data_8AMP
# 
_entry.id   8AMP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.385 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   8AMP         pdb_00008amp 10.2210/pdb8amp/pdb 
WWPDB D_1292124511 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2023-02-15 
2 'Structure model' 1 1 2024-02-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom                
2 2 'Structure model' chem_comp_bond                
3 2 'Structure model' pdbx_initial_refinement_model 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        8AMP 
_pdbx_database_status.recvd_initial_deposition_date   2022-08-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_pdbx_contact_author.id                 4 
_pdbx_contact_author.email              borshchevskiy.vi@phystech.edu 
_pdbx_contact_author.name_first         Valentin 
_pdbx_contact_author.name_last          Borshchevskiy 
_pdbx_contact_author.name_mi            ? 
_pdbx_contact_author.role               'principal investigator/group leader' 
_pdbx_contact_author.identifier_ORCID   0000-0003-4398-9712 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bukhdruker, S.'    1 ? 
'Kavaleuski, A.'    2 ? 
'Marin, E.'         3 ? 
'Kapranov, I.'      4 ? 
'Mishin, A.'        5 ? 
'Gilep, A.'         6 ? 
'Strushkevich, N.'  7 ? 
'Borshchevskiy, V.' 8 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CH 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Front Mol Biosci' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2296-889X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            9 
_citation.language                  ? 
_citation.page_first                1100032 
_citation.page_last                 1100032 
_citation.title                     
'Structural insights into 3Fe-4S ferredoxins diversity in M. tuberculosis highlighted by a first redox complex with P450.' 
_citation.year                      2022 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.3389/fmolb.2022.1100032 
_citation.pdbx_database_id_PubMed   36699703 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gilep, A.'         1  ? 
primary 'Varaksa, T.'       2  ? 
primary 'Bukhdruker, S.'    3  ? 
primary 'Kavaleuski, A.'    4  ? 
primary 'Ryzhykau, Y.'      5  ? 
primary 'Smolskaya, S.'     6  ? 
primary 'Sushko, T.'        7  ? 
primary 'Tsumoto, K.'       8  ? 
primary 'Grabovec, I.'      9  ? 
primary 'Kapranov, I.'      10 ? 
primary 'Okhrimenko, I.'    11 ? 
primary 'Marin, E.'         12 ? 
primary 'Shevtsov, M.'      13 ? 
primary 'Mishin, A.'        14 ? 
primary 'Kovalev, K.'       15 ? 
primary 'Kuklin, A.'        16 ? 
primary 'Gordeliy, V.'      17 ? 
primary 'Kaluzhskiy, L.'    18 ? 
primary 'Gnedenko, O.'      19 ? 
primary 'Yablokov, E.'      20 ? 
primary 'Ivanov, A.'        21 ? 
primary 'Borshchevskiy, V.' 22 ? 
primary 'Strushkevich, N.'  23 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Possible ferredoxin' 8519.586 1 ? ? ? ? 
2 non-polymer syn 'FE3-S4 CLUSTER'      295.795  1 ? ? ? ? 
3 non-polymer syn 'FE (III) ION'        55.845   1 ? ? ? ? 
4 water       nat water                 18.015   5 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MGYRVEADRDLCQGHAMCELEAPEYFRVPKRGQVEILDPEPPEEARGVIKHAVWACPTQALSIRETGEHHHHHH 
_entity_poly.pdbx_seq_one_letter_code_can   MGYRVEADRDLCQGHAMCELEAPEYFRVPKRGQVEILDPEPPEEARGVIKHAVWACPTQALSIRETGEHHHHHH 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE3-S4 CLUSTER' F3S 
3 'FE (III) ION'   FE  
4 water            HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  GLY n 
1 3  TYR n 
1 4  ARG n 
1 5  VAL n 
1 6  GLU n 
1 7  ALA n 
1 8  ASP n 
1 9  ARG n 
1 10 ASP n 
1 11 LEU n 
1 12 CYS n 
1 13 GLN n 
1 14 GLY n 
1 15 HIS n 
1 16 ALA n 
1 17 MET n 
1 18 CYS n 
1 19 GLU n 
1 20 LEU n 
1 21 GLU n 
1 22 ALA n 
1 23 PRO n 
1 24 GLU n 
1 25 TYR n 
1 26 PHE n 
1 27 ARG n 
1 28 VAL n 
1 29 PRO n 
1 30 LYS n 
1 31 ARG n 
1 32 GLY n 
1 33 GLN n 
1 34 VAL n 
1 35 GLU n 
1 36 ILE n 
1 37 LEU n 
1 38 ASP n 
1 39 PRO n 
1 40 GLU n 
1 41 PRO n 
1 42 PRO n 
1 43 GLU n 
1 44 GLU n 
1 45 ALA n 
1 46 ARG n 
1 47 GLY n 
1 48 VAL n 
1 49 ILE n 
1 50 LYS n 
1 51 HIS n 
1 52 ALA n 
1 53 VAL n 
1 54 TRP n 
1 55 ALA n 
1 56 CYS n 
1 57 PRO n 
1 58 THR n 
1 59 GLN n 
1 60 ALA n 
1 61 LEU n 
1 62 SER n 
1 63 ILE n 
1 64 ARG n 
1 65 GLU n 
1 66 THR n 
1 67 GLY n 
1 68 GLU n 
1 69 HIS n 
1 70 HIS n 
1 71 HIS n 
1 72 HIS n 
1 73 HIS n 
1 74 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   74 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Rv0763c 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mycobacterium tuberculosis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1773 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
F3S non-polymer         . 'FE3-S4 CLUSTER' ? 'Fe3 S4'         295.795 
FE  non-polymer         . 'FE (III) ION'   ? 'Fe 3'           55.845  
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  ?  ?   ?   A . n 
A 1 2  GLY 2  2  2  GLY GLY A . n 
A 1 3  TYR 3  3  3  TYR TYR A . n 
A 1 4  ARG 4  4  4  ARG ARG A . n 
A 1 5  VAL 5  5  5  VAL VAL A . n 
A 1 6  GLU 6  6  6  GLU GLU A . n 
A 1 7  ALA 7  7  7  ALA ALA A . n 
A 1 8  ASP 8  8  8  ASP ASP A . n 
A 1 9  ARG 9  9  9  ARG ARG A . n 
A 1 10 ASP 10 10 10 ASP ASP A . n 
A 1 11 LEU 11 11 11 LEU LEU A . n 
A 1 12 CYS 12 12 12 CYS CYS A . n 
A 1 13 GLN 13 13 13 GLN GLN A . n 
A 1 14 GLY 14 14 14 GLY GLY A . n 
A 1 15 HIS 15 15 15 HIS HIS A . n 
A 1 16 ALA 16 16 16 ALA ALA A . n 
A 1 17 MET 17 17 17 MET MET A . n 
A 1 18 CYS 18 18 18 CYS CYS A . n 
A 1 19 GLU 19 19 19 GLU GLU A . n 
A 1 20 LEU 20 20 20 LEU LEU A . n 
A 1 21 GLU 21 21 21 GLU GLU A . n 
A 1 22 ALA 22 22 22 ALA ALA A . n 
A 1 23 PRO 23 23 23 PRO PRO A . n 
A 1 24 GLU 24 24 24 GLU GLU A . n 
A 1 25 TYR 25 25 25 TYR TYR A . n 
A 1 26 PHE 26 26 26 PHE PHE A . n 
A 1 27 ARG 27 27 27 ARG ARG A . n 
A 1 28 VAL 28 28 28 VAL VAL A . n 
A 1 29 PRO 29 29 29 PRO PRO A . n 
A 1 30 LYS 30 30 30 LYS LYS A . n 
A 1 31 ARG 31 31 31 ARG ARG A . n 
A 1 32 GLY 32 32 32 GLY GLY A . n 
A 1 33 GLN 33 33 33 GLN GLN A . n 
A 1 34 VAL 34 34 34 VAL VAL A . n 
A 1 35 GLU 35 35 35 GLU GLU A . n 
A 1 36 ILE 36 36 36 ILE ILE A . n 
A 1 37 LEU 37 37 37 LEU LEU A . n 
A 1 38 ASP 38 38 38 ASP ASP A . n 
A 1 39 PRO 39 39 39 PRO PRO A . n 
A 1 40 GLU 40 40 40 GLU GLU A . n 
A 1 41 PRO 41 41 41 PRO PRO A . n 
A 1 42 PRO 42 42 42 PRO PRO A . n 
A 1 43 GLU 43 43 43 GLU GLU A . n 
A 1 44 GLU 44 44 44 GLU GLU A . n 
A 1 45 ALA 45 45 45 ALA ALA A . n 
A 1 46 ARG 46 46 46 ARG ARG A . n 
A 1 47 GLY 47 47 47 GLY GLY A . n 
A 1 48 VAL 48 48 48 VAL VAL A . n 
A 1 49 ILE 49 49 49 ILE ILE A . n 
A 1 50 LYS 50 50 50 LYS LYS A . n 
A 1 51 HIS 51 51 51 HIS HIS A . n 
A 1 52 ALA 52 52 52 ALA ALA A . n 
A 1 53 VAL 53 53 53 VAL VAL A . n 
A 1 54 TRP 54 54 54 TRP TRP A . n 
A 1 55 ALA 55 55 55 ALA ALA A . n 
A 1 56 CYS 56 56 56 CYS CYS A . n 
A 1 57 PRO 57 57 57 PRO PRO A . n 
A 1 58 THR 58 58 58 THR THR A . n 
A 1 59 GLN 59 59 59 GLN GLN A . n 
A 1 60 ALA 60 60 60 ALA ALA A . n 
A 1 61 LEU 61 61 61 LEU LEU A . n 
A 1 62 SER 62 62 62 SER SER A . n 
A 1 63 ILE 63 63 63 ILE ILE A . n 
A 1 64 ARG 64 64 64 ARG ARG A . n 
A 1 65 GLU 65 65 65 GLU GLU A . n 
A 1 66 THR 66 66 66 THR THR A . n 
A 1 67 GLY 67 67 ?  ?   ?   A . n 
A 1 68 GLU 68 68 ?  ?   ?   A . n 
A 1 69 HIS 69 69 ?  ?   ?   A . n 
A 1 70 HIS 70 70 ?  ?   ?   A . n 
A 1 71 HIS 71 71 ?  ?   ?   A . n 
A 1 72 HIS 72 72 ?  ?   ?   A . n 
A 1 73 HIS 73 73 ?  ?   ?   A . n 
A 1 74 HIS 74 74 ?  ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 F3S 1 101 101 F3S F3S A . 
C 3 FE  1 102 201 FE  FE  A . 
D 4 HOH 1 201 205 HOH HOH A . 
D 4 HOH 2 202 204 HOH HOH A . 
D 4 HOH 3 203 203 HOH HOH A . 
D 4 HOH 4 204 206 HOH HOH A . 
D 4 HOH 5 205 202 HOH HOH A . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 4  ? CG  ? A ARG 4  CG  
2  1 Y 1 A ARG 4  ? CD  ? A ARG 4  CD  
3  1 Y 1 A ARG 4  ? NE  ? A ARG 4  NE  
4  1 Y 1 A ARG 4  ? CZ  ? A ARG 4  CZ  
5  1 Y 1 A ARG 4  ? NH1 ? A ARG 4  NH1 
6  1 Y 1 A ARG 4  ? NH2 ? A ARG 4  NH2 
7  1 Y 1 A VAL 5  ? CG1 ? A VAL 5  CG1 
8  1 Y 1 A ASP 8  ? CG  ? A ASP 8  CG  
9  1 Y 1 A ASP 8  ? OD1 ? A ASP 8  OD1 
10 1 Y 1 A ASP 8  ? OD2 ? A ASP 8  OD2 
11 1 Y 1 A ASP 10 ? CG  ? A ASP 10 CG  
12 1 Y 1 A ASP 10 ? OD1 ? A ASP 10 OD1 
13 1 Y 1 A ASP 10 ? OD2 ? A ASP 10 OD2 
14 1 Y 1 A LEU 11 ? CG  ? A LEU 11 CG  
15 1 Y 1 A LEU 11 ? CD1 ? A LEU 11 CD1 
16 1 Y 1 A LEU 11 ? CD2 ? A LEU 11 CD2 
17 1 Y 1 A LEU 20 ? CG  ? A LEU 20 CG  
18 1 Y 1 A LEU 20 ? CD1 ? A LEU 20 CD1 
19 1 Y 1 A LEU 20 ? CD2 ? A LEU 20 CD2 
20 1 Y 1 A GLU 24 ? CG  ? A GLU 24 CG  
21 1 Y 1 A GLU 24 ? CD  ? A GLU 24 CD  
22 1 Y 1 A GLU 24 ? OE1 ? A GLU 24 OE1 
23 1 Y 1 A GLU 24 ? OE2 ? A GLU 24 OE2 
24 1 Y 1 A ARG 27 ? CG  ? A ARG 27 CG  
25 1 Y 1 A ARG 27 ? CD  ? A ARG 27 CD  
26 1 Y 1 A ARG 27 ? NE  ? A ARG 27 NE  
27 1 Y 1 A ARG 27 ? CZ  ? A ARG 27 CZ  
28 1 Y 1 A ARG 27 ? NH1 ? A ARG 27 NH1 
29 1 Y 1 A ARG 27 ? NH2 ? A ARG 27 NH2 
30 1 Y 1 A LYS 30 ? CG  ? A LYS 30 CG  
31 1 Y 1 A LYS 30 ? CD  ? A LYS 30 CD  
32 1 Y 1 A LYS 30 ? CE  ? A LYS 30 CE  
33 1 Y 1 A LYS 30 ? NZ  ? A LYS 30 NZ  
34 1 Y 1 A ARG 31 ? CG  ? A ARG 31 CG  
35 1 Y 1 A ARG 31 ? CD  ? A ARG 31 CD  
36 1 Y 1 A ARG 31 ? NE  ? A ARG 31 NE  
37 1 Y 1 A ARG 31 ? CZ  ? A ARG 31 CZ  
38 1 Y 1 A ARG 31 ? NH1 ? A ARG 31 NH1 
39 1 Y 1 A ARG 31 ? NH2 ? A ARG 31 NH2 
40 1 Y 1 A LYS 50 ? CE  ? A LYS 50 CE  
41 1 Y 1 A LYS 50 ? NZ  ? A LYS 50 NZ  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS       ? ? ? 20170615             1 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? STARANISO ? ? ? '3.344 27-Apr-2022'  2 
? phasing          ? ? ? ? ? ? ? ? ? ? ? MoRDa     ? ? ? '1.4.09; 10.02.2022' 3 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? PHENIX    ? ? ? 1.20.1_4487          4 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX    ? ? ? 1.20.1_4487          5 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     8AMP 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     46.959 
_cell.length_a_esd                 ? 
_cell.length_b                     46.959 
_cell.length_b_esd                 ? 
_cell.length_c                     162.674 
_cell.length_c_esd                 ? 
_cell.volume                       310660.801 
_cell.volume_esd                   ? 
_cell.Z_PDB                        18 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
_cell.pdbx_esd_method              ? 
# 
_symmetry.entry_id                         8AMP 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
_symmetry.space_group_name_Hall            
;R 3 2"
;
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   8AMP 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                       ? 
_exptl_crystal.density_diffrn               ? 
_exptl_crystal.density_Matthews             2.03 
_exptl_crystal.density_method               ? 
_exptl_crystal.density_percent_sol          39.28 
_exptl_crystal.description                  ? 
_exptl_crystal.F_000                        ? 
_exptl_crystal.id                           1 
_exptl_crystal.preparation                  ? 
_exptl_crystal.size_max                     ? 
_exptl_crystal.size_mid                     ? 
_exptl_crystal.size_min                     ? 
_exptl_crystal.size_rad                     ? 
_exptl_crystal.colour_lustre                ? 
_exptl_crystal.colour_modifier              ? 
_exptl_crystal.colour_primary               ? 
_exptl_crystal.density_meas                 ? 
_exptl_crystal.density_meas_esd             ? 
_exptl_crystal.density_meas_gt              ? 
_exptl_crystal.density_meas_lt              ? 
_exptl_crystal.density_meas_temp            ? 
_exptl_crystal.density_meas_temp_esd        ? 
_exptl_crystal.density_meas_temp_gt         ? 
_exptl_crystal.density_meas_temp_lt         ? 
_exptl_crystal.pdbx_crystal_image_url       ? 
_exptl_crystal.pdbx_crystal_image_format    ? 
_exptl_crystal.pdbx_mosaicity               ? 
_exptl_crystal.pdbx_mosaicity_esd           ? 
_exptl_crystal.pdbx_mosaic_method           ? 
_exptl_crystal.pdbx_mosaic_block_size       ? 
_exptl_crystal.pdbx_mosaic_block_size_esd   ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M MgCl2, 0.1 M Tris, 25% (w/v) PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 2M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-06-28 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.966 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE MASSIF-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.966 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   MASSIF-1 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate                          38.46 
_reflns.entry_id                                       8AMP 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              2.00 
_reflns.d_resolution_low                               28.76 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     4958 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           99.9 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                9.5 
_reflns.pdbx_Rmerge_I_obs                              ? 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          10.95 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                0.097 
_reflns.pdbx_Rpim_I_all                                ? 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   0.998 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
_reflns.pdbx_CC_split_method                           ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
_reflns_shell.pdbx_percent_possible_ellipsoidal 
_reflns_shell.pdbx_percent_possible_spherical 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous 
_reflns_shell.pdbx_percent_possible_spherical_anomalous 
_reflns_shell.pdbx_redundancy_anomalous 
_reflns_shell.pdbx_CC_half_anomalous 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous 
_reflns_shell.pdbx_percent_possible_anomalous 
2.00 2.05  ? 0.93  ? ? ? ? 346 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 9.9  ? ? ? ? 2.801 ? ? 1  1 0.526 ? ? ? ? ? ? ? ? ? ? 
2.05 2.11  ? 1.32  ? ? ? ? 361 99.4 ? ? ? ? ? ? ? ? ? ? ? ? ? 9.8  ? ? ? ? 1.997 ? ? 2  1 0.687 ? ? ? ? ? ? ? ? ? ? 
2.11 2.17  ? 1.62  ? ? ? ? 338 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 9.5  ? ? ? ? 1.621 ? ? 3  1 0.794 ? ? ? ? ? ? ? ? ? ? 
2.17 2.24  ? 2.07  ? ? ? ? 339 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 9.1  ? ? ? ? 1.252 ? ? 4  1 0.814 ? ? ? ? ? ? ? ? ? ? 
2.24 2.31  ? 2.60  ? ? ? ? 303 92.0 ? ? ? ? ? ? ? ? ? ? ? ? ? 9.0  ? ? ? ? 0.976 ? ? 5  1 0.874 ? ? ? ? ? ? ? ? ? ? 
2.31 2.39  ? 3.30  ? ? ? ? 319 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 9.6  ? ? ? ? 0.793 ? ? 6  1 0.923 ? ? ? ? ? ? ? ? ? ? 
2.39 2.48  ? 4.27  ? ? ? ? 303 99.7 ? ? ? ? ? ? ? ? ? ? ? ? ? 10.3 ? ? ? ? 0.64  ? ? 7  1 0.951 ? ? ? ? ? ? ? ? ? ? 
2.48 2.58  ? 5.38  ? ? ? ? 284 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 9.9  ? ? ? ? 0.463 ? ? 8  1 0.974 ? ? ? ? ? ? ? ? ? ? 
2.58 2.70  ? 6.32  ? ? ? ? 281 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 10.0 ? ? ? ? 0.393 ? ? 9  1 0.982 ? ? ? ? ? ? ? ? ? ? 
2.70 2.83  ? 10.00 ? ? ? ? 264 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 9.8  ? ? ? ? 0.222 ? ? 10 1 0.992 ? ? ? ? ? ? ? ? ? ? 
2.83 2.98  ? 11.19 ? ? ? ? 249 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 9.6  ? ? ? ? 0.197 ? ? 11 1 0.992 ? ? ? ? ? ? ? ? ? ? 
2.98 3.16  ? 13.10 ? ? ? ? 247 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 9.2  ? ? ? ? 0.140 ? ? 12 1 0.996 ? ? ? ? ? ? ? ? ? ? 
3.16 3.38  ? 17.05 ? ? ? ? 234 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 8.7  ? ? ? ? 0.099 ? ? 13 1 0.997 ? ? ? ? ? ? ? ? ? ? 
3.38 3.65  ? 23.14 ? ? ? ? 220 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 9.6  ? ? ? ? 0.071 ? ? 14 1 0.999 ? ? ? ? ? ? ? ? ? ? 
3.65 4.00  ? 27.87 ? ? ? ? 189 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 9.7  ? ? ? ? 0.063 ? ? 15 1 0.999 ? ? ? ? ? ? ? ? ? ? 
4.00 4.47  ? 32.87 ? ? ? ? 188 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 9.6  ? ? ? ? 0.056 ? ? 16 1 0.999 ? ? ? ? ? ? ? ? ? ? 
4.47 5.17  ? 33.15 ? ? ? ? 168 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 8.7  ? ? ? ? 0.053 ? ? 17 1 0.999 ? ? ? ? ? ? ? ? ? ? 
5.17 6.33  ? 31.52 ? ? ? ? 133 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 7.9  ? ? ? ? 0.056 ? ? 18 1 0.999 ? ? ? ? ? ? ? ? ? ? 
6.33 8.95  ? 35.29 ? ? ? ? 119 100  ? ? ? ? ? ? ? ? ? ? ? ? ? 8.3  ? ? ? ? 0.051 ? ? 19 1 0.999 ? ? ? ? ? ? ? ? ? ? 
8.95 28.76 ? 36.57 ? ? ? ? 73  96.1 ? ? ? ? ? ? ? ? ? ? ? ? ? 7.4  ? ? ? ? 0.051 ? ? 20 1 0.994 ? ? ? ? ? ? ? ? ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               56.80 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 8AMP 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.00 
_refine.ls_d_res_low                             28.76 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     4119 
_refine.ls_number_reflns_R_free                  416 
_refine.ls_number_reflns_R_work                  3703 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    83.03 
_refine.ls_percent_reflns_R_free                 10.10 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2543 
_refine.ls_R_factor_R_free                       0.2910 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2503 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1VJW 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1000 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 36.4958 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2447 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        28.76 
_refine_hist.number_atoms_solvent             5 
_refine_hist.number_atoms_total               487 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        474 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.1220  ? 495 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 4.4138  ? 680 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 2.0938  ? 73  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0047  ? 91  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 14.0730 ? 171 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.00 2.29  . . 98  869  60.17  . . . 0.3601 . 0.3185 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.29 2.88  . . 146 1290 87.72  . . . 0.3454 . 0.3149 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.89 28.76 . . 172 1544 100.00 . . . 0.2651 . 0.2245 . . . . . . . . . . . 
# 
_struct.entry_id                     8AMP 
_struct.title                        'Crystal structure of M.tuberculosis ferredoxin Fdx' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        8AMP 
_struct_keywords.text            'Ferredoxin, electron transport, tuberculosis, Rv0763c, CYP51' 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    P71820_MYCTU 
_struct_ref.pdbx_db_accession          P71820 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MGYRVEADRDLCQGHAMCELEAPEYFRVPKRGQVEILDPEPPEEARGVIKHAVWACPTQALSIRETGE 
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              8AMP 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 68 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P71820 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  68 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       68 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 8AMP HIS A 69 ? UNP P71820 ? ? 'expression tag' 69 1 
1 8AMP HIS A 70 ? UNP P71820 ? ? 'expression tag' 70 2 
1 8AMP HIS A 71 ? UNP P71820 ? ? 'expression tag' 71 3 
1 8AMP HIS A 72 ? UNP P71820 ? ? 'expression tag' 72 4 
1 8AMP HIS A 73 ? UNP P71820 ? ? 'expression tag' 73 5 
1 8AMP HIS A 74 ? UNP P71820 ? ? 'expression tag' 74 6 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 470  ? 
1 MORE         -27  ? 
1 'SSA (A^2)'  3750 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ALA A 16 ? ALA A 22 ? ALA A 16 ALA A 22 1 ? 7  
HELX_P HELX_P2 AA2 PRO A 42 ? GLU A 44 ? PRO A 42 GLU A 44 5 ? 3  
HELX_P HELX_P3 AA3 ALA A 45 ? CYS A 56 ? ALA A 45 CYS A 56 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 12 SG  ? ? ? 1_555 B F3S . FE4 ? ? A CYS 12  A F3S 101 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc2 metalc ? ? A CYS 18 SG  ? ? ? 1_555 B F3S . FE3 ? ? A CYS 18  A F3S 101 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc3 metalc ? ? A HIS 51 NE2 ? ? ? 1_555 C FE  . FE  ? ? A HIS 51  A FE  102 1_555 ? ? ? ? ? ? ? 2.070 ? ? 
metalc4 metalc ? ? A HIS 51 NE2 ? ? ? 1_555 C FE  . FE  ? ? A HIS 51  A FE  102 2_455 ? ? ? ? ? ? ? 2.042 ? ? 
metalc5 metalc ? ? A CYS 56 SG  ? ? ? 1_555 B F3S . FE1 ? ? A CYS 56  A F3S 101 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc6 metalc ? ? C FE  .  FE  ? ? ? 1_555 D HOH . O   ? ? A FE  102 A HOH 205 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc7 metalc ? ? C FE  .  FE  ? ? ? 1_555 D HOH . O   ? ? A FE  102 A HOH 205 2_455 ? ? ? ? ? ? ? 2.309 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 12 ? A CYS 12  ? 1_555 FE4 ? B F3S . ? A F3S 101 ? 1_555 S2  ? B F3S .  ? A F3S 101 ? 1_555 114.8 ? 
2  SG  ? A CYS 12 ? A CYS 12  ? 1_555 FE4 ? B F3S . ? A F3S 101 ? 1_555 S3  ? B F3S .  ? A F3S 101 ? 1_555 116.5 ? 
3  S2  ? B F3S .  ? A F3S 101 ? 1_555 FE4 ? B F3S . ? A F3S 101 ? 1_555 S3  ? B F3S .  ? A F3S 101 ? 1_555 105.5 ? 
4  SG  ? A CYS 12 ? A CYS 12  ? 1_555 FE4 ? B F3S . ? A F3S 101 ? 1_555 S4  ? B F3S .  ? A F3S 101 ? 1_555 101.7 ? 
5  S2  ? B F3S .  ? A F3S 101 ? 1_555 FE4 ? B F3S . ? A F3S 101 ? 1_555 S4  ? B F3S .  ? A F3S 101 ? 1_555 111.1 ? 
6  S3  ? B F3S .  ? A F3S 101 ? 1_555 FE4 ? B F3S . ? A F3S 101 ? 1_555 S4  ? B F3S .  ? A F3S 101 ? 1_555 107.0 ? 
7  SG  ? A CYS 18 ? A CYS 18  ? 1_555 FE3 ? B F3S . ? A F3S 101 ? 1_555 S1  ? B F3S .  ? A F3S 101 ? 1_555 110.8 ? 
8  SG  ? A CYS 18 ? A CYS 18  ? 1_555 FE3 ? B F3S . ? A F3S 101 ? 1_555 S3  ? B F3S .  ? A F3S 101 ? 1_555 120.1 ? 
9  S1  ? B F3S .  ? A F3S 101 ? 1_555 FE3 ? B F3S . ? A F3S 101 ? 1_555 S3  ? B F3S .  ? A F3S 101 ? 1_555 105.4 ? 
10 SG  ? A CYS 18 ? A CYS 18  ? 1_555 FE3 ? B F3S . ? A F3S 101 ? 1_555 S4  ? B F3S .  ? A F3S 101 ? 1_555 104.9 ? 
11 S1  ? B F3S .  ? A F3S 101 ? 1_555 FE3 ? B F3S . ? A F3S 101 ? 1_555 S4  ? B F3S .  ? A F3S 101 ? 1_555 108.4 ? 
12 S3  ? B F3S .  ? A F3S 101 ? 1_555 FE3 ? B F3S . ? A F3S 101 ? 1_555 S4  ? B F3S .  ? A F3S 101 ? 1_555 106.8 ? 
13 NE2 ? A HIS 51 ? A HIS 51  ? 1_555 FE  ? C FE  . ? A FE  102 ? 1_555 NE2 ? A HIS 51 ? A HIS 51  ? 1_555 0.0   ? 
14 NE2 ? A HIS 51 ? A HIS 51  ? 1_555 FE  ? C FE  . ? A FE  102 ? 1_555 O   ? D HOH .  ? A HOH 205 ? 1_555 106.0 ? 
15 NE2 ? A HIS 51 ? A HIS 51  ? 1_555 FE  ? C FE  . ? A FE  102 ? 1_555 O   ? D HOH .  ? A HOH 205 ? 1_555 106.0 ? 
16 NE2 ? A HIS 51 ? A HIS 51  ? 1_555 FE  ? C FE  . ? A FE  102 ? 1_555 O   ? D HOH .  ? A HOH 205 ? 2_455 106.1 ? 
17 NE2 ? A HIS 51 ? A HIS 51  ? 1_555 FE  ? C FE  . ? A FE  102 ? 1_555 O   ? D HOH .  ? A HOH 205 ? 2_455 106.1 ? 
18 O   ? D HOH .  ? A HOH 205 ? 1_555 FE  ? C FE  . ? A FE  102 ? 1_555 O   ? D HOH .  ? A HOH 205 ? 2_455 0.1   ? 
19 SG  ? A CYS 56 ? A CYS 56  ? 1_555 FE1 ? B F3S . ? A F3S 101 ? 1_555 S1  ? B F3S .  ? A F3S 101 ? 1_555 116.9 ? 
20 SG  ? A CYS 56 ? A CYS 56  ? 1_555 FE1 ? B F3S . ? A F3S 101 ? 1_555 S2  ? B F3S .  ? A F3S 101 ? 1_555 117.5 ? 
21 S1  ? B F3S .  ? A F3S 101 ? 1_555 FE1 ? B F3S . ? A F3S 101 ? 1_555 S2  ? B F3S .  ? A F3S 101 ? 1_555 107.5 ? 
22 SG  ? A CYS 56 ? A CYS 56  ? 1_555 FE1 ? B F3S . ? A F3S 101 ? 1_555 S3  ? B F3S .  ? A F3S 101 ? 1_555 102.8 ? 
23 S1  ? B F3S .  ? A F3S 101 ? 1_555 FE1 ? B F3S . ? A F3S 101 ? 1_555 S3  ? B F3S .  ? A F3S 101 ? 1_555 105.4 ? 
24 S2  ? B F3S .  ? A F3S 101 ? 1_555 FE1 ? B F3S . ? A F3S 101 ? 1_555 S3  ? B F3S .  ? A F3S 101 ? 1_555 105.2 ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TYR A 3  ? ALA A 7  ? TYR A 3  ALA A 7  
AA1 2 LEU A 61 ? GLU A 65 ? LEU A 61 GLU A 65 
AA2 1 PHE A 26 ? ARG A 27 ? PHE A 26 ARG A 27 
AA2 2 GLU A 35 ? ILE A 36 ? GLU A 35 ILE A 36 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 6  ? N GLU A 6  O SER A 62 ? O SER A 62 
AA2 1 2 N ARG A 27 ? N ARG A 27 O GLU A 35 ? O GLU A 35 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A FE  102 ? C FE  . 
2 1 A HOH 201 ? D HOH . 
3 1 A HOH 205 ? D HOH . 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1  x,y,z                  
2  -y,x-y,z               
3  -x+y,-x,z              
4  x-y,-y,-z              
5  -x,-x+y,-z             
6  y,x,-z                 
7  x+1/3,y+2/3,z+2/3      
8  -y+1/3,x-y+2/3,z+2/3   
9  -x+y+1/3,-x+2/3,z+2/3  
10 x-y+1/3,-y+2/3,-z+2/3  
11 -x+1/3,-x+y+2/3,-z+2/3 
12 y+1/3,x+2/3,-z+2/3     
13 x+2/3,y+1/3,z+1/3      
14 -y+2/3,x-y+1/3,z+1/3   
15 -x+y+2/3,-x+1/3,z+1/3  
16 x-y+2/3,-y+1/3,-z+1/3  
17 -x+2/3,-x+y+1/3,-z+1/3 
18 y+2/3,x+1/3,-z+1/3     
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -10.2235812771 
_pdbx_refine_tls.origin_y         -10.5283877981 
_pdbx_refine_tls.origin_z         -13.6477102063 
_pdbx_refine_tls.T[1][1]          0.169361525199 
_pdbx_refine_tls.T[1][1]_esd      ? 
_pdbx_refine_tls.T[1][2]          -0.0369906789722 
_pdbx_refine_tls.T[1][2]_esd      ? 
_pdbx_refine_tls.T[1][3]          -0.215263474863 
_pdbx_refine_tls.T[1][3]_esd      ? 
_pdbx_refine_tls.T[2][2]          0.313415454142 
_pdbx_refine_tls.T[2][2]_esd      ? 
_pdbx_refine_tls.T[2][3]          0.0664168035822 
_pdbx_refine_tls.T[2][3]_esd      ? 
_pdbx_refine_tls.T[3][3]          0.663810000722 
_pdbx_refine_tls.T[3][3]_esd      ? 
_pdbx_refine_tls.L[1][1]          2.12669271625 
_pdbx_refine_tls.L[1][1]_esd      ? 
_pdbx_refine_tls.L[1][2]          -2.00557385106 
_pdbx_refine_tls.L[1][2]_esd      ? 
_pdbx_refine_tls.L[1][3]          0.17651409912 
_pdbx_refine_tls.L[1][3]_esd      ? 
_pdbx_refine_tls.L[2][2]          5.28127722827 
_pdbx_refine_tls.L[2][2]_esd      ? 
_pdbx_refine_tls.L[2][3]          0.169499384196 
_pdbx_refine_tls.L[2][3]_esd      ? 
_pdbx_refine_tls.L[3][3]          0.807417697391 
_pdbx_refine_tls.L[3][3]_esd      ? 
_pdbx_refine_tls.S[1][1]          0.203074986829 
_pdbx_refine_tls.S[1][1]_esd      ? 
_pdbx_refine_tls.S[1][2]          0.0371668676423 
_pdbx_refine_tls.S[1][2]_esd      ? 
_pdbx_refine_tls.S[1][3]          0.459390927478 
_pdbx_refine_tls.S[1][3]_esd      ? 
_pdbx_refine_tls.S[2][1]          0.622434118087 
_pdbx_refine_tls.S[2][1]_esd      ? 
_pdbx_refine_tls.S[2][2]          -0.0829792519237 
_pdbx_refine_tls.S[2][2]_esd      ? 
_pdbx_refine_tls.S[2][3]          -3.2436368637 
_pdbx_refine_tls.S[2][3]_esd      ? 
_pdbx_refine_tls.S[3][1]          -0.539500956334 
_pdbx_refine_tls.S[3][1]_esd      ? 
_pdbx_refine_tls.S[3][2]          0.484072393083 
_pdbx_refine_tls.S[3][2]_esd      ? 
_pdbx_refine_tls.S[3][3]          0.260567329696 
_pdbx_refine_tls.S[3][3]_esd      ? 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_label_asym_id   A 
_pdbx_refine_tls_group.beg_label_seq_id    1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     2 
_pdbx_refine_tls_group.beg_PDB_ins_code    ? 
_pdbx_refine_tls_group.end_label_asym_id   D 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     202 
_pdbx_refine_tls_group.end_PDB_ins_code    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   
;(chain 'A' and resid 2 through 202)
;
# 
_pdbx_entry_details.entry_id                 8AMP 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1  ? A MET 1  
2 1 Y 1 A GLY 67 ? A GLY 67 
3 1 Y 1 A GLU 68 ? A GLU 68 
4 1 Y 1 A HIS 69 ? A HIS 69 
5 1 Y 1 A HIS 70 ? A HIS 70 
6 1 Y 1 A HIS 71 ? A HIS 71 
7 1 Y 1 A HIS 72 ? A HIS 72 
8 1 Y 1 A HIS 73 ? A HIS 73 
9 1 Y 1 A HIS 74 ? A HIS 74 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASP N    N  N N 41  
ASP CA   C  N S 42  
ASP C    C  N N 43  
ASP O    O  N N 44  
ASP CB   C  N N 45  
ASP CG   C  N N 46  
ASP OD1  O  N N 47  
ASP OD2  O  N N 48  
ASP OXT  O  N N 49  
ASP H    H  N N 50  
ASP H2   H  N N 51  
ASP HA   H  N N 52  
ASP HB2  H  N N 53  
ASP HB3  H  N N 54  
ASP HD2  H  N N 55  
ASP HXT  H  N N 56  
CYS N    N  N N 57  
CYS CA   C  N R 58  
CYS C    C  N N 59  
CYS O    O  N N 60  
CYS CB   C  N N 61  
CYS SG   S  N N 62  
CYS OXT  O  N N 63  
CYS H    H  N N 64  
CYS H2   H  N N 65  
CYS HA   H  N N 66  
CYS HB2  H  N N 67  
CYS HB3  H  N N 68  
CYS HG   H  N N 69  
CYS HXT  H  N N 70  
F3S FE1  FE N N 71  
F3S FE3  FE N N 72  
F3S FE4  FE N N 73  
F3S S1   S  N N 74  
F3S S2   S  N N 75  
F3S S3   S  N N 76  
F3S S4   S  N N 77  
FE  FE   FE N N 78  
GLN N    N  N N 79  
GLN CA   C  N S 80  
GLN C    C  N N 81  
GLN O    O  N N 82  
GLN CB   C  N N 83  
GLN CG   C  N N 84  
GLN CD   C  N N 85  
GLN OE1  O  N N 86  
GLN NE2  N  N N 87  
GLN OXT  O  N N 88  
GLN H    H  N N 89  
GLN H2   H  N N 90  
GLN HA   H  N N 91  
GLN HB2  H  N N 92  
GLN HB3  H  N N 93  
GLN HG2  H  N N 94  
GLN HG3  H  N N 95  
GLN HE21 H  N N 96  
GLN HE22 H  N N 97  
GLN HXT  H  N N 98  
GLU N    N  N N 99  
GLU CA   C  N S 100 
GLU C    C  N N 101 
GLU O    O  N N 102 
GLU CB   C  N N 103 
GLU CG   C  N N 104 
GLU CD   C  N N 105 
GLU OE1  O  N N 106 
GLU OE2  O  N N 107 
GLU OXT  O  N N 108 
GLU H    H  N N 109 
GLU H2   H  N N 110 
GLU HA   H  N N 111 
GLU HB2  H  N N 112 
GLU HB3  H  N N 113 
GLU HG2  H  N N 114 
GLU HG3  H  N N 115 
GLU HE2  H  N N 116 
GLU HXT  H  N N 117 
GLY N    N  N N 118 
GLY CA   C  N N 119 
GLY C    C  N N 120 
GLY O    O  N N 121 
GLY OXT  O  N N 122 
GLY H    H  N N 123 
GLY H2   H  N N 124 
GLY HA2  H  N N 125 
GLY HA3  H  N N 126 
GLY HXT  H  N N 127 
HIS N    N  N N 128 
HIS CA   C  N S 129 
HIS C    C  N N 130 
HIS O    O  N N 131 
HIS CB   C  N N 132 
HIS CG   C  Y N 133 
HIS ND1  N  Y N 134 
HIS CD2  C  Y N 135 
HIS CE1  C  Y N 136 
HIS NE2  N  Y N 137 
HIS OXT  O  N N 138 
HIS H    H  N N 139 
HIS H2   H  N N 140 
HIS HA   H  N N 141 
HIS HB2  H  N N 142 
HIS HB3  H  N N 143 
HIS HD1  H  N N 144 
HIS HD2  H  N N 145 
HIS HE1  H  N N 146 
HIS HE2  H  N N 147 
HIS HXT  H  N N 148 
HOH O    O  N N 149 
HOH H1   H  N N 150 
HOH H2   H  N N 151 
ILE N    N  N N 152 
ILE CA   C  N S 153 
ILE C    C  N N 154 
ILE O    O  N N 155 
ILE CB   C  N S 156 
ILE CG1  C  N N 157 
ILE CG2  C  N N 158 
ILE CD1  C  N N 159 
ILE OXT  O  N N 160 
ILE H    H  N N 161 
ILE H2   H  N N 162 
ILE HA   H  N N 163 
ILE HB   H  N N 164 
ILE HG12 H  N N 165 
ILE HG13 H  N N 166 
ILE HG21 H  N N 167 
ILE HG22 H  N N 168 
ILE HG23 H  N N 169 
ILE HD11 H  N N 170 
ILE HD12 H  N N 171 
ILE HD13 H  N N 172 
ILE HXT  H  N N 173 
LEU N    N  N N 174 
LEU CA   C  N S 175 
LEU C    C  N N 176 
LEU O    O  N N 177 
LEU CB   C  N N 178 
LEU CG   C  N N 179 
LEU CD1  C  N N 180 
LEU CD2  C  N N 181 
LEU OXT  O  N N 182 
LEU H    H  N N 183 
LEU H2   H  N N 184 
LEU HA   H  N N 185 
LEU HB2  H  N N 186 
LEU HB3  H  N N 187 
LEU HG   H  N N 188 
LEU HD11 H  N N 189 
LEU HD12 H  N N 190 
LEU HD13 H  N N 191 
LEU HD21 H  N N 192 
LEU HD22 H  N N 193 
LEU HD23 H  N N 194 
LEU HXT  H  N N 195 
LYS N    N  N N 196 
LYS CA   C  N S 197 
LYS C    C  N N 198 
LYS O    O  N N 199 
LYS CB   C  N N 200 
LYS CG   C  N N 201 
LYS CD   C  N N 202 
LYS CE   C  N N 203 
LYS NZ   N  N N 204 
LYS OXT  O  N N 205 
LYS H    H  N N 206 
LYS H2   H  N N 207 
LYS HA   H  N N 208 
LYS HB2  H  N N 209 
LYS HB3  H  N N 210 
LYS HG2  H  N N 211 
LYS HG3  H  N N 212 
LYS HD2  H  N N 213 
LYS HD3  H  N N 214 
LYS HE2  H  N N 215 
LYS HE3  H  N N 216 
LYS HZ1  H  N N 217 
LYS HZ2  H  N N 218 
LYS HZ3  H  N N 219 
LYS HXT  H  N N 220 
MET N    N  N N 221 
MET CA   C  N S 222 
MET C    C  N N 223 
MET O    O  N N 224 
MET CB   C  N N 225 
MET CG   C  N N 226 
MET SD   S  N N 227 
MET CE   C  N N 228 
MET OXT  O  N N 229 
MET H    H  N N 230 
MET H2   H  N N 231 
MET HA   H  N N 232 
MET HB2  H  N N 233 
MET HB3  H  N N 234 
MET HG2  H  N N 235 
MET HG3  H  N N 236 
MET HE1  H  N N 237 
MET HE2  H  N N 238 
MET HE3  H  N N 239 
MET HXT  H  N N 240 
PHE N    N  N N 241 
PHE CA   C  N S 242 
PHE C    C  N N 243 
PHE O    O  N N 244 
PHE CB   C  N N 245 
PHE CG   C  Y N 246 
PHE CD1  C  Y N 247 
PHE CD2  C  Y N 248 
PHE CE1  C  Y N 249 
PHE CE2  C  Y N 250 
PHE CZ   C  Y N 251 
PHE OXT  O  N N 252 
PHE H    H  N N 253 
PHE H2   H  N N 254 
PHE HA   H  N N 255 
PHE HB2  H  N N 256 
PHE HB3  H  N N 257 
PHE HD1  H  N N 258 
PHE HD2  H  N N 259 
PHE HE1  H  N N 260 
PHE HE2  H  N N 261 
PHE HZ   H  N N 262 
PHE HXT  H  N N 263 
PRO N    N  N N 264 
PRO CA   C  N S 265 
PRO C    C  N N 266 
PRO O    O  N N 267 
PRO CB   C  N N 268 
PRO CG   C  N N 269 
PRO CD   C  N N 270 
PRO OXT  O  N N 271 
PRO H    H  N N 272 
PRO HA   H  N N 273 
PRO HB2  H  N N 274 
PRO HB3  H  N N 275 
PRO HG2  H  N N 276 
PRO HG3  H  N N 277 
PRO HD2  H  N N 278 
PRO HD3  H  N N 279 
PRO HXT  H  N N 280 
SER N    N  N N 281 
SER CA   C  N S 282 
SER C    C  N N 283 
SER O    O  N N 284 
SER CB   C  N N 285 
SER OG   O  N N 286 
SER OXT  O  N N 287 
SER H    H  N N 288 
SER H2   H  N N 289 
SER HA   H  N N 290 
SER HB2  H  N N 291 
SER HB3  H  N N 292 
SER HG   H  N N 293 
SER HXT  H  N N 294 
THR N    N  N N 295 
THR CA   C  N S 296 
THR C    C  N N 297 
THR O    O  N N 298 
THR CB   C  N R 299 
THR OG1  O  N N 300 
THR CG2  C  N N 301 
THR OXT  O  N N 302 
THR H    H  N N 303 
THR H2   H  N N 304 
THR HA   H  N N 305 
THR HB   H  N N 306 
THR HG1  H  N N 307 
THR HG21 H  N N 308 
THR HG22 H  N N 309 
THR HG23 H  N N 310 
THR HXT  H  N N 311 
TRP N    N  N N 312 
TRP CA   C  N S 313 
TRP C    C  N N 314 
TRP O    O  N N 315 
TRP CB   C  N N 316 
TRP CG   C  Y N 317 
TRP CD1  C  Y N 318 
TRP CD2  C  Y N 319 
TRP NE1  N  Y N 320 
TRP CE2  C  Y N 321 
TRP CE3  C  Y N 322 
TRP CZ2  C  Y N 323 
TRP CZ3  C  Y N 324 
TRP CH2  C  Y N 325 
TRP OXT  O  N N 326 
TRP H    H  N N 327 
TRP H2   H  N N 328 
TRP HA   H  N N 329 
TRP HB2  H  N N 330 
TRP HB3  H  N N 331 
TRP HD1  H  N N 332 
TRP HE1  H  N N 333 
TRP HE3  H  N N 334 
TRP HZ2  H  N N 335 
TRP HZ3  H  N N 336 
TRP HH2  H  N N 337 
TRP HXT  H  N N 338 
TYR N    N  N N 339 
TYR CA   C  N S 340 
TYR C    C  N N 341 
TYR O    O  N N 342 
TYR CB   C  N N 343 
TYR CG   C  Y N 344 
TYR CD1  C  Y N 345 
TYR CD2  C  Y N 346 
TYR CE1  C  Y N 347 
TYR CE2  C  Y N 348 
TYR CZ   C  Y N 349 
TYR OH   O  N N 350 
TYR OXT  O  N N 351 
TYR H    H  N N 352 
TYR H2   H  N N 353 
TYR HA   H  N N 354 
TYR HB2  H  N N 355 
TYR HB3  H  N N 356 
TYR HD1  H  N N 357 
TYR HD2  H  N N 358 
TYR HE1  H  N N 359 
TYR HE2  H  N N 360 
TYR HH   H  N N 361 
TYR HXT  H  N N 362 
VAL N    N  N N 363 
VAL CA   C  N S 364 
VAL C    C  N N 365 
VAL O    O  N N 366 
VAL CB   C  N N 367 
VAL CG1  C  N N 368 
VAL CG2  C  N N 369 
VAL OXT  O  N N 370 
VAL H    H  N N 371 
VAL H2   H  N N 372 
VAL HA   H  N N 373 
VAL HB   H  N N 374 
VAL HG11 H  N N 375 
VAL HG12 H  N N 376 
VAL HG13 H  N N 377 
VAL HG21 H  N N 378 
VAL HG22 H  N N 379 
VAL HG23 H  N N 380 
VAL HXT  H  N N 381 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASP N   CA   sing N N 39  
ASP N   H    sing N N 40  
ASP N   H2   sing N N 41  
ASP CA  C    sing N N 42  
ASP CA  CB   sing N N 43  
ASP CA  HA   sing N N 44  
ASP C   O    doub N N 45  
ASP C   OXT  sing N N 46  
ASP CB  CG   sing N N 47  
ASP CB  HB2  sing N N 48  
ASP CB  HB3  sing N N 49  
ASP CG  OD1  doub N N 50  
ASP CG  OD2  sing N N 51  
ASP OD2 HD2  sing N N 52  
ASP OXT HXT  sing N N 53  
CYS N   CA   sing N N 54  
CYS N   H    sing N N 55  
CYS N   H2   sing N N 56  
CYS CA  C    sing N N 57  
CYS CA  CB   sing N N 58  
CYS CA  HA   sing N N 59  
CYS C   O    doub N N 60  
CYS C   OXT  sing N N 61  
CYS CB  SG   sing N N 62  
CYS CB  HB2  sing N N 63  
CYS CB  HB3  sing N N 64  
CYS SG  HG   sing N N 65  
CYS OXT HXT  sing N N 66  
F3S FE1 S1   sing N N 67  
F3S FE1 S2   sing N N 68  
F3S FE1 S3   sing N N 69  
F3S FE3 S1   sing N N 70  
F3S FE3 S3   sing N N 71  
F3S FE3 S4   sing N N 72  
F3S FE4 S2   sing N N 73  
F3S FE4 S3   sing N N 74  
F3S FE4 S4   sing N N 75  
GLN N   CA   sing N N 76  
GLN N   H    sing N N 77  
GLN N   H2   sing N N 78  
GLN CA  C    sing N N 79  
GLN CA  CB   sing N N 80  
GLN CA  HA   sing N N 81  
GLN C   O    doub N N 82  
GLN C   OXT  sing N N 83  
GLN CB  CG   sing N N 84  
GLN CB  HB2  sing N N 85  
GLN CB  HB3  sing N N 86  
GLN CG  CD   sing N N 87  
GLN CG  HG2  sing N N 88  
GLN CG  HG3  sing N N 89  
GLN CD  OE1  doub N N 90  
GLN CD  NE2  sing N N 91  
GLN NE2 HE21 sing N N 92  
GLN NE2 HE22 sing N N 93  
GLN OXT HXT  sing N N 94  
GLU N   CA   sing N N 95  
GLU N   H    sing N N 96  
GLU N   H2   sing N N 97  
GLU CA  C    sing N N 98  
GLU CA  CB   sing N N 99  
GLU CA  HA   sing N N 100 
GLU C   O    doub N N 101 
GLU C   OXT  sing N N 102 
GLU CB  CG   sing N N 103 
GLU CB  HB2  sing N N 104 
GLU CB  HB3  sing N N 105 
GLU CG  CD   sing N N 106 
GLU CG  HG2  sing N N 107 
GLU CG  HG3  sing N N 108 
GLU CD  OE1  doub N N 109 
GLU CD  OE2  sing N N 110 
GLU OE2 HE2  sing N N 111 
GLU OXT HXT  sing N N 112 
GLY N   CA   sing N N 113 
GLY N   H    sing N N 114 
GLY N   H2   sing N N 115 
GLY CA  C    sing N N 116 
GLY CA  HA2  sing N N 117 
GLY CA  HA3  sing N N 118 
GLY C   O    doub N N 119 
GLY C   OXT  sing N N 120 
GLY OXT HXT  sing N N 121 
HIS N   CA   sing N N 122 
HIS N   H    sing N N 123 
HIS N   H2   sing N N 124 
HIS CA  C    sing N N 125 
HIS CA  CB   sing N N 126 
HIS CA  HA   sing N N 127 
HIS C   O    doub N N 128 
HIS C   OXT  sing N N 129 
HIS CB  CG   sing N N 130 
HIS CB  HB2  sing N N 131 
HIS CB  HB3  sing N N 132 
HIS CG  ND1  sing Y N 133 
HIS CG  CD2  doub Y N 134 
HIS ND1 CE1  doub Y N 135 
HIS ND1 HD1  sing N N 136 
HIS CD2 NE2  sing Y N 137 
HIS CD2 HD2  sing N N 138 
HIS CE1 NE2  sing Y N 139 
HIS CE1 HE1  sing N N 140 
HIS NE2 HE2  sing N N 141 
HIS OXT HXT  sing N N 142 
HOH O   H1   sing N N 143 
HOH O   H2   sing N N 144 
ILE N   CA   sing N N 145 
ILE N   H    sing N N 146 
ILE N   H2   sing N N 147 
ILE CA  C    sing N N 148 
ILE CA  CB   sing N N 149 
ILE CA  HA   sing N N 150 
ILE C   O    doub N N 151 
ILE C   OXT  sing N N 152 
ILE CB  CG1  sing N N 153 
ILE CB  CG2  sing N N 154 
ILE CB  HB   sing N N 155 
ILE CG1 CD1  sing N N 156 
ILE CG1 HG12 sing N N 157 
ILE CG1 HG13 sing N N 158 
ILE CG2 HG21 sing N N 159 
ILE CG2 HG22 sing N N 160 
ILE CG2 HG23 sing N N 161 
ILE CD1 HD11 sing N N 162 
ILE CD1 HD12 sing N N 163 
ILE CD1 HD13 sing N N 164 
ILE OXT HXT  sing N N 165 
LEU N   CA   sing N N 166 
LEU N   H    sing N N 167 
LEU N   H2   sing N N 168 
LEU CA  C    sing N N 169 
LEU CA  CB   sing N N 170 
LEU CA  HA   sing N N 171 
LEU C   O    doub N N 172 
LEU C   OXT  sing N N 173 
LEU CB  CG   sing N N 174 
LEU CB  HB2  sing N N 175 
LEU CB  HB3  sing N N 176 
LEU CG  CD1  sing N N 177 
LEU CG  CD2  sing N N 178 
LEU CG  HG   sing N N 179 
LEU CD1 HD11 sing N N 180 
LEU CD1 HD12 sing N N 181 
LEU CD1 HD13 sing N N 182 
LEU CD2 HD21 sing N N 183 
LEU CD2 HD22 sing N N 184 
LEU CD2 HD23 sing N N 185 
LEU OXT HXT  sing N N 186 
LYS N   CA   sing N N 187 
LYS N   H    sing N N 188 
LYS N   H2   sing N N 189 
LYS CA  C    sing N N 190 
LYS CA  CB   sing N N 191 
LYS CA  HA   sing N N 192 
LYS C   O    doub N N 193 
LYS C   OXT  sing N N 194 
LYS CB  CG   sing N N 195 
LYS CB  HB2  sing N N 196 
LYS CB  HB3  sing N N 197 
LYS CG  CD   sing N N 198 
LYS CG  HG2  sing N N 199 
LYS CG  HG3  sing N N 200 
LYS CD  CE   sing N N 201 
LYS CD  HD2  sing N N 202 
LYS CD  HD3  sing N N 203 
LYS CE  NZ   sing N N 204 
LYS CE  HE2  sing N N 205 
LYS CE  HE3  sing N N 206 
LYS NZ  HZ1  sing N N 207 
LYS NZ  HZ2  sing N N 208 
LYS NZ  HZ3  sing N N 209 
LYS OXT HXT  sing N N 210 
MET N   CA   sing N N 211 
MET N   H    sing N N 212 
MET N   H2   sing N N 213 
MET CA  C    sing N N 214 
MET CA  CB   sing N N 215 
MET CA  HA   sing N N 216 
MET C   O    doub N N 217 
MET C   OXT  sing N N 218 
MET CB  CG   sing N N 219 
MET CB  HB2  sing N N 220 
MET CB  HB3  sing N N 221 
MET CG  SD   sing N N 222 
MET CG  HG2  sing N N 223 
MET CG  HG3  sing N N 224 
MET SD  CE   sing N N 225 
MET CE  HE1  sing N N 226 
MET CE  HE2  sing N N 227 
MET CE  HE3  sing N N 228 
MET OXT HXT  sing N N 229 
PHE N   CA   sing N N 230 
PHE N   H    sing N N 231 
PHE N   H2   sing N N 232 
PHE CA  C    sing N N 233 
PHE CA  CB   sing N N 234 
PHE CA  HA   sing N N 235 
PHE C   O    doub N N 236 
PHE C   OXT  sing N N 237 
PHE CB  CG   sing N N 238 
PHE CB  HB2  sing N N 239 
PHE CB  HB3  sing N N 240 
PHE CG  CD1  doub Y N 241 
PHE CG  CD2  sing Y N 242 
PHE CD1 CE1  sing Y N 243 
PHE CD1 HD1  sing N N 244 
PHE CD2 CE2  doub Y N 245 
PHE CD2 HD2  sing N N 246 
PHE CE1 CZ   doub Y N 247 
PHE CE1 HE1  sing N N 248 
PHE CE2 CZ   sing Y N 249 
PHE CE2 HE2  sing N N 250 
PHE CZ  HZ   sing N N 251 
PHE OXT HXT  sing N N 252 
PRO N   CA   sing N N 253 
PRO N   CD   sing N N 254 
PRO N   H    sing N N 255 
PRO CA  C    sing N N 256 
PRO CA  CB   sing N N 257 
PRO CA  HA   sing N N 258 
PRO C   O    doub N N 259 
PRO C   OXT  sing N N 260 
PRO CB  CG   sing N N 261 
PRO CB  HB2  sing N N 262 
PRO CB  HB3  sing N N 263 
PRO CG  CD   sing N N 264 
PRO CG  HG2  sing N N 265 
PRO CG  HG3  sing N N 266 
PRO CD  HD2  sing N N 267 
PRO CD  HD3  sing N N 268 
PRO OXT HXT  sing N N 269 
SER N   CA   sing N N 270 
SER N   H    sing N N 271 
SER N   H2   sing N N 272 
SER CA  C    sing N N 273 
SER CA  CB   sing N N 274 
SER CA  HA   sing N N 275 
SER C   O    doub N N 276 
SER C   OXT  sing N N 277 
SER CB  OG   sing N N 278 
SER CB  HB2  sing N N 279 
SER CB  HB3  sing N N 280 
SER OG  HG   sing N N 281 
SER OXT HXT  sing N N 282 
THR N   CA   sing N N 283 
THR N   H    sing N N 284 
THR N   H2   sing N N 285 
THR CA  C    sing N N 286 
THR CA  CB   sing N N 287 
THR CA  HA   sing N N 288 
THR C   O    doub N N 289 
THR C   OXT  sing N N 290 
THR CB  OG1  sing N N 291 
THR CB  CG2  sing N N 292 
THR CB  HB   sing N N 293 
THR OG1 HG1  sing N N 294 
THR CG2 HG21 sing N N 295 
THR CG2 HG22 sing N N 296 
THR CG2 HG23 sing N N 297 
THR OXT HXT  sing N N 298 
TRP N   CA   sing N N 299 
TRP N   H    sing N N 300 
TRP N   H2   sing N N 301 
TRP CA  C    sing N N 302 
TRP CA  CB   sing N N 303 
TRP CA  HA   sing N N 304 
TRP C   O    doub N N 305 
TRP C   OXT  sing N N 306 
TRP CB  CG   sing N N 307 
TRP CB  HB2  sing N N 308 
TRP CB  HB3  sing N N 309 
TRP CG  CD1  doub Y N 310 
TRP CG  CD2  sing Y N 311 
TRP CD1 NE1  sing Y N 312 
TRP CD1 HD1  sing N N 313 
TRP CD2 CE2  doub Y N 314 
TRP CD2 CE3  sing Y N 315 
TRP NE1 CE2  sing Y N 316 
TRP NE1 HE1  sing N N 317 
TRP CE2 CZ2  sing Y N 318 
TRP CE3 CZ3  doub Y N 319 
TRP CE3 HE3  sing N N 320 
TRP CZ2 CH2  doub Y N 321 
TRP CZ2 HZ2  sing N N 322 
TRP CZ3 CH2  sing Y N 323 
TRP CZ3 HZ3  sing N N 324 
TRP CH2 HH2  sing N N 325 
TRP OXT HXT  sing N N 326 
TYR N   CA   sing N N 327 
TYR N   H    sing N N 328 
TYR N   H2   sing N N 329 
TYR CA  C    sing N N 330 
TYR CA  CB   sing N N 331 
TYR CA  HA   sing N N 332 
TYR C   O    doub N N 333 
TYR C   OXT  sing N N 334 
TYR CB  CG   sing N N 335 
TYR CB  HB2  sing N N 336 
TYR CB  HB3  sing N N 337 
TYR CG  CD1  doub Y N 338 
TYR CG  CD2  sing Y N 339 
TYR CD1 CE1  sing Y N 340 
TYR CD1 HD1  sing N N 341 
TYR CD2 CE2  doub Y N 342 
TYR CD2 HD2  sing N N 343 
TYR CE1 CZ   doub Y N 344 
TYR CE1 HE1  sing N N 345 
TYR CE2 CZ   sing Y N 346 
TYR CE2 HE2  sing N N 347 
TYR CZ  OH   sing N N 348 
TYR OH  HH   sing N N 349 
TYR OXT HXT  sing N N 350 
VAL N   CA   sing N N 351 
VAL N   H    sing N N 352 
VAL N   H2   sing N N 353 
VAL CA  C    sing N N 354 
VAL CA  CB   sing N N 355 
VAL CA  HA   sing N N 356 
VAL C   O    doub N N 357 
VAL C   OXT  sing N N 358 
VAL CB  CG1  sing N N 359 
VAL CB  CG2  sing N N 360 
VAL CB  HB   sing N N 361 
VAL CG1 HG11 sing N N 362 
VAL CG1 HG12 sing N N 363 
VAL CG1 HG13 sing N N 364 
VAL CG2 HG21 sing N N 365 
VAL CG2 HG22 sing N N 366 
VAL CG2 HG23 sing N N 367 
VAL OXT HXT  sing N N 368 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Ministry of Science and Higher Education of the Russian Federation' 'Russian Federation' 075-15-2021-1354 1 
'Ministry of Science and Higher Education of the Russian Federation' 'Russian Federation' 122030100168-2   2 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        F3S 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   F3S 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   1VJW 
_pdbx_initial_refinement_model.details          ? 
# 
_space_group.name_H-M_alt     'R 3 2 :H' 
_space_group.name_Hall        
;R 3 2"
;
_space_group.IT_number        155 
_space_group.crystal_system   trigonal 
_space_group.id               1 
# 
_atom_sites.entry_id                    8AMP 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.021295 
_atom_sites.fract_transf_matrix[1][2]   0.012295 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.024590 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006147 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356  2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
FE ? ? 20.90327 4.99816 ? ? 2.55100  38.46870 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 4.01032  2.96436 ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 4.49882  3.47563 ? ? 15.80542 1.70748  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732  6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_