOH A . M 3 HOH 28 628 25 HOH HOH A . M 3 HOH 29 629 352 HOH HOH A . M 3 HOH 30 630 432 HOH HOH A . M 3 HOH 31 631 344 HOH HOH A . M 3 HOH 32 632 357 HOH HOH A . M 3 HOH 33 633 192 HOH HOH A . M 3 HOH 34 634 41 HOH HOH A . M 3 HOH 35 635 302 HOH HOH A . M 3 HOH 36 636 168 HOH HOH A . M 3 HOH 37 637 394 HOH HOH A . M 3 HOH 38 638 236 HOH HOH A . M 3 HOH 39 639 309 HOH HOH A . M 3 HOH 40 640 199 HOH HOH A . M 3 HOH 41 641 55 HOH HOH A . M 3 HOH 42 642 260 HOH HOH A . M 3 HOH 43 643 72 HOH HOH A . M 3 HOH 44 644 177 HOH HOH A . M 3 HOH 45 645 360 HOH HOH A . M 3 HOH 46 646 304 HOH HOH A . M 3 HOH 47 647 182 HOH HOH A . M 3 HOH 48 648 103 HOH HOH A . M 3 HOH 49 649 368 HOH HOH A . M 3 HOH 50 650 160 HOH HOH A . M 3 HOH 51 651 411 HOH HOH A . M 3 HOH 52 652 490 HOH HOH A . M 3 HOH 53 653 167 HOH HOH A . M 3 HOH 54 654 124 HOH HOH A . M 3 HOH 55 655 262 HOH HOH A . M 3 HOH 56 656 518 HOH HOH A . M 3 HOH 57 657 79 HOH HOH A . M 3 HOH 58 658 294 HOH HOH A . M 3 HOH 59 659 113 HOH HOH A . M 3 HOH 60 660 354 HOH HOH A . M 3 HOH 61 661 434 HOH HOH A . M 3 HOH 62 662 108 HOH HOH A . M 3 HOH 63 663 185 HOH HOH A . M 3 HOH 64 664 452 HOH HOH A . M 3 HOH 65 665 371 HOH HOH A . M 3 HOH 66 666 455 HOH HOH A . M 3 HOH 67 667 512 HOH HOH A . M 3 HOH 68 668 91 HOH HOH A . M 3 HOH 69 669 456 HOH HOH A . M 3 HOH 70 670 267 HOH HOH A . M 3 HOH 71 671 429 HOH HOH A . M 3 HOH 72 672 407 HOH HOH A . M 3 HOH 73 673 54 HOH HOH A . M 3 HOH 74 674 386 HOH HOH A . M 3 HOH 75 675 245 HOH HOH A . M 3 HOH 76 676 444 HOH HOH A . M 3 HOH 77 677 471 HOH HOH A . M 3 HOH 78 678 353 HOH HOH A . M 3 HOH 79 679 499 HOH HOH A . M 3 HOH 80 680 162 HOH HOH A . M 3 HOH 81 681 312 HOH HOH A . M 3 HOH 82 682 485 HOH HOH A . N 3 HOH 1 601 369 HOH HOH B . N 3 HOH 2 602 438 HOH HOH B . N 3 HOH 3 603 237 HOH HOH B . N 3 HOH 4 604 219 HOH HOH B . N 3 HOH 5 605 217 HOH HOH B . N 3 HOH 6 606 7 HOH HOH B . N 3 HOH 7 607 229 HOH HOH B . N 3 HOH 8 608 174 HOH HOH B . N 3 HOH 9 609 205 HOH HOH B . N 3 HOH 10 610 470 HOH HOH B . N 3 HOH 11 611 340 HOH HOH B . N 3 HOH 12 612 505 HOH HOH B . N 3 HOH 13 613 448 HOH HOH B . N 3 HOH 14 614 152 HOH HOH B . N 3 HOH 15 615 1 HOH HOH B . N 3 HOH 16 616 31 HOH HOH B . N 3 HOH 17 617 510 HOH HOH B . N 3 HOH 18 618 112 HOH HOH B . N 3 HOH 19 619 509 HOH HOH B . N 3 HOH 20 620 40 HOH HOH B . N 3 HOH 21 621 396 HOH HOH B . N 3 HOH 22 622 171 HOH HOH B . N 3 HOH 23 623 268 HOH HOH B . N 3 HOH 24 624 481 HOH HOH B . N 3 HOH 25 625 147 HOH HOH B . N 3 HOH 26 626 46 HOH HOH B . N 3 HOH 27 627 138 HOH HOH B . N 3 HOH 28 628 189 HOH HOH B . N 3 HOH 29 629 14 HOH HOH B . N 3 HOH 30 630 15 HOH HOH B . N 3 HOH 31 631 92 HOH HOH B . N 3 HOH 32 632 45 HOH HOH B . N 3 HOH 33 633 298 HOH HOH B . N 3 HOH 34 634 348 HOH HOH B . N 3 HOH 35 635 97 HOH HOH B . N 3 HOH 36 636 279 HOH HOH B . N 3 HOH 37 637 67 HOH HOH B . N 3 HOH 38 638 12 HOH HOH B . N 3 HOH 39 639 80 HOH HOH B . N 3 HOH 40 640 464 HOH HOH B . N 3 HOH 41 641 326 HOH HOH B . N 3 HOH 42 642 51 HOH HOH B . N 3 HOH 43 643 58 HOH HOH B . N 3 HOH 44 644 398 HOH HOH B . N 3 HOH 45 645 318 HOH HOH B . N 3 HOH 46 646 320 HOH HOH B . N 3 HOH 47 647 325 HOH HOH B . N 3 HOH 48 648 426 HOH HOH B . N 3 HOH 49 649 361 HOH HOH B . N 3 HOH 50 650 424 HOH HOH B . N 3 HOH 51 651 22 HOH HOH B . N 3 HOH 52 652 216 HOH HOH B . N 3 HOH 53 653 319 HOH HOH B . N 3 HOH 54 654 362 HOH HOH B . N 3 HOH 55 655 392 HOH HOH B . N 3 HOH 56 656 405 HOH HOH B . N 3 HOH 57 657 297 HOH HOH B . N 3 HOH 58 658 94 HOH HOH B . N 3 HOH 59 659 188 HOH HOH B . N 3 HOH 60 660 314 HOH HOH B . N 3 HOH 61 661 469 HOH HOH B . N 3 HOH 62 662 374 HOH HOH B . N 3 HOH 63 663 306 HOH HOH B . N 3 HOH 64 664 207 HOH HOH B . N 3 HOH 65 665 401 HOH HOH B . N 3 HOH 66 666 204 HOH HOH B . N 3 HOH 67 667 427 HOH HOH B . N 3 HOH 68 668 390 HOH HOH B . N 3 HOH 69 669 150 HOH HOH B . N 3 HOH 70 670 382 HOH HOH B . N 3 HOH 71 671 76 HOH HOH B . N 3 HOH 72 672 330 HOH HOH B . N 3 HOH 73 673 218 HOH HOH B . N 3 HOH 74 674 496 HOH HOH B . N 3 HOH 75 675 472 HOH HOH B . N 3 HOH 76 676 214 HOH HOH B . N 3 HOH 77 677 238 HOH HOH B . N 3 HOH 78 678 445 HOH HOH B . N 3 HOH 79 679 221 HOH HOH B . N 3 HOH 80 680 508 HOH HOH B . N 3 HOH 81 681 191 HOH HOH B . N 3 HOH 82 682 290 HOH HOH B . N 3 HOH 83 683 376 HOH HOH B . N 3 HOH 84 684 358 HOH HOH B . O 3 HOH 1 601 123 HOH HOH C . O 3 HOH 2 602 428 HOH HOH C . O 3 HOH 3 603 24 HOH HOH C . O 3 HOH 4 604 274 HOH HOH C . O 3 HOH 5 605 323 HOH HOH C . O 3 HOH 6 606 230 HOH HOH C . O 3 HOH 7 607 64 HOH HOH C . O 3 HOH 8 608 198 HOH HOH C . O 3 HOH 9 609 203 HOH HOH C . O 3 HOH 10 610 35 HOH HOH C . O 3 HOH 11 611 130 HOH HOH C . O 3 HOH 12 612 275 HOH HOH C . O 3 HOH 13 613 497 HOH HOH C . O 3 HOH 14 614 148 HOH HOH C . O 3 HOH 15 615 5 HOH HOH C . O 3 HOH 16 616 248 HOH HOH C . O 3 HOH 17 617 261 HOH HOH C . O 3 HOH 18 618 315 HOH HOH C . O 3 HOH 19 619 154 HOH HOH C . O 3 HOH 20 620 440 HOH HOH C . O 3 HOH 21 621 421 HOH HOH C . O 3 HOH 22 622 234 HOH HOH C . O 3 HOH 23 623 257 HOH HOH C . O 3 HOH 24 624 212 HOH HOH C . O 3 HOH 25 625 71 HOH HOH C . O 3 HOH 26 626 90 HOH HOH C . O 3 HOH 27 627 281 HOH HOH C . O 3 HOH 28 628 201 HOH HOH C . O 3 HOH 29 629 13 HOH HOH C . O 3 HOH 30 630 287 HOH HOH C . O 3 HOH 31 631 355 HOH HOH C . O 3 HOH 32 632 99 HOH HOH C . O 3 HOH 33 633 53 HOH HOH C . O 3 HOH 34 634 210 HOH HOH C . O 3 HOH 35 635 278 HOH HOH C . O 3 HOH 36 636 231 HOH HOH C . O 3 HOH 37 637 69 HOH HOH C . O 3 HOH 38 638 29 HOH HOH C . O 3 HOH 39 639 347 HOH HOH C . O 3 HOH 40 640 135 HOH HOH C . O 3 HOH 41 641 52 HOH HOH C . O 3 HOH 42 642 359 HOH HOH C . O 3 HOH 43 643 197 HOH HOH C . O 3 HOH 44 644 84 HOH HOH C . O 3 HOH 45 645 109 HOH HOH C . O 3 HOH 46 646 74 HOH HOH C . O 3 HOH 47 647 495 HOH HOH C . O 3 HOH 48 648 85 HOH HOH C . O 3 HOH 49 649 247 HOH HOH C . O 3 HOH 50 650 468 HOH HOH C . O 3 HOH 51 651 181 HOH HOH C . O 3 HOH 52 652 283 HOH HOH C . O 3 HOH 53 653 366 HOH HOH C . O 3 HOH 54 654 377 HOH HOH C . O 3 HOH 55 655 195 HOH HOH C . O 3 HOH 56 656 336 HOH HOH C . O 3 HOH 57 657 417 HOH HOH C . O 3 HOH 58 658 89 HOH HOH C . O 3 HOH 59 659 117 HOH HOH C . O 3 HOH 60 660 450 HOH HOH C . O 3 HOH 61 661 459 HOH HOH C . O 3 HOH 62 662 500 HOH HOH C . O 3 HOH 63 663 175 HOH HOH C . O 3 HOH 64 664 311 HOH HOH C . O 3 HOH 65 665 415 HOH HOH C . O 3 HOH 66 666 492 HOH HOH C . O 3 HOH 67 667 387 HOH HOH C . O 3 HOH 68 668 437 HOH HOH C . O 3 HOH 69 669 292 HOH HOH C . O 3 HOH 70 670 451 HOH HOH C . O 3 HOH 71 671 250 HOH HOH C . O 3 HOH 72 672 321 HOH HOH C . O 3 HOH 73 673 402 HOH HOH C . O 3 HOH 74 674 517 HOH HOH C . O 3 HOH 75 675 484 HOH HOH C . O 3 HOH 76 676 226 HOH HOH C . O 3 HOH 77 677 393 HOH HOH C . O 3 HOH 78 678 441 HOH HOH C . O 3 HOH 79 679 435 HOH HOH C . P 3 HOH 1 601 342 HOH HOH D . P 3 HOH 2 602 380 HOH HOH D . P 3 HOH 3 603 227 HOH HOH D . P 3 HOH 4 604 70 HOH HOH D . P 3 HOH 5 605 43 HOH HOH D . P 3 HOH 6 606 256 HOH HOH D . P 3 HOH 7 607 462 HOH HOH D . P 3 HOH 8 608 73 HOH HOH D . P 3 HOH 9 609 391 HOH HOH D . P 3 HOH 10 610 16 HOH HOH D . P 3 HOH 11 611 246 HOH HOH D . P 3 HOH 12 612 251 HOH HOH D . P 3 HOH 13 613 110 HOH HOH D . P 3 HOH 14 614 187 HOH HOH D . P 3 HOH 15 615 49 HOH HOH D . P 3 HOH 16 616 88 HOH HOH D . P 3 HOH 17 617 341 HOH HOH D . P 3 HOH 18 618 307 HOH HOH D . P 3 HOH 19 619 506 HOH HOH D . P 3 HOH 20 620 293 HOH HOH D . P 3 HOH 21 621 78 HOH HOH D . P 3 HOH 22 622 6 HOH HOH D . P 3 HOH 23 623 208 HOH HOH D . P 3 HOH 24 624 346 HOH HOH D . P 3 HOH 25 625 4 HOH HOH D . P 3 HOH 26 626 193 HOH HOH D . P 3 HOH 27 627 66 HOH HOH D . P 3 HOH 28 628 372 HOH HOH D . P 3 HOH 29 629 254 HOH HOH D . P 3 HOH 30 630 316 HOH HOH D . P 3 HOH 31 631 57 HOH HOH D . P 3 HOH 32 632 242 HOH HOH D . P 3 HOH 33 633 265 HOH HOH D . P 3 HOH 34 634 77 HOH HOH D . P 3 HOH 35 635 34 HOH HOH D . P 3 HOH 36 636 145 HOH HOH D . P 3 HOH 37 637 269 HOH HOH D . P 3 HOH 38 638 102 HOH HOH D . P 3 HOH 39 639 351 HOH HOH D . P 3 HOH 40 640 313 HOH HOH D . P 3 HOH 41 641 141 HOH HOH D . P 3 HOH 42 642 183 HOH HOH D . P 3 HOH 43 643 476 HOH HOH D . P 3 HOH 44 644 18 HOH HOH D . P 3 HOH 45 645 176 HOH HOH D . P 3 HOH 46 646 87 HOH HOH D . P 3 HOH 47 647 266 HOH HOH D . P 3 HOH 48 648 133 HOH HOH D . P 3 HOH 49 649 334 HOH HOH D . P 3 HOH 50 650 142 HOH HOH D . P 3 HOH 51 651 317 HOH HOH D . P 3 HOH 52 652 289 HOH HOH D . P 3 HOH 53 653 202 HOH HOH D . P 3 HOH 54 654 105 HOH HOH D . P 3 HOH 55 655 501 HOH HOH D . P 3 HOH 56 656 239 HOH HOH D . P 3 HOH 57 657 395 HOH HOH D . P 3 HOH 58 658 111 HOH HOH D . P 3 HOH 59 659 282 HOH HOH D . P 3 HOH 60 660 419 HOH HOH D . P 3 HOH 61 661 300 HOH HOH D . P 3 HOH 62 662 30 HOH HOH D . P 3 HOH 63 663 241 HOH HOH D . P 3 HOH 64 664 404 HOH HOH D . P 3 HOH 65 665 166 HOH HOH D . P 3 HOH 66 666 333 HOH HOH D . P 3 HOH 67 667 388 HOH HOH D . P 3 HOH 68 668 373 HOH HOH D . P 3 HOH 69 669 63 HOH HOH D . P 3 HOH 70 670 482 HOH HOH D . P 3 HOH 71 671 367 HOH HOH D . P 3 HOH 72 672 255 HOH HOH D . P 3 HOH 73 673 228 HOH HOH D . P 3 HOH 74 674 365 HOH HOH D . P 3 HOH 75 675 295 HOH HOH D . P 3 HOH 76 676 503 HOH HOH D . P 3 HOH 77 677 414 HOH HOH D . P 3 HOH 78 678 60 HOH HOH D . P 3 HOH 79 679 422 HOH HOH D . P 3 HOH 80 680 215 HOH HOH D . P 3 HOH 81 681 285 HOH HOH D . P 3 HOH 82 682 96 HOH HOH D . P 3 HOH 83 683 308 HOH HOH D . P 3 HOH 84 684 491 HOH HOH D . P 3 HOH 85 685 190 HOH HOH D . P 3 HOH 86 686 498 HOH HOH D . Q 3 HOH 1 501 335 HOH HOH E . Q 3 HOH 2 502 453 HOH HOH E . Q 3 HOH 3 503 460 HOH HOH E . Q 3 HOH 4 504 194 HOH HOH E . Q 3 HOH 5 505 331 HOH HOH E . Q 3 HOH 6 506 232 HOH HOH E . Q 3 HOH 7 507 134 HOH HOH E . Q 3 HOH 8 508 129 HOH HOH E . Q 3 HOH 9 509 186 HOH HOH E . Q 3 HOH 10 510 286 HOH HOH E . Q 3 HOH 11 511 59 HOH HOH E . Q 3 HOH 12 512 2 HOH HOH E . Q 3 HOH 13 513 345 HOH HOH E . Q 3 HOH 14 514 61 HOH HOH E . Q 3 HOH 15 515 32 HOH HOH E . Q 3 HOH 16 516 62 HOH HOH E . Q 3 HOH 17 517 75 HOH HOH E . Q 3 HOH 18 518 115 HOH HOH E . Q 3 HOH 19 519 324 HOH HOH E . Q 3 HOH 20 520 3 HOH HOH E . Q 3 HOH 21 521 378 HOH HOH E . Q 3 HOH 22 522 332 HOH HOH E . Q 3 HOH 23 523 273 HOH HOH E . Q 3 HOH 24 524 169 HOH HOH E . Q 3 HOH 25 525 385 HOH HOH E . Q 3 HOH 26 526 42 HOH HOH E . Q 3 HOH 27 527 488 HOH HOH E . Q 3 HOH 28 528 143 HOH HOH E . Q 3 HOH 29 529 21 HOH HOH E . Q 3 HOH 30 530 384 HOH HOH E . Q 3 HOH 31 531 220 HOH HOH E . Q 3 HOH 32 532 149 HOH HOH E . Q 3 HOH 33 533 467 HOH HOH E . Q 3 HOH 34 534 56 HOH HOH E . Q 3 HOH 35 535 19 HOH HOH E . Q 3 HOH 36 536 179 HOH HOH E . Q 3 HOH 37 537 17 HOH HOH E . Q 3 HOH 38 538 507 HOH HOH E . Q 3 HOH 39 539 95 HOH HOH E . Q 3 HOH 40 540 370 HOH HOH E . Q 3 HOH 41 541 83 HOH HOH E . Q 3 HOH 42 542 350 HOH HOH E . Q 3 HOH 43 543 137 HOH HOH E . Q 3 HOH 44 544 477 HOH HOH E . Q 3 HOH 45 545 486 HOH HOH E . Q 3 HOH 46 546 65 HOH HOH E . Q 3 HOH 47 547 44 HOH HOH E . Q 3 HOH 48 548 431 HOH HOH E . Q 3 HOH 49 549 416 HOH HOH E . Q 3 HOH 50 550 461 HOH HOH E . Q 3 HOH 51 551 20 HOH HOH E . Q 3 HOH 52 552 305 HOH HOH E . Q 3 HOH 53 553 413 HOH HOH E . Q 3 HOH 54 554 107 HOH HOH E . Q 3 HOH 55 555 516 HOH HOH E . Q 3 HOH 56 556 223 HOH HOH E . Q 3 HOH 57 557 126 HOH HOH E . Q 3 HOH 58 558 487 HOH HOH E . Q 3 HOH 59 559 252 HOH HOH E . Q 3 HOH 60 560 128 HOH HOH E . Q 3 HOH 61 561 264 HOH HOH E . Q 3 HOH 62 562 511 HOH HOH E . Q 3 HOH 63 563 125 HOH HOH E . Q 3 HOH 64 564 27 HOH HOH E . Q 3 HOH 65 565 513 HOH HOH E . Q 3 HOH 66 566 363 HOH HOH E . Q 3 HOH 67 567 356 HOH HOH E . Q 3 HOH 68 568 244 HOH HOH E . Q 3 HOH 69 569 259 HOH HOH E . Q 3 HOH 70 570 420 HOH HOH E . Q 3 HOH 71 571 98 HOH HOH E . Q 3 HOH 72 572 164 HOH HOH E . Q 3 HOH 73 573 409 HOH HOH E . Q 3 HOH 74 574 322 HOH HOH E . Q 3 HOH 75 575 310 HOH HOH E . Q 3 HOH 76 576 466 HOH HOH E . Q 3 HOH 77 577 502 HOH HOH E . Q 3 HOH 78 578 478 HOH HOH E . Q 3 HOH 79 579 100 HOH HOH E . Q 3 HOH 80 580 339 HOH HOH E . Q 3 HOH 81 581 178 HOH HOH E . Q 3 HOH 82 582 114 HOH HOH E . Q 3 HOH 83 583 337 HOH HOH E . Q 3 HOH 84 584 329 HOH HOH E . Q 3 HOH 85 585 447 HOH HOH E . Q 3 HOH 86 586 494 HOH HOH E . Q 3 HOH 87 587 489 HOH HOH E . Q 3 HOH 88 588 299 HOH HOH E . Q 3 HOH 89 589 514 HOH HOH E . Q 3 HOH 90 590 284 HOH HOH E . Q 3 HOH 91 591 480 HOH HOH E . Q 3 HOH 92 592 253 HOH HOH E . Q 3 HOH 93 593 200 HOH HOH E . Q 3 HOH 94 594 474 HOH HOH E . Q 3 HOH 95 595 327 HOH HOH E . Q 3 HOH 96 596 120 HOH HOH E . R 3 HOH 1 601 296 HOH HOH F . R 3 HOH 2 602 209 HOH HOH F . R 3 HOH 3 603 222 HOH HOH F . R 3 HOH 4 604 104 HOH HOH F . R 3 HOH 5 605 271 HOH HOH F . R 3 HOH 6 606 158 HOH HOH F . R 3 HOH 7 607 23 HOH HOH F . R 3 HOH 8 608 121 HOH HOH F . R 3 HOH 9 609 263 HOH HOH F . R 3 HOH 10 610 465 HOH HOH F . R 3 HOH 11 611 140 HOH HOH F . R 3 HOH 12 612 159 HOH HOH F . R 3 HOH 13 613 81 HOH HOH F . R 3 HOH 14 614 280 HOH HOH F . R 3 HOH 15 615 249 HOH HOH F . R 3 HOH 16 616 433 HOH HOH F . R 3 HOH 17 617 50 HOH HOH F . R 3 HOH 18 618 504 HOH HOH F . R 3 HOH 19 619 101 HOH HOH F . R 3 HOH 20 620 8 HOH HOH F . R 3 HOH 21 621 36 HOH HOH F . R 3 HOH 22 622 127 HOH HOH F . R 3 HOH 23 623 399 HOH HOH F . R 3 HOH 24 624 86 HOH HOH F . R 3 HOH 25 625 520 HOH HOH F . R 3 HOH 26 626 240 HOH HOH F . R 3 HOH 27 627 328 HOH HOH F . R 3 HOH 28 628 118 HOH HOH F . R 3 HOH 29 629 153 HOH HOH F . R 3 HOH 30 630 136 HOH HOH F . R 3 HOH 31 631 301 HOH HOH F . R 3 HOH 32 632 483 HOH HOH F . R 3 HOH 33 633 397 HOH HOH F . R 3 HOH 34 634 82 HOH HOH F . R 3 HOH 35 635 379 HOH HOH F . R 3 HOH 36 636 224 HOH HOH F . R 3 HOH 37 637 106 HOH HOH F . R 3 HOH 38 638 33 HOH HOH F . R 3 HOH 39 639 10 HOH HOH F . R 3 HOH 40 640 39 HOH HOH F . R 3 HOH 41 641 458 HOH HOH F . R 3 HOH 42 642 406 HOH HOH F . R 3 HOH 43 643 276 HOH HOH F . R 3 HOH 44 644 157 HOH HOH F . R 3 HOH 45 645 243 HOH HOH F . R 3 HOH 46 646 383 HOH HOH F . R 3 HOH 47 647 211 HOH HOH F . R 3 HOH 48 648 479 HOH HOH F . R 3 HOH 49 649 196 HOH HOH F . R 3 HOH 50 650 37 HOH HOH F . R 3 HOH 51 651 48 HOH HOH F . R 3 HOH 52 652 206 HOH HOH F . R 3 HOH 53 653 270 HOH HOH F . R 3 HOH 54 654 47 HOH HOH F . R 3 HOH 55 655 93 HOH HOH F . R 3 HOH 56 656 155 HOH HOH F . R 3 HOH 57 657 131 HOH HOH F . R 3 HOH 58 658 343 HOH HOH F . R 3 HOH 59 659 161 HOH HOH F . R 3 HOH 60 660 449 HOH HOH F . R 3 HOH 61 661 403 HOH HOH F . R 3 HOH 62 662 381 HOH HOH F . R 3 HOH 63 663 180 HOH HOH F . R 3 HOH 64 664 412 HOH HOH F . R 3 HOH 65 665 122 HOH HOH F . R 3 HOH 66 666 165 HOH HOH F . R 3 HOH 67 667 338 HOH HOH F . R 3 HOH 68 668 163 HOH HOH F . R 3 HOH 69 669 400 HOH HOH F . R 3 HOH 70 670 225 HOH HOH F . R 3 HOH 71 671 132 HOH HOH F . R 3 HOH 72 672 277 HOH HOH F . R 3 HOH 73 673 288 HOH HOH F . R 3 HOH 74 674 515 HOH HOH F . R 3 HOH 75 675 454 HOH HOH F . R 3 HOH 76 676 410 HOH HOH F . R 3 HOH 77 677 442 HOH HOH F . R 3 HOH 78 678 457 HOH HOH F . R 3 HOH 79 679 418 HOH HOH F . R 3 HOH 80 680 423 HOH HOH F . R 3 HOH 81 681 473 HOH HOH F . R 3 HOH 82 682 364 HOH HOH F . R 3 HOH 83 683 258 HOH HOH F . R 3 HOH 84 684 475 HOH HOH F . R 3 HOH 85 685 139 HOH HOH F . R 3 HOH 86 686 172 HOH HOH F . R 3 HOH 87 687 439 HOH HOH F . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 320 ? OG ? A SER 21 OG 2 1 Y 1 A THR 321 ? OG1 ? A THR 22 OG1 3 1 Y 1 A THR 321 ? CG2 ? A THR 22 CG2 4 1 Y 1 A LYS 355 ? CG ? A LYS 56 CG 5 1 Y 1 A LYS 355 ? CD ? A LYS 56 CD 6 1 Y 1 A LYS 355 ? CE ? A LYS 56 CE 7 1 Y 1 A LYS 355 ? NZ ? A LYS 56 NZ 8 1 Y 1 A GLN 384 ? CG ? A GLN 85 CG 9 1 Y 1 A GLN 384 ? CD ? A GLN 85 CD 10 1 Y 1 A GLN 384 ? OE1 ? A GLN 85 OE1 11 1 Y 1 A GLN 384 ? NE2 ? A GLN 85 NE2 12 1 Y 1 A GLU 396 ? CG ? A GLU 97 CG 13 1 Y 1 A GLU 396 ? CD ? A GLU 97 CD 14 1 Y 1 A GLU 396 ? OE1 ? A GLU 97 OE1 15 1 Y 1 A GLU 396 ? OE2 ? A GLU 97 OE2 16 1 Y 1 B ILE 307 ? CG1 ? B ILE 8 CG1 17 1 Y 1 B ILE 307 ? CG2 ? B ILE 8 CG2 18 1 Y 1 B ILE 307 ? CD1 ? B ILE 8 CD1 19 1 Y 1 B ARG 309 ? CG ? B ARG 10 CG 20 1 Y 1 B ARG 309 ? CD ? B ARG 10 CD 21 1 Y 1 B ARG 309 ? NE ? B ARG 10 NE 22 1 Y 1 B ARG 309 ? CZ ? B ARG 10 CZ 23 1 Y 1 B ARG 309 ? NH1 ? B ARG 10 NH1 24 1 Y 1 B ARG 309 ? NH2 ? B ARG 10 NH2 25 1 Y 1 B GLU 310 ? CG ? B GLU 11 CG 26 1 Y 1 B GLU 310 ? CD ? B GLU 11 CD 27 1 Y 1 B GLU 310 ? OE1 ? B GLU 11 OE1 28 1 Y 1 B GLU 310 ? OE2 ? B GLU 11 OE2 29 1 Y 1 B LYS 355 ? CG ? B LYS 56 CG 30 1 Y 1 B LYS 355 ? CD ? B LYS 56 CD 31 1 Y 1 B LYS 355 ? CE ? B LYS 56 CE 32 1 Y 1 B LYS 355 ? NZ ? B LYS 56 NZ 33 1 Y 1 B ARG 368 ? CG ? B ARG 69 CG 34 1 Y 1 B ARG 368 ? CD ? B ARG 69 CD 35 1 Y 1 B ARG 368 ? NE ? B ARG 69 NE 36 1 Y 1 B ARG 368 ? CZ ? B ARG 69 CZ 37 1 Y 1 B ARG 368 ? NH1 ? B ARG 69 NH1 38 1 Y 1 B ARG 368 ? NH2 ? B ARG 69 NH2 39 1 Y 1 B ASN 369 ? CG ? B ASN 70 CG 40 1 Y 1 B ASN 369 ? OD1 ? B ASN 70 OD1 41 1 Y 1 B ASN 369 ? ND2 ? B ASN 70 ND2 42 1 Y 1 B GLU 395 ? CG ? B GLU 96 CG 43 1 Y 1 B GLU 395 ? CD ? B GLU 96 CD 44 1 Y 1 B GLU 395 ? OE1 ? B GLU 96 OE1 45 1 Y 1 B GLU 395 ? OE2 ? B GLU 96 OE2 46 1 Y 1 C GLU 331 ? CG ? C GLU 32 CG 47 1 Y 1 C GLU 331 ? CD ? C GLU 32 CD 48 1 Y 1 C GLU 331 ? OE1 ? C GLU 32 OE1 49 1 Y 1 C GLU 331 ? OE2 ? C GLU 32 OE2 50 1 Y 1 C GLU 373 ? CG ? C GLU 74 CG 51 1 Y 1 C GLU 373 ? CD ? C GLU 74 CD 52 1 Y 1 C GLU 373 ? OE1 ? C GLU 74 OE1 53 1 Y 1 C GLU 373 ? OE2 ? C GLU 74 OE2 54 1 Y 1 C GLN 384 ? CG ? C GLN 85 CG 55 1 Y 1 C GLN 384 ? CD ? C GLN 85 CD 56 1 Y 1 C GLN 384 ? OE1 ? C GLN 85 OE1 57 1 Y 1 C GLN 384 ? NE2 ? C GLN 85 NE2 58 1 Y 1 C GLU 401 ? CG ? C GLU 102 CG 59 1 Y 1 C GLU 401 ? CD ? C GLU 102 CD 60 1 Y 1 C GLU 401 ? OE1 ? C GLU 102 OE1 61 1 Y 1 C GLU 401 ? OE2 ? C GLU 102 OE2 62 1 Y 1 D ARG 309 ? CG ? D ARG 10 CG 63 1 Y 1 D ARG 309 ? CD ? D ARG 10 CD 64 1 Y 1 D ARG 309 ? NE ? D ARG 10 NE 65 1 Y 1 D ARG 309 ? CZ ? D ARG 10 CZ 66 1 Y 1 D ARG 309 ? NH1 ? D ARG 10 NH1 67 1 Y 1 D ARG 309 ? NH2 ? D ARG 10 NH2 68 1 Y 1 D GLU 310 ? CG ? D GLU 11 CG 69 1 Y 1 D GLU 310 ? CD ? D GLU 11 CD 70 1 Y 1 D GLU 310 ? OE1 ? D GLU 11 OE1 71 1 Y 1 D GLU 310 ? OE2 ? D GLU 11 OE2 72 1 Y 1 D SER 320 ? OG ? D SER 21 OG 73 1 Y 1 D THR 321 ? OG1 ? D THR 22 OG1 74 1 Y 1 D THR 321 ? CG2 ? D THR 22 CG2 75 1 Y 1 D LYS 355 ? CG ? D LYS 56 CG 76 1 Y 1 D LYS 355 ? CD ? D LYS 56 CD 77 1 Y 1 D LYS 355 ? CE ? D LYS 56 CE 78 1 Y 1 D LYS 355 ? NZ ? D LYS 56 NZ 79 1 Y 1 D GLU 395 ? CG ? D GLU 96 CG 80 1 Y 1 D GLU 395 ? CD ? D GLU 96 CD 81 1 Y 1 D GLU 395 ? OE1 ? D GLU 96 OE1 82 1 Y 1 D GLU 395 ? OE2 ? D GLU 96 OE2 83 1 Y 1 D ARG 399 ? CG ? D ARG 100 CG 84 1 Y 1 D ARG 399 ? CD ? D ARG 100 CD 85 1 Y 1 D ARG 399 ? NE ? D ARG 100 NE 86 1 Y 1 D ARG 399 ? CZ ? D ARG 100 CZ 87 1 Y 1 D ARG 399 ? NH1 ? D ARG 100 NH1 88 1 Y 1 D ARG 399 ? NH2 ? D ARG 100 NH2 89 1 Y 1 E ARG 309 ? CG ? E ARG 10 CG 90 1 Y 1 E ARG 309 ? CD ? E ARG 10 CD 91 1 Y 1 E ARG 309 ? NE ? E ARG 10 NE 92 1 Y 1 E ARG 309 ? CZ ? E ARG 10 CZ 93 1 Y 1 E ARG 309 ? NH1 ? E ARG 10 NH1 94 1 Y 1 E ARG 309 ? NH2 ? E ARG 10 NH2 95 1 Y 1 E GLU 310 ? CG ? E GLU 11 CG 96 1 Y 1 E GLU 310 ? CD ? E GLU 11 CD 97 1 Y 1 E GLU 310 ? OE1 ? E GLU 11 OE1 98 1 Y 1 E GLU 310 ? OE2 ? E GLU 11 OE2 99 1 Y 1 E THR 321 ? OG1 ? E THR 22 OG1 100 1 Y 1 E THR 321 ? CG2 ? E THR 22 CG2 101 1 Y 1 E GLU 331 ? CG ? E GLU 32 CG 102 1 Y 1 E GLU 331 ? CD ? E GLU 32 CD 103 1 Y 1 E GLU 331 ? OE1 ? E GLU 32 OE1 104 1 Y 1 E GLU 331 ? OE2 ? E GLU 32 OE2 105 1 Y 1 E ARG 354 ? CG ? E ARG 55 CG 106 1 Y 1 E ARG 354 ? CD ? E ARG 55 CD 107 1 Y 1 E ARG 354 ? NE ? E ARG 55 NE 108 1 Y 1 E ARG 354 ? CZ ? E ARG 55 CZ 109 1 Y 1 E ARG 354 ? NH1 ? E ARG 55 NH1 110 1 Y 1 E ARG 354 ? NH2 ? E ARG 55 NH2 111 1 Y 1 E LYS 355 ? CG ? E LYS 56 CG 112 1 Y 1 E LYS 355 ? CD ? E LYS 56 CD 113 1 Y 1 E LYS 355 ? CE ? E LYS 56 CE 114 1 Y 1 E LYS 355 ? NZ ? E LYS 56 NZ 115 1 Y 1 E GLU 395 ? CG ? E GLU 96 CG 116 1 Y 1 E GLU 395 ? CD ? E GLU 96 CD 117 1 Y 1 E GLU 395 ? OE1 ? E GLU 96 OE1 118 1 Y 1 E GLU 395 ? OE2 ? E GLU 96 OE2 119 1 Y 1 F ARG 309 ? CG ? F ARG 10 CG 120 1 Y 1 F ARG 309 ? CD ? F ARG 10 CD 121 1 Y 1 F ARG 309 ? NE ? F ARG 10 NE 122 1 Y 1 F ARG 309 ? CZ ? F ARG 10 CZ 123 1 Y 1 F ARG 309 ? NH1 ? F ARG 10 NH1 124 1 Y 1 F ARG 309 ? NH2 ? F ARG 10 NH2 125 1 Y 1 F GLU 310 ? CG ? F GLU 11 CG 126 1 Y 1 F GLU 310 ? CD ? F GLU 11 CD 127 1 Y 1 F GLU 310 ? OE1 ? F GLU 11 OE1 128 1 Y 1 F GLU 310 ? OE2 ? F GLU 11 OE2 129 1 Y 1 F LYS 355 ? CG ? F LYS 56 CG 130 1 Y 1 F LYS 355 ? CD ? F LYS 56 CD 131 1 Y 1 F LYS 355 ? CE ? F LYS 56 CE 132 1 Y 1 F LYS 355 ? NZ ? F LYS 56 NZ 133 1 Y 1 F LYS 403 ? CG ? F LYS 104 CG 134 1 Y 1 F LYS 403 ? CD ? F LYS 104 CD 135 1 Y 1 F LYS 403 ? CE ? F LYS 104 CE 136 1 Y 1 F LYS 403 ? NZ ? F LYS 104 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8AH4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 61.698 _cell.length_a_esd ? _cell.length_b 61.698 _cell.length_b_esd ? _cell.length_c 228.702 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 36 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8AH4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 151 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 1 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8AH4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.88 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 34.52 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG4K, 0.2M AMSO4, 0.1M AcONa' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-11-18 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9677 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9677 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 16.730 _reflns.entry_id 8AH4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.478 _reflns.d_resolution_low 52.031 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 59113 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.9 _reflns.pdbx_Rmerge_I_obs 0.071 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 1.478 _reflns_shell.d_res_low 1.635 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2957 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.692 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.722 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 92.590 _refine.B_iso_mean 24.4110 _refine.B_iso_min 9.020 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8AH4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.4800 _refine.ls_d_res_low 48.4100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 58980 _refine.ls_number_reflns_R_free 2882 _refine.ls_number_reflns_R_work 56098 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 70.2500 _refine.ls_percent_reflns_R_free 4.8900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1966 _refine.ls_R_factor_R_free 0.2308 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1949 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6QJI _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.9400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.4800 _refine_hist.d_res_low 48.4100 _refine_hist.number_atoms_solvent 516 _refine_hist.number_atoms_total 4698 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 565 _refine_hist.pdbx_B_iso_mean_ligand 38.28 _refine_hist.pdbx_B_iso_mean_solvent 30.46 _refine_hist.pdbx_number_atoms_protein 4140 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 42 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 2179 8.376 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 2179 8.376 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 2179 8.376 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? D 2179 8.376 ? 1 'X-RAY DIFFRACTION' 5 ? ? ? ? ? 5 TORSIONAL ? E 2179 8.376 ? 1 'X-RAY DIFFRACTION' 6 ? ? ? ? ? 6 TORSIONAL ? F 2179 8.376 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.4800 1.5000 131 . 3 128 3.0000 . . . 0.4959 0.0000 0.3649 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 1.5000 1.5300 243 . 6 237 6.0000 . . . 0.4303 0.0000 0.2999 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 1.5300 1.5600 454 . 28 426 12.0000 . . . 0.3409 0.0000 0.3142 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 1.5600 1.5900 653 . 37 616 16.0000 . . . 0.4079 0.0000 0.2932 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 1.5900 1.6200 917 . 42 875 23.0000 . . . 0.3122 0.0000 0.2907 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 1.6200 1.6500 1206 . 78 1128 31.0000 . . . 0.3212 0.0000 0.2764 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 1.6500 1.6900 1622 . 74 1548 41.0000 . . . 0.3361 0.0000 0.2584 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 1.6900 1.7300 2817 . 142 2675 71.0000 . . . 0.2796 0.0000 0.2660 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 1.7300 1.7800 3625 . 183 3442 91.0000 . . . 0.2706 0.0000 0.2570 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 1.7800 1.8300 3915 . 176 3739 99.0000 . . . 0.2796 0.0000 0.2411 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 1.8300 1.8900 3960 . 192 3768 100.0000 . . . 0.2747 0.0000 0.2259 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 1.8900 1.9600 3996 . 171 3825 100.0000 . . . 0.2470 0.0000 0.2137 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 1.9600 2.0400 3982 . 185 3797 100.0000 . . . 0.2190 0.0000 0.1980 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 2.0400 2.1300 3995 . 207 3788 99.0000 . . . 0.2375 0.0000 0.1867 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 2.1300 2.2400 3942 . 199 3743 99.0000 . . . 0.2281 0.0000 0.1816 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 2.2400 2.3800 3967 . 214 3753 98.0000 . . . 0.2086 0.0000 0.1800 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 2.3900 2.5700 3925 . 174 3751 98.0000 . . . 0.2312 0.0000 0.1914 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 2.5700 2.8300 3845 . 189 3656 96.0000 . . . 0.2411 0.0000 0.1884 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 2.8300 3.2400 3688 . 163 3525 91.0000 . . . 0.1996 0.0000 0.1741 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 3.2400 4.0800 4054 . 215 3839 100.0000 . . . 0.2106 0.0000 0.1594 . . . . . . . 21 . . . 'X-RAY DIFFRACTION' 4.0800 48.4100 4043 . 204 3839 97.0000 . . . 0.2194 0.0000 0.2097 . . . . . . . 21 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and ((resid 309 through 310 and (name N or name CA or name C or name O or name CB )) or resid 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 2 ;(chain B and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or resid 369 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 3 ;(chain C and ((resid 309 through 310 and (name N or name CA or name C or name O or name CB )) or resid 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 4 ;(chain D and (resid 309 through 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 400)) ; 1 5 ;(chain E and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 6 ;(chain F and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A ARG 10 . A GLU 11 . A ARG 309 A GLU 310 ? ;(chain A and ((resid 309 through 310 and (name N or name CA or name C or name O or name CB )) or resid 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 1 2 A PRO 9 . A GLU 102 . A PRO 308 A GLU 401 ? ;(chain A and ((resid 309 through 310 and (name N or name CA or name C or name O or name CB )) or resid 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 1 3 A PRO 9 . A GLU 102 . A PRO 308 A GLU 401 ? ;(chain A and ((resid 309 through 310 and (name N or name CA or name C or name O or name CB )) or resid 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 1 4 A PRO 9 . A GLU 102 . A PRO 308 A GLU 401 ? ;(chain A and ((resid 309 through 310 and (name N or name CA or name C or name O or name CB )) or resid 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 1 5 A PRO 9 . A GLU 102 . A PRO 308 A GLU 401 ? ;(chain A and ((resid 309 through 310 and (name N or name CA or name C or name O or name CB )) or resid 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 2 1 B ARG 10 . B PRO 12 . B ARG 309 B PRO 311 ? ;(chain B and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or resid 369 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 2 2 B ARG 14 . B GLY 20 . B ARG 313 B GLY 319 ? ;(chain B and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or resid 369 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 2 3 B SER 21 . B THR 22 . B SER 320 B THR 321 ? ;(chain B and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or resid 369 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 2 4 B ILE 8 . I ACT . . B ILE 307 B ACT 501 ? ;(chain B and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or resid 369 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 2 5 B ILE 8 . I ACT . . B ILE 307 B ACT 501 ? ;(chain B and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or resid 369 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 2 6 B ILE 8 . I ACT . . B ILE 307 B ACT 501 ? ;(chain B and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or resid 369 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 2 7 B ILE 8 . I ACT . . B ILE 307 B ACT 501 ? ;(chain B and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or resid 369 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 3 1 C ARG 10 . C GLU 11 . C ARG 309 C GLU 310 ? ;(chain C and ((resid 309 through 310 and (name N or name CA or name C or name O or name CB )) or resid 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 3 2 C PRO 9 . C GLU 102 . C PRO 308 C GLU 401 ? ;(chain C and ((resid 309 through 310 and (name N or name CA or name C or name O or name CB )) or resid 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 3 3 C PRO 9 . C GLU 102 . C PRO 308 C GLU 401 ? ;(chain C and ((resid 309 through 310 and (name N or name CA or name C or name O or name CB )) or resid 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 3 4 C PRO 9 . C GLU 102 . C PRO 308 C GLU 401 ? ;(chain C and ((resid 309 through 310 and (name N or name CA or name C or name O or name CB )) or resid 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 3 5 C PRO 9 . C GLU 102 . C PRO 308 C GLU 401 ? ;(chain C and ((resid 309 through 310 and (name N or name CA or name C or name O or name CB )) or resid 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 4 1 D ARG 10 . D PRO 12 . D ARG 309 D PRO 311 ? ;(chain D and (resid 309 through 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 400)) ; 1 4 2 D ARG 14 . D GLY 31 . D ARG 313 D GLY 330 ? ;(chain D and (resid 309 through 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 400)) ; 1 4 3 D ASP 33 . D GLY 34 . D ASP 332 D GLY 333 ? ;(chain D and (resid 309 through 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 400)) ; 1 4 4 D GLY 36 . D LEU 54 . D GLY 335 D LEU 353 ? ;(chain D and (resid 309 through 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 400)) ; 1 4 5 D ARG 55 . D LYS 56 . D ARG 354 D LYS 355 ? ;(chain D and (resid 309 through 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 400)) ; 1 4 6 D ARG 10 . D PHE 101 . D ARG 309 D PHE 400 ? ;(chain D and (resid 309 through 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 400)) ; 1 4 7 D ARG 10 . D PHE 101 . D ARG 309 D PHE 400 ? ;(chain D and (resid 309 through 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 400)) ; 1 4 8 D ARG 10 . D PHE 101 . D ARG 309 D PHE 400 ? ;(chain D and (resid 309 through 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 400)) ; 1 4 9 D ARG 10 . D PHE 101 . D ARG 309 D PHE 400 ? ;(chain D and (resid 309 through 311 or resid 313 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 400)) ; 1 5 1 E ARG 10 . E PRO 12 . E ARG 309 E PRO 311 ? ;(chain E and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 5 2 E ARG 14 . E GLY 20 . E ARG 313 E GLY 319 ? ;(chain E and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 5 3 E SER 21 . E THR 22 . E SER 320 E THR 321 ? ;(chain E and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 5 4 E ARG 10 . E ALA 103 . E ARG 309 E ALA 402 ? ;(chain E and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 5 5 E ARG 10 . E ALA 103 . E ARG 309 E ALA 402 ? ;(chain E and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 5 6 E ARG 10 . E ALA 103 . E ARG 309 E ALA 402 ? ;(chain E and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 5 7 E ARG 10 . E ALA 103 . E ARG 309 E ALA 402 ? ;(chain E and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 395 or (resid 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 6 1 F ARG 10 . F PRO 12 . F ARG 309 F PRO 311 ? ;(chain F and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 6 2 F ARG 14 . F GLY 20 . F ARG 313 F GLY 319 ? ;(chain F and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 6 3 F SER 21 . F THR 22 . F SER 320 F THR 321 ? ;(chain F and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 6 4 F PRO 9 . F LYS 104 . F PRO 308 F LYS 403 ? ;(chain F and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 6 5 F PRO 9 . F LYS 104 . F PRO 308 F LYS 403 ? ;(chain F and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 6 6 F PRO 9 . F LYS 104 . F PRO 308 F LYS 403 ? ;(chain F and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; 1 6 7 F PRO 9 . F LYS 104 . F PRO 308 F LYS 403 ? ;(chain F and (resid 309 through 311 or resid 313 through 319 or (resid 320 through 321 and (name N or name CA or name C or name O or name CB )) or resid 322 through 330 or resid 332 through 333 or resid 335 through 353 or (resid 354 through 355 and (name N or name CA or name C or name O or name CB )) or resid 356 through 367 or (resid 369 through 370 and (name N or name CA or name C or name O or name CB )) or resid 371 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 383 or (resid 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 394 or (resid 395 through 396 and (name N or name CA or name C or name O or name CB )) or resid 397 through 398 or (resid 399 and (name N or name CA or name C or name O or name CB )) or resid 400)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 8AH4 _struct.title 'Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P3112 at pH 4.0' _struct.pdbx_model_details 'pH 4.0 P3112 polymorph' _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8AH4 _struct_keywords.text 'PDZ domain, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 2 ? K N N 2 ? L N N 2 ? M N N 3 ? N N N 3 ? O N N 3 ? P N N 3 ? Q N N 3 ? R N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B7Z4H2_HUMAN _struct_ref.pdbx_db_accession B7Z4H2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKN AGQTVTIIAQYKPEEYSRFEAK ; _struct_ref.pdbx_align_begin 242 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8AH4 A 3 ? 104 ? B7Z4H2 242 ? 343 ? 302 403 2 1 8AH4 B 3 ? 104 ? B7Z4H2 242 ? 343 ? 302 403 3 1 8AH4 C 3 ? 104 ? B7Z4H2 242 ? 343 ? 302 403 4 1 8AH4 D 3 ? 104 ? B7Z4H2 242 ? 343 ? 302 403 5 1 8AH4 E 3 ? 104 ? B7Z4H2 242 ? 343 ? 302 403 6 1 8AH4 F 3 ? 104 ? B7Z4H2 242 ? 343 ? 302 403 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8AH4 MET A 1 ? UNP B7Z4H2 ? ? 'initiating methionine' 300 1 1 8AH4 GLY A 2 ? UNP B7Z4H2 ? ? 'expression tag' 301 2 2 8AH4 MET B 1 ? UNP B7Z4H2 ? ? 'initiating methionine' 300 3 2 8AH4 GLY B 2 ? UNP B7Z4H2 ? ? 'expression tag' 301 4 3 8AH4 MET C 1 ? UNP B7Z4H2 ? ? 'initiating methionine' 300 5 3 8AH4 GLY C 2 ? UNP B7Z4H2 ? ? 'expression tag' 301 6 4 8AH4 MET D 1 ? UNP B7Z4H2 ? ? 'initiating methionine' 300 7 4 8AH4 GLY D 2 ? UNP B7Z4H2 ? ? 'expression tag' 301 8 5 8AH4 MET E 1 ? UNP B7Z4H2 ? ? 'initiating methionine' 300 9 5 8AH4 GLY E 2 ? UNP B7Z4H2 ? ? 'expression tag' 301 10 6 8AH4 MET F 1 ? UNP B7Z4H2 ? ? 'initiating methionine' 300 11 6 8AH4 GLY F 2 ? UNP B7Z4H2 ? ? 'expression tag' 301 12 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 author_defined_assembly ? monomeric 1 4 author_defined_assembly ? monomeric 1 5 author_defined_assembly ? monomeric 1 6 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,G,H,M 2 1 B,I,N 3 1 C,J,O 4 1 D,K,P 5 1 E,Q 6 1 F,L,R # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 46 ? SER A 51 ? GLY A 345 SER A 350 1 ? 6 HELX_P HELX_P2 AA2 SER A 72 ? ASN A 82 ? SER A 371 ASN A 381 1 ? 11 HELX_P HELX_P3 AA3 LYS A 94 ? GLU A 102 ? LYS A 393 GLU A 401 1 ? 9 HELX_P HELX_P4 AA4 GLY B 46 ? SER B 51 ? GLY B 345 SER B 350 1 ? 6 HELX_P HELX_P5 AA5 SER B 72 ? ALA B 83 ? SER B 371 ALA B 382 1 ? 12 HELX_P HELX_P6 AA6 LYS B 94 ? GLU B 102 ? LYS B 393 GLU B 401 1 ? 9 HELX_P HELX_P7 AA7 GLY C 46 ? SER C 51 ? GLY C 345 SER C 350 1 ? 6 HELX_P HELX_P8 AA8 SER C 72 ? ASN C 82 ? SER C 371 ASN C 381 1 ? 11 HELX_P HELX_P9 AA9 LYS C 94 ? GLU C 102 ? LYS C 393 GLU C 401 1 ? 9 HELX_P HELX_P10 AB1 GLU D 32 ? GLU D 35 ? GLU D 331 GLU D 334 5 ? 4 HELX_P HELX_P11 AB2 GLY D 46 ? SER D 51 ? GLY D 345 SER D 350 1 ? 6 HELX_P HELX_P12 AB3 SER D 72 ? ALA D 83 ? SER D 371 ALA D 382 1 ? 12 HELX_P HELX_P13 AB4 LYS D 94 ? PHE D 101 ? LYS D 393 PHE D 400 1 ? 8 HELX_P HELX_P14 AB5 GLY E 46 ? SER E 51 ? GLY E 345 SER E 350 1 ? 6 HELX_P HELX_P15 AB6 SER E 72 ? ASN E 82 ? SER E 371 ASN E 381 1 ? 11 HELX_P HELX_P16 AB7 LYS E 94 ? ALA E 103 ? LYS E 393 ALA E 402 1 ? 10 HELX_P HELX_P17 AB8 GLY F 46 ? GLY F 52 ? GLY F 345 GLY F 351 1 ? 7 HELX_P HELX_P18 AB9 SER F 72 ? ASN F 82 ? SER F 371 ASN F 381 1 ? 11 HELX_P HELX_P19 AC1 LYS F 94 ? GLU F 102 ? LYS F 393 GLU F 401 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? AA3 ? 4 ? AA4 ? 2 ? AA5 ? 4 ? AA6 ? 2 ? AA7 ? 4 ? AA8 ? 2 ? AA9 ? 4 ? AB1 ? 2 ? AB2 ? 4 ? AB3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? anti-parallel AA7 3 4 ? anti-parallel AA8 1 2 ? anti-parallel AA9 1 2 ? anti-parallel AA9 2 3 ? anti-parallel AA9 3 4 ? anti-parallel AB1 1 2 ? anti-parallel AB2 1 2 ? anti-parallel AB2 2 3 ? anti-parallel AB2 3 4 ? anti-parallel AB3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 13 ? HIS A 18 ? ARG A 312 HIS A 317 AA1 2 THR A 86 ? TYR A 93 ? THR A 385 TYR A 392 AA1 3 ASP A 58 ? VAL A 63 ? ASP A 357 VAL A 362 AA1 4 VAL A 66 ? ASP A 67 ? VAL A 365 ASP A 366 AA2 1 PHE A 26 ? GLU A 32 ? PHE A 325 GLU A 331 AA2 2 GLU A 35 ? ILE A 42 ? GLU A 334 ILE A 341 AA3 1 ARG B 13 ? HIS B 18 ? ARG B 312 HIS B 317 AA3 2 THR B 86 ? TYR B 93 ? THR B 385 TYR B 392 AA3 3 ASP B 58 ? VAL B 63 ? ASP B 357 VAL B 362 AA3 4 VAL B 66 ? ASP B 67 ? VAL B 365 ASP B 366 AA4 1 PHE B 26 ? GLY B 30 ? PHE B 325 GLY B 329 AA4 2 ILE B 37 ? ILE B 42 ? ILE B 336 ILE B 341 AA5 1 ARG C 13 ? HIS C 18 ? ARG C 312 HIS C 317 AA5 2 THR C 86 ? TYR C 93 ? THR C 385 TYR C 392 AA5 3 ASP C 58 ? VAL C 63 ? ASP C 357 VAL C 362 AA5 4 VAL C 66 ? ASP C 67 ? VAL C 365 ASP C 366 AA6 1 PHE C 26 ? GLY C 30 ? PHE C 325 GLY C 329 AA6 2 ILE C 37 ? ILE C 42 ? ILE C 336 ILE C 341 AA7 1 ARG D 13 ? HIS D 18 ? ARG D 312 HIS D 317 AA7 2 THR D 86 ? TYR D 93 ? THR D 385 TYR D 392 AA7 3 ASP D 58 ? VAL D 63 ? ASP D 357 VAL D 362 AA7 4 VAL D 66 ? ASP D 67 ? VAL D 365 ASP D 366 AA8 1 PHE D 26 ? GLY D 30 ? PHE D 325 GLY D 329 AA8 2 ILE D 37 ? ILE D 42 ? ILE D 336 ILE D 341 AA9 1 ARG E 13 ? HIS E 18 ? ARG E 312 HIS E 317 AA9 2 THR E 86 ? TYR E 93 ? THR E 385 TYR E 392 AA9 3 ASP E 58 ? VAL E 63 ? ASP E 357 VAL E 362 AA9 4 VAL E 66 ? ASP E 67 ? VAL E 365 ASP E 366 AB1 1 PHE E 26 ? GLU E 32 ? PHE E 325 GLU E 331 AB1 2 GLU E 35 ? ILE E 42 ? GLU E 334 ILE E 341 AB2 1 ARG F 13 ? HIS F 18 ? ARG F 312 HIS F 317 AB2 2 THR F 86 ? TYR F 93 ? THR F 385 TYR F 392 AB2 3 ASP F 58 ? VAL F 63 ? ASP F 357 VAL F 362 AB2 4 VAL F 66 ? ASP F 67 ? VAL F 365 ASP F 366 AB3 1 PHE F 26 ? GLY F 30 ? PHE F 325 GLY F 329 AB3 2 ILE F 37 ? ILE F 42 ? ILE F 336 ILE F 341 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 15 ? N ILE A 314 O ILE A 89 ? O ILE A 388 AA1 2 3 O GLN A 92 ? O GLN A 391 N GLN A 59 ? N GLN A 358 AA1 3 4 N VAL A 63 ? N VAL A 362 O VAL A 66 ? O VAL A 365 AA2 1 2 N GLU A 32 ? N GLU A 331 O GLU A 35 ? O GLU A 334 AA3 1 2 N ILE B 15 ? N ILE B 314 O ILE B 89 ? O ILE B 388 AA3 2 3 O GLN B 92 ? O GLN B 391 N GLN B 59 ? N GLN B 358 AA3 3 4 N VAL B 63 ? N VAL B 362 O VAL B 66 ? O VAL B 365 AA4 1 2 N ASN B 27 ? N ASN B 326 O SER B 40 ? O SER B 339 AA5 1 2 N ILE C 15 ? N ILE C 314 O ILE C 89 ? O ILE C 388 AA5 2 3 O GLN C 92 ? O GLN C 391 N GLN C 59 ? N GLN C 358 AA5 3 4 N VAL C 63 ? N VAL C 362 O VAL C 66 ? O VAL C 365 AA6 1 2 N VAL C 29 ? N VAL C 328 O PHE C 38 ? O PHE C 337 AA7 1 2 N ILE D 15 ? N ILE D 314 O ILE D 89 ? O ILE D 388 AA7 2 3 O GLN D 92 ? O GLN D 391 N GLN D 59 ? N GLN D 358 AA7 3 4 N VAL D 63 ? N VAL D 362 O VAL D 66 ? O VAL D 365 AA8 1 2 N VAL D 29 ? N VAL D 328 O PHE D 38 ? O PHE D 337 AA9 1 2 N ILE E 15 ? N ILE E 314 O ILE E 89 ? O ILE E 388 AA9 2 3 O GLN E 92 ? O GLN E 391 N GLN E 59 ? N GLN E 358 AA9 3 4 N VAL E 63 ? N VAL E 362 O VAL E 66 ? O VAL E 365 AB1 1 2 N VAL E 29 ? N VAL E 328 O PHE E 38 ? O PHE E 337 AB2 1 2 N ILE F 15 ? N ILE F 314 O ILE F 89 ? O ILE F 388 AB2 2 3 O GLN F 92 ? O GLN F 391 N GLN F 59 ? N GLN F 358 AB2 3 4 N VAL F 63 ? N VAL F 362 O VAL F 66 ? O VAL F 365 AB3 1 2 N VAL F 29 ? N VAL F 328 O PHE F 38 ? O PHE F 337 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 321 ? ? -109.85 46.19 2 1 GLU A 352 ? ? -128.69 -52.10 3 1 GLU B 352 ? ? -129.39 -50.61 4 1 GLU C 352 ? ? -129.37 -51.92 5 1 THR F 321 ? ? -108.13 42.79 6 1 GLU F 352 ? ? -126.64 -51.49 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 B HOH 668 ? N HOH . 2 1 D HOH 665 ? P HOH . 3 1 E HOH 535 ? Q HOH . 4 1 E HOH 579 ? Q HOH . 5 1 F HOH 663 ? R HOH . # _phasing.method MR # _pdbx_entry_details.entry_id 8AH4 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 300 ? A MET 1 2 1 Y 1 A GLY 301 ? A GLY 2 3 1 Y 1 A LEU 302 ? A LEU 3 4 1 Y 1 A GLY 303 ? A GLY 4 5 1 Y 1 A GLU 304 ? A GLU 5 6 1 Y 1 A GLU 305 ? A GLU 6 7 1 Y 1 A ASP 306 ? A ASP 7 8 1 Y 1 A ILE 307 ? A ILE 8 9 1 Y 1 A ALA 402 ? A ALA 103 10 1 Y 1 A LYS 403 ? A LYS 104 11 1 Y 1 B MET 300 ? B MET 1 12 1 Y 1 B GLY 301 ? B GLY 2 13 1 Y 1 B LEU 302 ? B LEU 3 14 1 Y 1 B GLY 303 ? B GLY 4 15 1 Y 1 B GLU 304 ? B GLU 5 16 1 Y 1 B GLU 305 ? B GLU 6 17 1 Y 1 B ASP 306 ? B ASP 7 18 1 Y 1 B ALA 402 ? B ALA 103 19 1 Y 1 B LYS 403 ? B LYS 104 20 1 Y 1 C MET 300 ? C MET 1 21 1 Y 1 C GLY 301 ? C GLY 2 22 1 Y 1 C LEU 302 ? C LEU 3 23 1 Y 1 C GLY 303 ? C GLY 4 24 1 Y 1 C GLU 304 ? C GLU 5 25 1 Y 1 C GLU 305 ? C GLU 6 26 1 Y 1 C ASP 306 ? C ASP 7 27 1 Y 1 C ILE 307 ? C ILE 8 28 1 Y 1 C ALA 402 ? C ALA 103 29 1 Y 1 C LYS 403 ? C LYS 104 30 1 Y 1 D MET 300 ? D MET 1 31 1 Y 1 D GLY 301 ? D GLY 2 32 1 Y 1 D LEU 302 ? D LEU 3 33 1 Y 1 D GLY 303 ? D GLY 4 34 1 Y 1 D GLU 304 ? D GLU 5 35 1 Y 1 D GLU 305 ? D GLU 6 36 1 Y 1 D ASP 306 ? D ASP 7 37 1 Y 1 D ILE 307 ? D ILE 8 38 1 Y 1 D PRO 308 ? D PRO 9 39 1 Y 1 D GLU 401 ? D GLU 102 40 1 Y 1 D ALA 402 ? D ALA 103 41 1 Y 1 D LYS 403 ? D LYS 104 42 1 Y 1 E MET 300 ? E MET 1 43 1 Y 1 E GLY 301 ? E GLY 2 44 1 Y 1 E LEU 302 ? E LEU 3 45 1 Y 1 E GLY 303 ? E GLY 4 46 1 Y 1 E GLU 304 ? E GLU 5 47 1 Y 1 E GLU 305 ? E GLU 6 48 1 Y 1 E ASP 306 ? E ASP 7 49 1 Y 1 E ILE 307 ? E ILE 8 50 1 Y 1 E PRO 308 ? E PRO 9 51 1 Y 1 E LYS 403 ? E LYS 104 52 1 Y 1 F MET 300 ? F MET 1 53 1 Y 1 F GLY 301 ? F GLY 2 54 1 Y 1 F LEU 302 ? F LEU 3 55 1 Y 1 F GLY 303 ? F GLY 4 56 1 Y 1 F GLU 304 ? F GLU 5 57 1 Y 1 F GLU 305 ? F GLU 6 58 1 Y 1 F ASP 306 ? F ASP 7 59 1 Y 1 F ILE 307 ? F ILE 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 GLN N N N N 81 GLN CA C N S 82 GLN C C N N 83 GLN O O N N 84 GLN CB C N N 85 GLN CG C N N 86 GLN CD C N N 87 GLN OE1 O N N 88 GLN NE2 N N N 89 GLN OXT O N N 90 GLN H H N N 91 GLN H2 H N N 92 GLN HA H N N 93 GLN HB2 H N N 94 GLN HB3 H N N 95 GLN HG2 H N N 96 GLN HG3 H N N 97 GLN HE21 H N N 98 GLN HE22 H N N 99 GLN HXT H N N 100 GLU N N N N 101 GLU CA C N S 102 GLU C C N N 103 GLU O O N N 104 GLU CB C N N 105 GLU CG C N N 106 GLU CD C N N 107 GLU OE1 O N N 108 GLU OE2 O N N 109 GLU OXT O N N 110 GLU H H N N 111 GLU H2 H N N 112 GLU HA H N N 113 GLU HB2 H N N 114 GLU HB3 H N N 115 GLU HG2 H N N 116 GLU HG3 H N N 117 GLU HE2 H N N 118 GLU HXT H N N 119 GLY N N N N 120 GLY CA C N N 121 GLY C C N N 122 GLY O O N N 123 GLY OXT O N N 124 GLY H H N N 125 GLY H2 H N N 126 GLY HA2 H N N 127 GLY HA3 H N N 128 GLY HXT H N N 129 HIS N N N N 130 HIS CA C N S 131 HIS C C N N 132 HIS O O N N 133 HIS CB C N N 134 HIS CG C Y N 135 HIS ND1 N Y N 136 HIS CD2 C Y N 137 HIS CE1 C Y N 138 HIS NE2 N Y N 139 HIS OXT O N N 140 HIS H H N N 141 HIS H2 H N N 142 HIS HA H N N 143 HIS HB2 H N N 144 HIS HB3 H N N 145 HIS HD1 H N N 146 HIS HD2 H N N 147 HIS HE1 H N N 148 HIS HE2 H N N 149 HIS HXT H N N 150 HOH O O N N 151 HOH H1 H N N 152 HOH H2 H N N 153 ILE N N N N 154 ILE CA C N S 155 ILE C C N N 156 ILE O O N N 157 ILE CB C N S 158 ILE CG1 C N N 159 ILE CG2 C N N 160 ILE CD1 C N N 161 ILE OXT O N N 162 ILE H H N N 163 ILE H2 H N N 164 ILE HA H N N 165 ILE HB H N N 166 ILE HG12 H N N 167 ILE HG13 H N N 168 ILE HG21 H N N 169 ILE HG22 H N N 170 ILE HG23 H N N 171 ILE HD11 H N N 172 ILE HD12 H N N 173 ILE HD13 H N N 174 ILE HXT H N N 175 LEU N N N N 176 LEU CA C N S 177 LEU C C N N 178 LEU O O N N 179 LEU CB C N N 180 LEU CG C N N 181 LEU CD1 C N N 182 LEU CD2 C N N 183 LEU OXT O N N 184 LEU H H N N 185 LEU H2 H N N 186 LEU HA H N N 187 LEU HB2 H N N 188 LEU HB3 H N N 189 LEU HG H N N 190 LEU HD11 H N N 191 LEU HD12 H N N 192 LEU HD13 H N N 193 LEU HD21 H N N 194 LEU HD22 H N N 195 LEU HD23 H N N 196 LEU HXT H N N 197 LYS N N N N 198 LYS CA C N S 199 LYS C C N N 200 LYS O O N N 201 LYS CB C N N 202 LYS CG C N N 203 LYS CD C N N 204 LYS CE C N N 205 LYS NZ N N N 206 LYS OXT O N N 207 LYS H H N N 208 LYS H2 H N N 209 LYS HA H N N 210 LYS HB2 H N N 211 LYS HB3 H N N 212 LYS HG2 H N N 213 LYS HG3 H N N 214 LYS HD2 H N N 215 LYS HD3 H N N 216 LYS HE2 H N N 217 LYS HE3 H N N 218 LYS HZ1 H N N 219 LYS HZ2 H N N 220 LYS HZ3 H N N 221 LYS HXT H N N 222 MET N N N N 223 MET CA C N S 224 MET C C N N 225 MET O O N N 226 MET CB C N N 227 MET CG C N N 228 MET SD S N N 229 MET CE C N N 230 MET OXT O N N 231 MET H H N N 232 MET H2 H N N 233 MET HA H N N 234 MET HB2 H N N 235 MET HB3 H N N 236 MET HG2 H N N 237 MET HG3 H N N 238 MET HE1 H N N 239 MET HE2 H N N 240 MET HE3 H N N 241 MET HXT H N N 242 PHE N N N N 243 PHE CA C N S 244 PHE C C N N 245 PHE O O N N 246 PHE CB C N N 247 PHE CG C Y N 248 PHE CD1 C Y N 249 PHE CD2 C Y N 250 PHE CE1 C Y N 251 PHE CE2 C Y N 252 PHE CZ C Y N 253 PHE OXT O N N 254 PHE H H N N 255 PHE H2 H N N 256 PHE HA H N N 257 PHE HB2 H N N 258 PHE HB3 H N N 259 PHE HD1 H N N 260 PHE HD2 H N N 261 PHE HE1 H N N 262 PHE HE2 H N N 263 PHE HZ H N N 264 PHE HXT H N N 265 PRO N N N N 266 PRO CA C N S 267 PRO C C N N 268 PRO O O N N 269 PRO CB C N N 270 PRO CG C N N 271 PRO CD C N N 272 PRO OXT O N N 273 PRO H H N N 274 PRO HA H N N 275 PRO HB2 H N N 276 PRO HB3 H N N 277 PRO HG2 H N N 278 PRO HG3 H N N 279 PRO HD2 H N N 280 PRO HD3 H N N 281 PRO HXT H N N 282 SER N N N N 283 SER CA C N S 284 SER C C N N 285 SER O O N N 286 SER CB C N N 287 SER OG O N N 288 SER OXT O N N 289 SER H H N N 290 SER H2 H N N 291 SER HA H N N 292 SER HB2 H N N 293 SER HB3 H N N 294 SER HG H N N 295 SER HXT H N N 296 THR N N N N 297 THR CA C N S 298 THR C C N N 299 THR O O N N 300 THR CB C N R 301 THR OG1 O N N 302 THR CG2 C N N 303 THR OXT O N N 304 THR H H N N 305 THR H2 H N N 306 THR HA H N N 307 THR HB H N N 308 THR HG1 H N N 309 THR HG21 H N N 310 THR HG22 H N N 311 THR HG23 H N N 312 THR HXT H N N 313 TYR N N N N 314 TYR CA C N S 315 TYR C C N N 316 TYR O O N N 317 TYR CB C N N 318 TYR CG C Y N 319 TYR CD1 C Y N 320 TYR CD2 C Y N 321 TYR CE1 C Y N 322 TYR CE2 C Y N 323 TYR CZ C Y N 324 TYR OH O N N 325 TYR OXT O N N 326 TYR H H N N 327 TYR H2 H N N 328 TYR HA H N N 329 TYR HB2 H N N 330 TYR HB3 H N N 331 TYR HD1 H N N 332 TYR HD2 H N N 333 TYR HE1 H N N 334 TYR HE2 H N N 335 TYR HH H N N 336 TYR HXT H N N 337 VAL N N N N 338 VAL CA C N S 339 VAL C C N N 340 VAL O O N N 341 VAL CB C N N 342 VAL CG1 C N N 343 VAL CG2 C N N 344 VAL OXT O N N 345 VAL H H N N 346 VAL H2 H N N 347 VAL HA H N N 348 VAL HB H N N 349 VAL HG11 H N N 350 VAL HG12 H N N 351 VAL HG13 H N N 352 VAL HG21 H N N 353 VAL HG22 H N N 354 VAL HG23 H N N 355 VAL HXT H N N 356 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 GLN N CA sing N N 76 GLN N H sing N N 77 GLN N H2 sing N N 78 GLN CA C sing N N 79 GLN CA CB sing N N 80 GLN CA HA sing N N 81 GLN C O doub N N 82 GLN C OXT sing N N 83 GLN CB CG sing N N 84 GLN CB HB2 sing N N 85 GLN CB HB3 sing N N 86 GLN CG CD sing N N 87 GLN CG HG2 sing N N 88 GLN CG HG3 sing N N 89 GLN CD OE1 doub N N 90 GLN CD NE2 sing N N 91 GLN NE2 HE21 sing N N 92 GLN NE2 HE22 sing N N 93 GLN OXT HXT sing N N 94 GLU N CA sing N N 95 GLU N H sing N N 96 GLU N H2 sing N N 97 GLU CA C sing N N 98 GLU CA CB sing N N 99 GLU CA HA sing N N 100 GLU C O doub N N 101 GLU C OXT sing N N 102 GLU CB CG sing N N 103 GLU CB HB2 sing N N 104 GLU CB HB3 sing N N 105 GLU CG CD sing N N 106 GLU CG HG2 sing N N 107 GLU CG HG3 sing N N 108 GLU CD OE1 doub N N 109 GLU CD OE2 sing N N 110 GLU OE2 HE2 sing N N 111 GLU OXT HXT sing N N 112 GLY N CA sing N N 113 GLY N H sing N N 114 GLY N H2 sing N N 115 GLY CA C sing N N 116 GLY CA HA2 sing N N 117 GLY CA HA3 sing N N 118 GLY C O doub N N 119 GLY C OXT sing N N 120 GLY OXT HXT sing N N 121 HIS N CA sing N N 122 HIS N H sing N N 123 HIS N H2 sing N N 124 HIS CA C sing N N 125 HIS CA CB sing N N 126 HIS CA HA sing N N 127 HIS C O doub N N 128 HIS C OXT sing N N 129 HIS CB CG sing N N 130 HIS CB HB2 sing N N 131 HIS CB HB3 sing N N 132 HIS CG ND1 sing Y N 133 HIS CG CD2 doub Y N 134 HIS ND1 CE1 doub Y N 135 HIS ND1 HD1 sing N N 136 HIS CD2 NE2 sing Y N 137 HIS CD2 HD2 sing N N 138 HIS CE1 NE2 sing Y N 139 HIS CE1 HE1 sing N N 140 HIS NE2 HE2 sing N N 141 HIS OXT HXT sing N N 142 HOH O H1 sing N N 143 HOH O H2 sing N N 144 ILE N CA sing N N 145 ILE N H sing N N 146 ILE N H2 sing N N 147 ILE CA C sing N N 148 ILE CA CB sing N N 149 ILE CA HA sing N N 150 ILE C O doub N N 151 ILE C OXT sing N N 152 ILE CB CG1 sing N N 153 ILE CB CG2 sing N N 154 ILE CB HB sing N N 155 ILE CG1 CD1 sing N N 156 ILE CG1 HG12 sing N N 157 ILE CG1 HG13 sing N N 158 ILE CG2 HG21 sing N N 159 ILE CG2 HG22 sing N N 160 ILE CG2 HG23 sing N N 161 ILE CD1 HD11 sing N N 162 ILE CD1 HD12 sing N N 163 ILE CD1 HD13 sing N N 164 ILE OXT HXT sing N N 165 LEU N CA sing N N 166 LEU N H sing N N 167 LEU N H2 sing N N 168 LEU CA C sing N N 169 LEU CA CB sing N N 170 LEU CA HA sing N N 171 LEU C O doub N N 172 LEU C OXT sing N N 173 LEU CB CG sing N N 174 LEU CB HB2 sing N N 175 LEU CB HB3 sing N N 176 LEU CG CD1 sing N N 177 LEU CG CD2 sing N N 178 LEU CG HG sing N N 179 LEU CD1 HD11 sing N N 180 LEU CD1 HD12 sing N N 181 LEU CD1 HD13 sing N N 182 LEU CD2 HD21 sing N N 183 LEU CD2 HD22 sing N N 184 LEU CD2 HD23 sing N N 185 LEU OXT HXT sing N N 186 LYS N CA sing N N 187 LYS N H sing N N 188 LYS N H2 sing N N 189 LYS CA C sing N N 190 LYS CA CB sing N N 191 LYS CA HA sing N N 192 LYS C O doub N N 193 LYS C OXT sing N N 194 LYS CB CG sing N N 195 LYS CB HB2 sing N N 196 LYS CB HB3 sing N N 197 LYS CG CD sing N N 198 LYS CG HG2 sing N N 199 LYS CG HG3 sing N N 200 LYS CD CE sing N N 201 LYS CD HD2 sing N N 202 LYS CD HD3 sing N N 203 LYS CE NZ sing N N 204 LYS CE HE2 sing N N 205 LYS CE HE3 sing N N 206 LYS NZ HZ1 sing N N 207 LYS NZ HZ2 sing N N 208 LYS NZ HZ3 sing N N 209 LYS OXT HXT sing N N 210 MET N CA sing N N 211 MET N H sing N N 212 MET N H2 sing N N 213 MET CA C sing N N 214 MET CA CB sing N N 215 MET CA HA sing N N 216 MET C O doub N N 217 MET C OXT sing N N 218 MET CB CG sing N N 219 MET CB HB2 sing N N 220 MET CB HB3 sing N N 221 MET CG SD sing N N 222 MET CG HG2 sing N N 223 MET CG HG3 sing N N 224 MET SD CE sing N N 225 MET CE HE1 sing N N 226 MET CE HE2 sing N N 227 MET CE HE3 sing N N 228 MET OXT HXT sing N N 229 PHE N CA sing N N 230 PHE N H sing N N 231 PHE N H2 sing N N 232 PHE CA C sing N N 233 PHE CA CB sing N N 234 PHE CA HA sing N N 235 PHE C O doub N N 236 PHE C OXT sing N N 237 PHE CB CG sing N N 238 PHE CB HB2 sing N N 239 PHE CB HB3 sing N N 240 PHE CG CD1 doub Y N 241 PHE CG CD2 sing Y N 242 PHE CD1 CE1 sing Y N 243 PHE CD1 HD1 sing N N 244 PHE CD2 CE2 doub Y N 245 PHE CD2 HD2 sing N N 246 PHE CE1 CZ doub Y N 247 PHE CE1 HE1 sing N N 248 PHE CE2 CZ sing Y N 249 PHE CE2 HE2 sing N N 250 PHE CZ HZ sing N N 251 PHE OXT HXT sing N N 252 PRO N CA sing N N 253 PRO N CD sing N N 254 PRO N H sing N N 255 PRO CA C sing N N 256 PRO CA CB sing N N 257 PRO CA HA sing N N 258 PRO C O doub N N 259 PRO C OXT sing N N 260 PRO CB CG sing N N 261 PRO CB HB2 sing N N 262 PRO CB HB3 sing N N 263 PRO CG CD sing N N 264 PRO CG HG2 sing N N 265 PRO CG HG3 sing N N 266 PRO CD HD2 sing N N 267 PRO CD HD3 sing N N 268 PRO OXT HXT sing N N 269 SER N CA sing N N 270 SER N H sing N N 271 SER N H2 sing N N 272 SER CA C sing N N 273 SER CA CB sing N N 274 SER CA HA sing N N 275 SER C O doub N N 276 SER C OXT sing N N 277 SER CB OG sing N N 278 SER CB HB2 sing N N 279 SER CB HB3 sing N N 280 SER OG HG sing N N 281 SER OXT HXT sing N N 282 THR N CA sing N N 283 THR N H sing N N 284 THR N H2 sing N N 285 THR CA C sing N N 286 THR CA CB sing N N 287 THR CA HA sing N N 288 THR C O doub N N 289 THR C OXT sing N N 290 THR CB OG1 sing N N 291 THR CB CG2 sing N N 292 THR CB HB sing N N 293 THR OG1 HG1 sing N N 294 THR CG2 HG21 sing N N 295 THR CG2 HG22 sing N N 296 THR CG2 HG23 sing N N 297 THR OXT HXT sing N N 298 TYR N CA sing N N 299 TYR N H sing N N 300 TYR N H2 sing N N 301 TYR CA C sing N N 302 TYR CA CB sing N N 303 TYR CA HA sing N N 304 TYR C O doub N N 305 TYR C OXT sing N N 306 TYR CB CG sing N N 307 TYR CB HB2 sing N N 308 TYR CB HB3 sing N N 309 TYR CG CD1 doub Y N 310 TYR CG CD2 sing Y N 311 TYR CD1 CE1 sing Y N 312 TYR CD1 HD1 sing N N 313 TYR CD2 CE2 doub Y N 314 TYR CD2 HD2 sing N N 315 TYR CE1 CZ doub Y N 316 TYR CE1 HE1 sing N N 317 TYR CE2 CZ sing Y N 318 TYR CE2 HE2 sing N N 319 TYR CZ OH sing N N 320 TYR OH HH sing N N 321 TYR OXT HXT sing N N 322 VAL N CA sing N N 323 VAL N H sing N N 324 VAL N H2 sing N N 325 VAL CA C sing N N 326 VAL CA CB sing N N 327 VAL CA HA sing N N 328 VAL C O doub N N 329 VAL C OXT sing N N 330 VAL CB CG1 sing N N 331 VAL CB CG2 sing N N 332 VAL CB HB sing N N 333 VAL CG1 HG11 sing N N 334 VAL CG1 HG12 sing N N 335 VAL CG1 HG13 sing N N 336 VAL CG2 HG21 sing N N 337 VAL CG2 HG22 sing N N 338 VAL CG2 HG23 sing N N 339 VAL OXT HXT sing N N 340 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country Spain _pdbx_audit_support.grant_number UAL-FEDER-UAL18-BIO-B005-B _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6QJI _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8AH4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016208 _atom_sites.fract_transf_matrix[1][2] 0.009358 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018715 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004373 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_