data_8AR3 # _entry.id 8AR3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.368 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8AR3 pdb_00008ar3 10.2210/pdb8ar3/pdb WWPDB D_1292124463 ? ? BMRB 34753 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of TLR9 transmembrane and cytoplasmic juxtamembrane regions' _pdbx_database_related.db_id 34753 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8AR3 _pdbx_database_status.recvd_initial_deposition_date 2022-08-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kornilov, F.D.' 1 ? 'Shabalkina, A.V.' 2 ? 'Goncharuk, M.V.' 3 ? 'Goncharuk, S.A.' 4 ? 'Arseniev, A.S.' 5 ? 'Mineev, K.S.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 1503 _citation.page_last 1503 _citation.title 'The architecture of transmembrane and cytoplasmic juxtamembrane regions of Toll-like receptors.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-023-37042-6 _citation.pdbx_database_id_PubMed 36932058 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kornilov, F.D.' 1 ? primary 'Shabalkina, A.V.' 2 ? primary 'Lin, C.' 3 ? primary 'Volynsky, P.E.' 4 ? primary 'Kot, E.F.' 5 ? primary 'Kayushin, A.L.' 6 ? primary 'Lushpa, V.A.' 7 ? primary 'Goncharuk, M.V.' 8 ? primary 'Arseniev, A.S.' 9 ? primary 'Goncharuk, S.A.' 10 ? primary 'Wang, X.' 11 ? primary 'Mineev, K.S.' 12 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8AR3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8AR3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Toll-like receptor 9' _entity.formula_weight 5805.931 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MEALSWDCFALSLLAVALGLGVPMLHHLCGWDLWYCFHLCLAWLPWRGRQ _entity_poly.pdbx_seq_one_letter_code_can MEALSWDCFALSLLAVALGLGVPMLHHLCGWDLWYCFHLCLAWLPWRGRQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ALA n 1 4 LEU n 1 5 SER n 1 6 TRP n 1 7 ASP n 1 8 CYS n 1 9 PHE n 1 10 ALA n 1 11 LEU n 1 12 SER n 1 13 LEU n 1 14 LEU n 1 15 ALA n 1 16 VAL n 1 17 ALA n 1 18 LEU n 1 19 GLY n 1 20 LEU n 1 21 GLY n 1 22 VAL n 1 23 PRO n 1 24 MET n 1 25 LEU n 1 26 HIS n 1 27 HIS n 1 28 LEU n 1 29 CYS n 1 30 GLY n 1 31 TRP n 1 32 ASP n 1 33 LEU n 1 34 TRP n 1 35 TYR n 1 36 CYS n 1 37 PHE n 1 38 HIS n 1 39 LEU n 1 40 CYS n 1 41 LEU n 1 42 ALA n 1 43 TRP n 1 44 LEU n 1 45 PRO n 1 46 TRP n 1 47 ARG n 1 48 GLY n 1 49 ARG n 1 50 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 50 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TLR9, UNQ5798/PRO19605' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TLR9_HUMAN _struct_ref.pdbx_db_accession Q9NR96 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EALSWDCFALSLLAVALGLGVPMLHHLCGWDLWYCFHLCLAWLPWRGRQ _struct_ref.pdbx_align_begin 812 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8AR3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NR96 _struct_ref_seq.db_align_beg 812 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 860 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 812 _struct_ref_seq.pdbx_auth_seq_align_end 860 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8AR3 _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9NR96 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 811 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic constant time' 1 isotropic 3 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 4 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 5 1 1 '3D HNCO' 1 isotropic 6 1 1 '3D HNCA' 1 isotropic 7 1 1 '3D HN(CO)CA' 1 isotropic 8 1 1 '3D HCCH-TOCSY' 1 isotropic 9 1 1 '3D 1H-15N NOESY' 1 isotropic 10 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 11 1 1 '2D CBHD aromatic' 1 isotropic 12 1 1 '3D hCCH-COSY aromatic' 1 isotropic 13 2 2 '2D 1H-15N HSQC' 2 anisotropic 14 2 2 '2D 1H-15N IPAP-HSQC' 2 anisotropic # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 318 atm AMBIENT 7.0 50 ? ? mM conditions_main 0.1 pH ? ? K 2 318 atm AMBIENT 7.0 170 ? ? mM conditions_RDC 0.1 pH ? ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1000 uM [U-13C; U-15N] protein, 119 mM LPPC, 41 mM LPPG, 20 mM potassium phosphate, 5 mM TCEP, 1 mM TSP, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N13C_sample micelle ? 2 ;180 uM [U-15N] protein, 84 mM LPPC, 22 mM LPPG, 30 mM potassium phosphate, 5 mM TCEP, 1 mM TSP, 28 mg/mL dGpG, 80 mM potassium chloride, 0.05 % w/v sodium azide, 95% H2O/5% D2O ; '95% H2O/5% D2O' 15N_sample_forRDC micelle ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 800 ? # _pdbx_nmr_refine.entry_id 8AR3 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 8AR3 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8AR3 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 2 processing TopSpin 3.0 'Bruker Biospin' 3 'chemical shift assignment' CARA 1.9.7.1 'Keller and Wuthrich' 4 'peak picking' CARA 1.9.7.1 'Keller and Wuthrich' 5 processing qMDD 3.2 'Maxim Mayzel, Krzysztof Kazimierczuk, Vladislav Orekhov' 6 'data analysis' PyMOL ? 'Schrodinger, Inc.' 7 'data analysis' MOLMOL ? 'Koradi, Billeter and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8AR3 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8AR3 _struct.title 'Solution structure of TLR9 transmembrane and cytoplasmic juxtamembrane regions' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8AR3 _struct_keywords.text 'PROTEIN, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? HIS A 27 ? SER A 815 HIS A 837 1 ? 23 HELX_P HELX_P2 AA2 LEU A 33 ? LEU A 44 ? LEU A 843 LEU A 854 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 8AR3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 8AR3 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 811 811 MET MET A . n A 1 2 GLU 2 812 812 GLU GLU A . n A 1 3 ALA 3 813 813 ALA ALA A . n A 1 4 LEU 4 814 814 LEU LEU A . n A 1 5 SER 5 815 815 SER SER A . n A 1 6 TRP 6 816 816 TRP TRP A . n A 1 7 ASP 7 817 817 ASP ASP A . n A 1 8 CYS 8 818 818 CYS CYS A . n A 1 9 PHE 9 819 819 PHE PHE A . n A 1 10 ALA 10 820 820 ALA ALA A . n A 1 11 LEU 11 821 821 LEU LEU A . n A 1 12 SER 12 822 822 SER SER A . n A 1 13 LEU 13 823 823 LEU LEU A . n A 1 14 LEU 14 824 824 LEU LEU A . n A 1 15 ALA 15 825 825 ALA ALA A . n A 1 16 VAL 16 826 826 VAL VAL A . n A 1 17 ALA 17 827 827 ALA ALA A . n A 1 18 LEU 18 828 828 LEU LEU A . n A 1 19 GLY 19 829 829 GLY GLY A . n A 1 20 LEU 20 830 830 LEU LEU A . n A 1 21 GLY 21 831 831 GLY GLY A . n A 1 22 VAL 22 832 832 VAL VAL A . n A 1 23 PRO 23 833 833 PRO PRO A . n A 1 24 MET 24 834 834 MET MET A . n A 1 25 LEU 25 835 835 LEU LEU A . n A 1 26 HIS 26 836 836 HIS HIS A . n A 1 27 HIS 27 837 837 HIS HIS A . n A 1 28 LEU 28 838 838 LEU LEU A . n A 1 29 CYS 29 839 839 CYS CYS A . n A 1 30 GLY 30 840 840 GLY GLY A . n A 1 31 TRP 31 841 841 TRP TRP A . n A 1 32 ASP 32 842 842 ASP ASP A . n A 1 33 LEU 33 843 843 LEU LEU A . n A 1 34 TRP 34 844 844 TRP TRP A . n A 1 35 TYR 35 845 845 TYR TYR A . n A 1 36 CYS 36 846 846 CYS CYS A . n A 1 37 PHE 37 847 847 PHE PHE A . n A 1 38 HIS 38 848 848 HIS HIS A . n A 1 39 LEU 39 849 849 LEU LEU A . n A 1 40 CYS 40 850 850 CYS CYS A . n A 1 41 LEU 41 851 851 LEU LEU A . n A 1 42 ALA 42 852 852 ALA ALA A . n A 1 43 TRP 43 853 853 TRP TRP A . n A 1 44 LEU 44 854 854 LEU LEU A . n A 1 45 PRO 45 855 855 PRO PRO A . n A 1 46 TRP 46 856 856 TRP TRP A . n A 1 47 ARG 47 857 857 ARG ARG A . n A 1 48 GLY 48 858 858 GLY GLY A . n A 1 49 ARG 49 859 859 ARG ARG A . n A 1 50 GLN 50 860 860 GLN GLN A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email mineev@nmr.ru _pdbx_contact_author.name_first Konstantin _pdbx_contact_author.name_last Mineev _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2418-9421 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-03-22 2 'Structure model' 1 1 2023-03-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation_author.name' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 protein 1000 ? uM '[U-13C; U-15N]' 1 LPPC 119 ? mM 'natural abundance' 1 LPPG 41 ? mM 'natural abundance' 1 'potassium phosphate' 20 ? mM 'natural abundance' 1 TCEP 5 ? mM 'natural abundance' 1 TSP 1 ? mM 'natural abundance' 2 protein 180 ? uM '[U-15N]' 2 LPPC 84 ? mM 'natural abundance' 2 LPPG 22 ? mM 'natural abundance' 2 'potassium phosphate' 30 ? mM 'natural abundance' 2 TCEP 5 ? mM 'natural abundance' 2 TSP 1 ? mM 'natural abundance' 2 dGpG 28 ? mg/mL 'natural abundance' 2 'potassium chloride' 80 ? mM 'natural abundance' 2 'sodium azide' 0.05 ? '% w/v' 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 839 ? ? -109.20 40.95 2 1 LEU A 854 ? ? -49.20 155.37 3 1 ARG A 857 ? ? -57.95 -178.36 4 2 ASP A 842 ? ? -96.26 48.12 5 3 CYS A 839 ? ? -94.87 34.80 6 3 TRP A 841 ? ? -57.67 -176.11 7 3 ASP A 842 ? ? -99.80 43.26 8 4 LEU A 814 ? ? -99.53 31.31 9 4 LEU A 854 ? ? -49.02 155.25 10 4 TRP A 856 ? ? -154.54 88.20 11 6 LEU A 814 ? ? 54.68 93.30 12 6 TRP A 841 ? ? -57.06 -178.01 13 6 TRP A 856 ? ? -48.74 -75.13 14 8 TRP A 841 ? ? -56.53 -178.81 15 9 CYS A 839 ? ? 65.69 65.55 16 9 LEU A 854 ? ? -49.42 154.50 17 10 ASP A 842 ? ? -65.36 99.98 18 10 ARG A 859 ? ? -55.15 173.76 19 11 ARG A 857 ? ? -94.31 39.40 20 12 GLU A 812 ? ? -98.54 -60.95 21 12 CYS A 839 ? ? 179.04 82.03 22 14 LEU A 814 ? ? 54.77 93.96 23 14 TRP A 841 ? ? -55.53 178.64 24 14 TRP A 856 ? ? -48.62 -76.19 25 15 SER A 815 ? ? -58.28 -178.04 26 15 ARG A 857 ? ? 60.34 71.82 27 16 TRP A 841 ? ? -60.74 -176.13 28 16 LEU A 854 ? ? -49.22 155.38 29 16 TRP A 856 ? ? -154.48 86.18 30 17 CYS A 839 ? ? 61.19 60.49 31 18 LEU A 854 ? ? -49.25 155.16 32 18 TRP A 856 ? ? -153.20 85.37 33 19 ASP A 842 ? ? -122.00 -168.31 34 19 TRP A 856 ? ? -49.63 -76.24 # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 22-14-0020 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'NMR Distance Restraints' 'no extra NOE peaks' 2 1 'NMR relaxation study' 'values of tau c of alpha helix residues conform to monomer assembly' #