data_8ATJ # _entry.id 8ATJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8ATJ pdb_00008atj 10.2210/pdb8atj/pdb WWPDB D_1292124141 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-30 2 'Structure model' 1 1 2022-12-14 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' citation 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_ISSN' 3 2 'Structure model' '_citation.pdbx_database_id_DOI' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.identifier_ORCID' 7 2 'Structure model' '_citation_author.name' 8 3 'Structure model' '_citation.country' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8ATJ _pdbx_database_status.recvd_initial_deposition_date 2022-08-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email ibento@embl-hamburg.de _pdbx_contact_author.name_first Isabel _pdbx_contact_author.name_last Bento _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-3801-4929 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bento, I.' 1 0000-0003-3801-4929 'Gracia Alai, M.' 2 0000-0003-3788-3399 'Kreienkamp, J.-H.' 3 0000-0002-8871-9970 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Mol Psychiatry' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1476-5578 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Structural deficits in key domains of Shank2 lead to alterations in postsynaptic nanoclusters and to a neurodevelopmental disorder in humans. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41380-022-01882-3 _citation.pdbx_database_id_PubMed 36450866 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hassani Nia, F.' 1 ? primary 'Woike, D.' 2 ? primary 'Bento, I.' 3 ? primary 'Niebling, S.' 4 ? primary 'Tibbe, D.' 5 ? primary 'Schulz, K.' 6 ? primary 'Hirnet, D.' 7 ? primary 'Skiba, M.' 8 ? primary 'Honck, H.H.' 9 ? primary 'Veith, K.' 10 ? primary 'Gunther, C.' 11 ? primary 'Scholz, T.' 12 ? primary 'Bierhals, T.' 13 ? primary 'Driemeyer, J.' 14 ? primary 'Bend, R.' 15 ? primary 'Failla, A.V.' 16 ? primary 'Lohr, C.' 17 0000-0001-6518-6422 primary 'Alai, M.G.' 18 ? primary 'Kreienkamp, H.J.' 19 0000-0002-8871-9970 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Isoform 4 of SH3 and multiple ankyrin repeat domains protein 2' 8111.210 1 ? ? ? ? 2 non-polymer syn 'FORMIC ACID' 46.025 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 5 water nat water 18.015 51 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Shank2,Cortactin-binding protein 1,CortBP1,Proline-rich synapse-associated protein 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code TKPVHLWTKPDVADWLESLNLGEHKEAFMDNEIDGSHLPNLQKEDLIDLGVTRVGHRMNIERALKQLLDR _entity_poly.pdbx_seq_one_letter_code_can TKPVHLWTKPDVADWLESLNLGEHKEAFMDNEIDGSHLPNLQKEDLIDLGVTRVGHRMNIERALKQLLDR _entity_poly.pdbx_strand_id AAA _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FORMIC ACID' FMT 3 'CHLORIDE ION' CL 4 'ZINC ION' ZN 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 LYS n 1 3 PRO n 1 4 VAL n 1 5 HIS n 1 6 LEU n 1 7 TRP n 1 8 THR n 1 9 LYS n 1 10 PRO n 1 11 ASP n 1 12 VAL n 1 13 ALA n 1 14 ASP n 1 15 TRP n 1 16 LEU n 1 17 GLU n 1 18 SER n 1 19 LEU n 1 20 ASN n 1 21 LEU n 1 22 GLY n 1 23 GLU n 1 24 HIS n 1 25 LYS n 1 26 GLU n 1 27 ALA n 1 28 PHE n 1 29 MET n 1 30 ASP n 1 31 ASN n 1 32 GLU n 1 33 ILE n 1 34 ASP n 1 35 GLY n 1 36 SER n 1 37 HIS n 1 38 LEU n 1 39 PRO n 1 40 ASN n 1 41 LEU n 1 42 GLN n 1 43 LYS n 1 44 GLU n 1 45 ASP n 1 46 LEU n 1 47 ILE n 1 48 ASP n 1 49 LEU n 1 50 GLY n 1 51 VAL n 1 52 THR n 1 53 ARG n 1 54 VAL n 1 55 GLY n 1 56 HIS n 1 57 ARG n 1 58 MET n 1 59 ASN n 1 60 ILE n 1 61 GLU n 1 62 ARG n 1 63 ALA n 1 64 LEU n 1 65 LYS n 1 66 GLN n 1 67 LEU n 1 68 LEU n 1 69 ASP n 1 70 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 70 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SHANK2, CORTBP1, KIAA1022, PROSAP1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line 'HEK 193T' _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1780 1780 THR THR AAA . n A 1 2 LYS 2 1781 1781 LYS LYS AAA . n A 1 3 PRO 3 1782 1782 PRO PRO AAA . n A 1 4 VAL 4 1783 1783 VAL VAL AAA . n A 1 5 HIS 5 1784 1784 HIS HIS AAA . n A 1 6 LEU 6 1785 1785 LEU LEU AAA . n A 1 7 TRP 7 1786 1786 TRP TRP AAA . n A 1 8 THR 8 1787 1787 THR THR AAA . n A 1 9 LYS 9 1788 1788 LYS LYS AAA . n A 1 10 PRO 10 1789 1789 PRO PRO AAA . n A 1 11 ASP 11 1790 1790 ASP ASP AAA . n A 1 12 VAL 12 1791 1791 VAL VAL AAA . n A 1 13 ALA 13 1792 1792 ALA ALA AAA . n A 1 14 ASP 14 1793 1793 ASP ASP AAA . n A 1 15 TRP 15 1794 1794 TRP TRP AAA . n A 1 16 LEU 16 1795 1795 LEU LEU AAA . n A 1 17 GLU 17 1796 1796 GLU GLU AAA . n A 1 18 SER 18 1797 1797 SER SER AAA . n A 1 19 LEU 19 1798 1798 LEU LEU AAA . n A 1 20 ASN 20 1799 1799 ASN ASN AAA . n A 1 21 LEU 21 1800 1800 LEU LEU AAA . n A 1 22 GLY 22 1801 1801 GLY GLY AAA . n A 1 23 GLU 23 1802 1802 GLU GLU AAA . n A 1 24 HIS 24 1803 1803 HIS HIS AAA . n A 1 25 LYS 25 1804 1804 LYS LYS AAA . n A 1 26 GLU 26 1805 1805 GLU GLU AAA . n A 1 27 ALA 27 1806 1806 ALA ALA AAA . n A 1 28 PHE 28 1807 1807 PHE PHE AAA . n A 1 29 MET 29 1808 1808 MET MET AAA . n A 1 30 ASP 30 1809 1809 ASP ASP AAA . n A 1 31 ASN 31 1810 1810 ASN ASN AAA . n A 1 32 GLU 32 1811 1811 GLU GLU AAA . n A 1 33 ILE 33 1812 1812 ILE ILE AAA . n A 1 34 ASP 34 1813 1813 ASP ASP AAA . n A 1 35 GLY 35 1814 1814 GLY GLY AAA . n A 1 36 SER 36 1815 1815 SER SER AAA . n A 1 37 HIS 37 1816 1816 HIS HIS AAA . n A 1 38 LEU 38 1817 1817 LEU LEU AAA . n A 1 39 PRO 39 1818 1818 PRO PRO AAA . n A 1 40 ASN 40 1819 1819 ASN ASN AAA . n A 1 41 LEU 41 1820 1820 LEU LEU AAA . n A 1 42 GLN 42 1821 1821 GLN GLN AAA . n A 1 43 LYS 43 1822 1822 LYS LYS AAA . n A 1 44 GLU 44 1823 1823 GLU GLU AAA . n A 1 45 ASP 45 1824 1824 ASP ASP AAA . n A 1 46 LEU 46 1825 1825 LEU LEU AAA . n A 1 47 ILE 47 1826 1826 ILE ILE AAA . n A 1 48 ASP 48 1827 1827 ASP ASP AAA . n A 1 49 LEU 49 1828 1828 LEU LEU AAA . n A 1 50 GLY 50 1829 1829 GLY GLY AAA . n A 1 51 VAL 51 1830 1830 VAL VAL AAA . n A 1 52 THR 52 1831 1831 THR THR AAA . n A 1 53 ARG 53 1832 1832 ARG ARG AAA . n A 1 54 VAL 54 1833 1833 VAL VAL AAA . n A 1 55 GLY 55 1834 1834 GLY GLY AAA . n A 1 56 HIS 56 1835 1835 HIS HIS AAA . n A 1 57 ARG 57 1836 1836 ARG ARG AAA . n A 1 58 MET 58 1837 1837 MET MET AAA . n A 1 59 ASN 59 1838 1838 ASN ASN AAA . n A 1 60 ILE 60 1839 1839 ILE ILE AAA . n A 1 61 GLU 61 1840 1840 GLU GLU AAA . n A 1 62 ARG 62 1841 1841 ARG ARG AAA . n A 1 63 ALA 63 1842 1842 ALA ALA AAA . n A 1 64 LEU 64 1843 1843 LEU LEU AAA . n A 1 65 LYS 65 1844 1844 LYS LYS AAA . n A 1 66 GLN 66 1845 1845 GLN GLN AAA . n A 1 67 LEU 67 1846 1846 LEU LEU AAA . n A 1 68 LEU 68 1847 1847 LEU LEU AAA . n A 1 69 ASP 69 1848 1848 ASP ASP AAA . n A 1 70 ARG 70 1849 1849 ARG ARG AAA . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FMT 1 1901 1880 FMT FMT AAA . C 3 CL 1 1902 1 CL CL AAA . D 4 ZN 1 1903 1 ZN ZN AAA . E 5 HOH 1 2001 44 HOH HOH AAA . E 5 HOH 2 2002 39 HOH HOH AAA . E 5 HOH 3 2003 41 HOH HOH AAA . E 5 HOH 4 2004 1 HOH HOH AAA . E 5 HOH 5 2005 40 HOH HOH AAA . E 5 HOH 6 2006 23 HOH HOH AAA . E 5 HOH 7 2007 14 HOH HOH AAA . E 5 HOH 8 2008 26 HOH HOH AAA . E 5 HOH 9 2009 34 HOH HOH AAA . E 5 HOH 10 2010 25 HOH HOH AAA . E 5 HOH 11 2011 29 HOH HOH AAA . E 5 HOH 12 2012 7 HOH HOH AAA . E 5 HOH 13 2013 11 HOH HOH AAA . E 5 HOH 14 2014 46 HOH HOH AAA . E 5 HOH 15 2015 16 HOH HOH AAA . E 5 HOH 16 2016 4 HOH HOH AAA . E 5 HOH 17 2017 6 HOH HOH AAA . E 5 HOH 18 2018 9 HOH HOH AAA . E 5 HOH 19 2019 8 HOH HOH AAA . E 5 HOH 20 2020 3 HOH HOH AAA . E 5 HOH 21 2021 33 HOH HOH AAA . E 5 HOH 22 2022 12 HOH HOH AAA . E 5 HOH 23 2023 5 HOH HOH AAA . E 5 HOH 24 2024 36 HOH HOH AAA . E 5 HOH 25 2025 21 HOH HOH AAA . E 5 HOH 26 2026 18 HOH HOH AAA . E 5 HOH 27 2027 15 HOH HOH AAA . E 5 HOH 28 2028 13 HOH HOH AAA . E 5 HOH 29 2029 2 HOH HOH AAA . E 5 HOH 30 2030 10 HOH HOH AAA . E 5 HOH 31 2031 50 HOH HOH AAA . E 5 HOH 32 2032 28 HOH HOH AAA . E 5 HOH 33 2033 51 HOH HOH AAA . E 5 HOH 34 2034 37 HOH HOH AAA . E 5 HOH 35 2035 47 HOH HOH AAA . E 5 HOH 36 2036 32 HOH HOH AAA . E 5 HOH 37 2037 38 HOH HOH AAA . E 5 HOH 38 2038 31 HOH HOH AAA . E 5 HOH 39 2039 22 HOH HOH AAA . E 5 HOH 40 2040 43 HOH HOH AAA . E 5 HOH 41 2041 48 HOH HOH AAA . E 5 HOH 42 2042 30 HOH HOH AAA . E 5 HOH 43 2043 27 HOH HOH AAA . E 5 HOH 44 2044 49 HOH HOH AAA . E 5 HOH 45 2045 24 HOH HOH AAA . E 5 HOH 46 2046 17 HOH HOH AAA . E 5 HOH 47 2047 35 HOH HOH AAA . E 5 HOH 48 2048 45 HOH HOH AAA . E 5 HOH 49 2049 42 HOH HOH AAA . E 5 HOH 50 2050 19 HOH HOH AAA . E 5 HOH 51 2051 20 HOH HOH AAA . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8ATJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.490 _cell.length_a_esd ? _cell.length_b 57.490 _cell.length_b_esd ? _cell.length_c 48.033 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8ATJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8ATJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.82 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.46 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Bis Tris pH5.5, 0.3M of Magnesium formate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-03-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9762 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P14 (MX2)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9762 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P14 (MX2)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8ATJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 49.8 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5201 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.92 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.8 _reflns.pdbx_Rmerge_I_obs 0.2587 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.07 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.05916 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.16 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.61 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 516 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.42 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 19.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.3268 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.568 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.269 _refine.aniso_B[1][2] 0.135 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 0.269 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -0.873 _refine.B_iso_max ? _refine.B_iso_mean 38.747 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.957 _refine.correlation_coeff_Fo_to_Fc_free 0.926 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8ATJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.117 _refine.ls_d_res_low 49.788 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5122 _refine.ls_number_reflns_R_free 247 _refine.ls_number_reflns_R_work 4875 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.085 _refine.ls_percent_reflns_R_free 4.822 _refine.ls_R_factor_all 0.198 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2517 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1956 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2F44 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.218 _refine.pdbx_overall_ESU_R_Free 0.196 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 8.048 _refine.overall_SU_ML 0.186 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.117 _refine_hist.d_res_low 49.788 _refine_hist.number_atoms_solvent 51 _refine_hist.number_atoms_total 626 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 570 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.013 583 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 559 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.488 1.637 787 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.220 1.598 1290 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.684 5.000 69 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 42.586 23.235 34 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.627 15.000 109 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 22.922 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.075 0.200 72 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 656 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 124 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.214 0.200 136 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.177 0.200 522 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.150 0.200 273 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.078 0.200 256 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.249 0.200 35 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.075 0.200 1 ? r_symmetry_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.249 0.200 2 ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? 0.248 0.200 6 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.125 0.200 28 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.164 0.200 7 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 2.641 3.793 279 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.640 3.792 280 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.774 5.662 347 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.769 5.680 348 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.546 4.297 304 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.521 4.305 302 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 5.495 6.276 440 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.497 6.272 441 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.996 45.479 665 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 7.996 45.153 657 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.117 2.172 378 . 13 267 74.0741 . 1.393 . 1.637 . 1.379 . . . . . 1.460 . 20 . 0.294 0.416 'X-RAY DIFFRACTION' 2.172 2.231 367 . 14 353 100.0000 . 0.425 . 0.328 . 0.430 . . . . . 0.440 . 20 . 0.626 0.655 'X-RAY DIFFRACTION' 2.231 2.296 370 . 24 346 100.0000 . 0.293 . 0.339 . 0.290 . . . . . 0.290 . 20 . 0.795 0.734 'X-RAY DIFFRACTION' 2.296 2.366 349 . 21 328 100.0000 . 0.242 . 0.271 . 0.240 . . . . . 0.240 . 20 . 0.846 0.818 'X-RAY DIFFRACTION' 2.366 2.444 336 . 23 313 100.0000 . 0.198 . 0.246 . 0.195 . . . . . 0.191 . 20 . 0.895 0.859 'X-RAY DIFFRACTION' 2.444 2.529 344 . 14 330 100.0000 . 0.210 . 0.317 . 0.206 . . . . . 0.205 . 20 . 0.896 0.874 'X-RAY DIFFRACTION' 2.529 2.625 317 . 16 301 100.0000 . 0.210 . 0.210 . 0.210 . . . . . 0.197 . 20 . 0.885 0.907 'X-RAY DIFFRACTION' 2.625 2.732 303 . 8 295 100.0000 . 0.241 . 0.202 . 0.242 . . . . . 0.227 . 20 . 0.865 0.817 'X-RAY DIFFRACTION' 2.732 2.853 302 . 9 293 100.0000 . 0.235 . 0.449 . 0.227 . . . . . 0.211 . 20 . 0.872 0.824 'X-RAY DIFFRACTION' 2.853 2.991 283 . 9 274 100.0000 . 0.213 . 0.195 . 0.213 . . . . . 0.200 . 20 . 0.879 0.895 'X-RAY DIFFRACTION' 2.991 3.153 265 . 13 252 100.0000 . 0.185 . 0.207 . 0.184 . . . . . 0.175 . 20 . 0.899 0.891 'X-RAY DIFFRACTION' 3.153 3.343 248 . 13 235 100.0000 . 0.214 . 0.376 . 0.206 . . . . . 0.189 . 20 . 0.915 0.852 'X-RAY DIFFRACTION' 3.343 3.573 251 . 14 237 100.0000 . 0.197 . 0.269 . 0.192 . . . . . 0.183 . 20 . 0.946 0.943 'X-RAY DIFFRACTION' 3.573 3.857 223 . 3 218 99.1031 . 0.147 . 0.381 . 0.144 . . . . . 0.136 . 20 . 0.969 0.926 'X-RAY DIFFRACTION' 3.857 4.223 200 . 10 190 100.0000 . 0.120 . 0.087 . 0.122 . . . . . 0.115 . 20 . 0.978 0.980 'X-RAY DIFFRACTION' 4.223 4.717 199 . 11 188 100.0000 . 0.115 . 0.168 . 0.112 . . . . . 0.107 . 20 . 0.982 0.963 'X-RAY DIFFRACTION' 4.717 5.439 164 . 16 148 100.0000 . 0.146 . 0.200 . 0.140 . . . . . 0.129 . 20 . 0.970 0.965 'X-RAY DIFFRACTION' 5.439 6.641 143 . 4 139 100.0000 . 0.185 . 0.260 . 0.183 . . . . . 0.174 . 20 . 0.949 0.956 'X-RAY DIFFRACTION' 6.641 9.309 115 . 9 106 100.0000 . 0.161 . 0.098 . 0.168 . . . . . 0.156 . 20 . 0.962 0.981 'X-RAY DIFFRACTION' 9.309 49.788 65 . 3 62 100.0000 . 0.219 . 0.681 . 0.200 . . . . . 0.182 . 20 . 0.935 0.995 # _struct.entry_id 8ATJ _struct.title 'Crystal Structure of Shank2-SAM domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8ATJ _struct_keywords.text 'synaptic scaffold protein; Zn2+ binding; Zn-dependent polymerization;, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SHAN2_HUMAN _struct_ref.pdbx_db_accession Q9UPX8 _struct_ref.pdbx_db_isoform Q9UPX8-4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TKPVHLWTKPDVADWLESLNLGEHKEAFMDNEIDGSHLPNLQKEDLIDLGVTRVGHRMNIERALKQLLDR _struct_ref.pdbx_align_begin 1185 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8ATJ _struct_ref_seq.pdbx_strand_id AAA _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UPX8 _struct_ref_seq.db_align_beg 1185 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1254 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1780 _struct_ref_seq.pdbx_auth_seq_align_end 1849 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 340 ? 1 MORE -43 ? 1 'SSA (A^2)' 4560 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 3 ? TRP A 7 ? PRO AAA 1782 TRP AAA 1786 5 ? 5 HELX_P HELX_P2 AA2 THR A 8 ? LEU A 19 ? THR AAA 1787 LEU AAA 1798 1 ? 12 HELX_P HELX_P3 AA3 LEU A 21 ? GLU A 23 ? LEU AAA 1800 GLU AAA 1802 5 ? 3 HELX_P HELX_P4 AA4 HIS A 24 ? ASN A 31 ? HIS AAA 1803 ASN AAA 1810 1 ? 8 HELX_P HELX_P5 AA5 ASP A 34 ? LEU A 41 ? ASP AAA 1813 LEU AAA 1820 5 ? 8 HELX_P HELX_P6 AA6 GLN A 42 ? LEU A 49 ? GLN AAA 1821 LEU AAA 1828 1 ? 8 HELX_P HELX_P7 AA7 ARG A 53 ? LEU A 68 ? ARG AAA 1832 LEU AAA 1847 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 24 NE2 ? ? ? 1_555 D ZN . ZN ? ? AAA HIS 1803 AAA ZN 1903 1_555 ? ? ? ? ? ? ? 1.870 ? ? metalc2 metalc ? ? A HIS 56 ND1 ? ? ? 1_555 D ZN . ZN ? ? AAA HIS 1835 AAA ZN 1903 1_555 ? ? ? ? ? ? ? 1.764 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id NE2 _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id HIS _pdbx_struct_conn_angle.ptnr1_label_seq_id 24 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id AAA _pdbx_struct_conn_angle.ptnr1_auth_comp_id HIS _pdbx_struct_conn_angle.ptnr1_auth_seq_id 1803 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id ZN _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id D _pdbx_struct_conn_angle.ptnr2_label_comp_id ZN _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id AAA _pdbx_struct_conn_angle.ptnr2_auth_comp_id ZN _pdbx_struct_conn_angle.ptnr2_auth_seq_id 1903 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id ND1 _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id A _pdbx_struct_conn_angle.ptnr3_label_comp_id HIS _pdbx_struct_conn_angle.ptnr3_label_seq_id 56 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id AAA _pdbx_struct_conn_angle.ptnr3_auth_comp_id HIS _pdbx_struct_conn_angle.ptnr3_auth_seq_id 1835 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 127.1 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD22 AAA ASN 1819 ? ? O AAA HOH 2004 ? ? 1.54 2 1 OD2 AAA ASP 1809 ? ? O AAA HOH 2001 ? ? 2.13 3 1 OE2 AAA GLU 1811 ? ? O AAA HOH 2002 ? ? 2.15 4 1 OE2 AAA GLU 1840 ? ? O AAA HOH 2003 ? ? 2.17 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id AAA _pdbx_validate_torsion.auth_seq_id 1848 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 37.70 _pdbx_validate_torsion.psi 58.56 # _pdbx_entry_details.entry_id 8ATJ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 FMT C C N N 75 FMT O1 O N N 76 FMT O2 O N N 77 FMT H H N N 78 FMT HO2 H N N 79 GLN N N N N 80 GLN CA C N S 81 GLN C C N N 82 GLN O O N N 83 GLN CB C N N 84 GLN CG C N N 85 GLN CD C N N 86 GLN OE1 O N N 87 GLN NE2 N N N 88 GLN OXT O N N 89 GLN H H N N 90 GLN H2 H N N 91 GLN HA H N N 92 GLN HB2 H N N 93 GLN HB3 H N N 94 GLN HG2 H N N 95 GLN HG3 H N N 96 GLN HE21 H N N 97 GLN HE22 H N N 98 GLN HXT H N N 99 GLU N N N N 100 GLU CA C N S 101 GLU C C N N 102 GLU O O N N 103 GLU CB C N N 104 GLU CG C N N 105 GLU CD C N N 106 GLU OE1 O N N 107 GLU OE2 O N N 108 GLU OXT O N N 109 GLU H H N N 110 GLU H2 H N N 111 GLU HA H N N 112 GLU HB2 H N N 113 GLU HB3 H N N 114 GLU HG2 H N N 115 GLU HG3 H N N 116 GLU HE2 H N N 117 GLU HXT H N N 118 GLY N N N N 119 GLY CA C N N 120 GLY C C N N 121 GLY O O N N 122 GLY OXT O N N 123 GLY H H N N 124 GLY H2 H N N 125 GLY HA2 H N N 126 GLY HA3 H N N 127 GLY HXT H N N 128 HIS N N N N 129 HIS CA C N S 130 HIS C C N N 131 HIS O O N N 132 HIS CB C N N 133 HIS CG C Y N 134 HIS ND1 N Y N 135 HIS CD2 C Y N 136 HIS CE1 C Y N 137 HIS NE2 N Y N 138 HIS OXT O N N 139 HIS H H N N 140 HIS H2 H N N 141 HIS HA H N N 142 HIS HB2 H N N 143 HIS HB3 H N N 144 HIS HD1 H N N 145 HIS HD2 H N N 146 HIS HE1 H N N 147 HIS HE2 H N N 148 HIS HXT H N N 149 HOH O O N N 150 HOH H1 H N N 151 HOH H2 H N N 152 ILE N N N N 153 ILE CA C N S 154 ILE C C N N 155 ILE O O N N 156 ILE CB C N S 157 ILE CG1 C N N 158 ILE CG2 C N N 159 ILE CD1 C N N 160 ILE OXT O N N 161 ILE H H N N 162 ILE H2 H N N 163 ILE HA H N N 164 ILE HB H N N 165 ILE HG12 H N N 166 ILE HG13 H N N 167 ILE HG21 H N N 168 ILE HG22 H N N 169 ILE HG23 H N N 170 ILE HD11 H N N 171 ILE HD12 H N N 172 ILE HD13 H N N 173 ILE HXT H N N 174 LEU N N N N 175 LEU CA C N S 176 LEU C C N N 177 LEU O O N N 178 LEU CB C N N 179 LEU CG C N N 180 LEU CD1 C N N 181 LEU CD2 C N N 182 LEU OXT O N N 183 LEU H H N N 184 LEU H2 H N N 185 LEU HA H N N 186 LEU HB2 H N N 187 LEU HB3 H N N 188 LEU HG H N N 189 LEU HD11 H N N 190 LEU HD12 H N N 191 LEU HD13 H N N 192 LEU HD21 H N N 193 LEU HD22 H N N 194 LEU HD23 H N N 195 LEU HXT H N N 196 LYS N N N N 197 LYS CA C N S 198 LYS C C N N 199 LYS O O N N 200 LYS CB C N N 201 LYS CG C N N 202 LYS CD C N N 203 LYS CE C N N 204 LYS NZ N N N 205 LYS OXT O N N 206 LYS H H N N 207 LYS H2 H N N 208 LYS HA H N N 209 LYS HB2 H N N 210 LYS HB3 H N N 211 LYS HG2 H N N 212 LYS HG3 H N N 213 LYS HD2 H N N 214 LYS HD3 H N N 215 LYS HE2 H N N 216 LYS HE3 H N N 217 LYS HZ1 H N N 218 LYS HZ2 H N N 219 LYS HZ3 H N N 220 LYS HXT H N N 221 MET N N N N 222 MET CA C N S 223 MET C C N N 224 MET O O N N 225 MET CB C N N 226 MET CG C N N 227 MET SD S N N 228 MET CE C N N 229 MET OXT O N N 230 MET H H N N 231 MET H2 H N N 232 MET HA H N N 233 MET HB2 H N N 234 MET HB3 H N N 235 MET HG2 H N N 236 MET HG3 H N N 237 MET HE1 H N N 238 MET HE2 H N N 239 MET HE3 H N N 240 MET HXT H N N 241 PHE N N N N 242 PHE CA C N S 243 PHE C C N N 244 PHE O O N N 245 PHE CB C N N 246 PHE CG C Y N 247 PHE CD1 C Y N 248 PHE CD2 C Y N 249 PHE CE1 C Y N 250 PHE CE2 C Y N 251 PHE CZ C Y N 252 PHE OXT O N N 253 PHE H H N N 254 PHE H2 H N N 255 PHE HA H N N 256 PHE HB2 H N N 257 PHE HB3 H N N 258 PHE HD1 H N N 259 PHE HD2 H N N 260 PHE HE1 H N N 261 PHE HE2 H N N 262 PHE HZ H N N 263 PHE HXT H N N 264 PRO N N N N 265 PRO CA C N S 266 PRO C C N N 267 PRO O O N N 268 PRO CB C N N 269 PRO CG C N N 270 PRO CD C N N 271 PRO OXT O N N 272 PRO H H N N 273 PRO HA H N N 274 PRO HB2 H N N 275 PRO HB3 H N N 276 PRO HG2 H N N 277 PRO HG3 H N N 278 PRO HD2 H N N 279 PRO HD3 H N N 280 PRO HXT H N N 281 SER N N N N 282 SER CA C N S 283 SER C C N N 284 SER O O N N 285 SER CB C N N 286 SER OG O N N 287 SER OXT O N N 288 SER H H N N 289 SER H2 H N N 290 SER HA H N N 291 SER HB2 H N N 292 SER HB3 H N N 293 SER HG H N N 294 SER HXT H N N 295 THR N N N N 296 THR CA C N S 297 THR C C N N 298 THR O O N N 299 THR CB C N R 300 THR OG1 O N N 301 THR CG2 C N N 302 THR OXT O N N 303 THR H H N N 304 THR H2 H N N 305 THR HA H N N 306 THR HB H N N 307 THR HG1 H N N 308 THR HG21 H N N 309 THR HG22 H N N 310 THR HG23 H N N 311 THR HXT H N N 312 TRP N N N N 313 TRP CA C N S 314 TRP C C N N 315 TRP O O N N 316 TRP CB C N N 317 TRP CG C Y N 318 TRP CD1 C Y N 319 TRP CD2 C Y N 320 TRP NE1 N Y N 321 TRP CE2 C Y N 322 TRP CE3 C Y N 323 TRP CZ2 C Y N 324 TRP CZ3 C Y N 325 TRP CH2 C Y N 326 TRP OXT O N N 327 TRP H H N N 328 TRP H2 H N N 329 TRP HA H N N 330 TRP HB2 H N N 331 TRP HB3 H N N 332 TRP HD1 H N N 333 TRP HE1 H N N 334 TRP HE3 H N N 335 TRP HZ2 H N N 336 TRP HZ3 H N N 337 TRP HH2 H N N 338 TRP HXT H N N 339 VAL N N N N 340 VAL CA C N S 341 VAL C C N N 342 VAL O O N N 343 VAL CB C N N 344 VAL CG1 C N N 345 VAL CG2 C N N 346 VAL OXT O N N 347 VAL H H N N 348 VAL H2 H N N 349 VAL HA H N N 350 VAL HB H N N 351 VAL HG11 H N N 352 VAL HG12 H N N 353 VAL HG13 H N N 354 VAL HG21 H N N 355 VAL HG22 H N N 356 VAL HG23 H N N 357 VAL HXT H N N 358 ZN ZN ZN N N 359 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 FMT C O1 doub N N 70 FMT C O2 sing N N 71 FMT C H sing N N 72 FMT O2 HO2 sing N N 73 GLN N CA sing N N 74 GLN N H sing N N 75 GLN N H2 sing N N 76 GLN CA C sing N N 77 GLN CA CB sing N N 78 GLN CA HA sing N N 79 GLN C O doub N N 80 GLN C OXT sing N N 81 GLN CB CG sing N N 82 GLN CB HB2 sing N N 83 GLN CB HB3 sing N N 84 GLN CG CD sing N N 85 GLN CG HG2 sing N N 86 GLN CG HG3 sing N N 87 GLN CD OE1 doub N N 88 GLN CD NE2 sing N N 89 GLN NE2 HE21 sing N N 90 GLN NE2 HE22 sing N N 91 GLN OXT HXT sing N N 92 GLU N CA sing N N 93 GLU N H sing N N 94 GLU N H2 sing N N 95 GLU CA C sing N N 96 GLU CA CB sing N N 97 GLU CA HA sing N N 98 GLU C O doub N N 99 GLU C OXT sing N N 100 GLU CB CG sing N N 101 GLU CB HB2 sing N N 102 GLU CB HB3 sing N N 103 GLU CG CD sing N N 104 GLU CG HG2 sing N N 105 GLU CG HG3 sing N N 106 GLU CD OE1 doub N N 107 GLU CD OE2 sing N N 108 GLU OE2 HE2 sing N N 109 GLU OXT HXT sing N N 110 GLY N CA sing N N 111 GLY N H sing N N 112 GLY N H2 sing N N 113 GLY CA C sing N N 114 GLY CA HA2 sing N N 115 GLY CA HA3 sing N N 116 GLY C O doub N N 117 GLY C OXT sing N N 118 GLY OXT HXT sing N N 119 HIS N CA sing N N 120 HIS N H sing N N 121 HIS N H2 sing N N 122 HIS CA C sing N N 123 HIS CA CB sing N N 124 HIS CA HA sing N N 125 HIS C O doub N N 126 HIS C OXT sing N N 127 HIS CB CG sing N N 128 HIS CB HB2 sing N N 129 HIS CB HB3 sing N N 130 HIS CG ND1 sing Y N 131 HIS CG CD2 doub Y N 132 HIS ND1 CE1 doub Y N 133 HIS ND1 HD1 sing N N 134 HIS CD2 NE2 sing Y N 135 HIS CD2 HD2 sing N N 136 HIS CE1 NE2 sing Y N 137 HIS CE1 HE1 sing N N 138 HIS NE2 HE2 sing N N 139 HIS OXT HXT sing N N 140 HOH O H1 sing N N 141 HOH O H2 sing N N 142 ILE N CA sing N N 143 ILE N H sing N N 144 ILE N H2 sing N N 145 ILE CA C sing N N 146 ILE CA CB sing N N 147 ILE CA HA sing N N 148 ILE C O doub N N 149 ILE C OXT sing N N 150 ILE CB CG1 sing N N 151 ILE CB CG2 sing N N 152 ILE CB HB sing N N 153 ILE CG1 CD1 sing N N 154 ILE CG1 HG12 sing N N 155 ILE CG1 HG13 sing N N 156 ILE CG2 HG21 sing N N 157 ILE CG2 HG22 sing N N 158 ILE CG2 HG23 sing N N 159 ILE CD1 HD11 sing N N 160 ILE CD1 HD12 sing N N 161 ILE CD1 HD13 sing N N 162 ILE OXT HXT sing N N 163 LEU N CA sing N N 164 LEU N H sing N N 165 LEU N H2 sing N N 166 LEU CA C sing N N 167 LEU CA CB sing N N 168 LEU CA HA sing N N 169 LEU C O doub N N 170 LEU C OXT sing N N 171 LEU CB CG sing N N 172 LEU CB HB2 sing N N 173 LEU CB HB3 sing N N 174 LEU CG CD1 sing N N 175 LEU CG CD2 sing N N 176 LEU CG HG sing N N 177 LEU CD1 HD11 sing N N 178 LEU CD1 HD12 sing N N 179 LEU CD1 HD13 sing N N 180 LEU CD2 HD21 sing N N 181 LEU CD2 HD22 sing N N 182 LEU CD2 HD23 sing N N 183 LEU OXT HXT sing N N 184 LYS N CA sing N N 185 LYS N H sing N N 186 LYS N H2 sing N N 187 LYS CA C sing N N 188 LYS CA CB sing N N 189 LYS CA HA sing N N 190 LYS C O doub N N 191 LYS C OXT sing N N 192 LYS CB CG sing N N 193 LYS CB HB2 sing N N 194 LYS CB HB3 sing N N 195 LYS CG CD sing N N 196 LYS CG HG2 sing N N 197 LYS CG HG3 sing N N 198 LYS CD CE sing N N 199 LYS CD HD2 sing N N 200 LYS CD HD3 sing N N 201 LYS CE NZ sing N N 202 LYS CE HE2 sing N N 203 LYS CE HE3 sing N N 204 LYS NZ HZ1 sing N N 205 LYS NZ HZ2 sing N N 206 LYS NZ HZ3 sing N N 207 LYS OXT HXT sing N N 208 MET N CA sing N N 209 MET N H sing N N 210 MET N H2 sing N N 211 MET CA C sing N N 212 MET CA CB sing N N 213 MET CA HA sing N N 214 MET C O doub N N 215 MET C OXT sing N N 216 MET CB CG sing N N 217 MET CB HB2 sing N N 218 MET CB HB3 sing N N 219 MET CG SD sing N N 220 MET CG HG2 sing N N 221 MET CG HG3 sing N N 222 MET SD CE sing N N 223 MET CE HE1 sing N N 224 MET CE HE2 sing N N 225 MET CE HE3 sing N N 226 MET OXT HXT sing N N 227 PHE N CA sing N N 228 PHE N H sing N N 229 PHE N H2 sing N N 230 PHE CA C sing N N 231 PHE CA CB sing N N 232 PHE CA HA sing N N 233 PHE C O doub N N 234 PHE C OXT sing N N 235 PHE CB CG sing N N 236 PHE CB HB2 sing N N 237 PHE CB HB3 sing N N 238 PHE CG CD1 doub Y N 239 PHE CG CD2 sing Y N 240 PHE CD1 CE1 sing Y N 241 PHE CD1 HD1 sing N N 242 PHE CD2 CE2 doub Y N 243 PHE CD2 HD2 sing N N 244 PHE CE1 CZ doub Y N 245 PHE CE1 HE1 sing N N 246 PHE CE2 CZ sing Y N 247 PHE CE2 HE2 sing N N 248 PHE CZ HZ sing N N 249 PHE OXT HXT sing N N 250 PRO N CA sing N N 251 PRO N CD sing N N 252 PRO N H sing N N 253 PRO CA C sing N N 254 PRO CA CB sing N N 255 PRO CA HA sing N N 256 PRO C O doub N N 257 PRO C OXT sing N N 258 PRO CB CG sing N N 259 PRO CB HB2 sing N N 260 PRO CB HB3 sing N N 261 PRO CG CD sing N N 262 PRO CG HG2 sing N N 263 PRO CG HG3 sing N N 264 PRO CD HD2 sing N N 265 PRO CD HD3 sing N N 266 PRO OXT HXT sing N N 267 SER N CA sing N N 268 SER N H sing N N 269 SER N H2 sing N N 270 SER CA C sing N N 271 SER CA CB sing N N 272 SER CA HA sing N N 273 SER C O doub N N 274 SER C OXT sing N N 275 SER CB OG sing N N 276 SER CB HB2 sing N N 277 SER CB HB3 sing N N 278 SER OG HG sing N N 279 SER OXT HXT sing N N 280 THR N CA sing N N 281 THR N H sing N N 282 THR N H2 sing N N 283 THR CA C sing N N 284 THR CA CB sing N N 285 THR CA HA sing N N 286 THR C O doub N N 287 THR C OXT sing N N 288 THR CB OG1 sing N N 289 THR CB CG2 sing N N 290 THR CB HB sing N N 291 THR OG1 HG1 sing N N 292 THR CG2 HG21 sing N N 293 THR CG2 HG22 sing N N 294 THR CG2 HG23 sing N N 295 THR OXT HXT sing N N 296 TRP N CA sing N N 297 TRP N H sing N N 298 TRP N H2 sing N N 299 TRP CA C sing N N 300 TRP CA CB sing N N 301 TRP CA HA sing N N 302 TRP C O doub N N 303 TRP C OXT sing N N 304 TRP CB CG sing N N 305 TRP CB HB2 sing N N 306 TRP CB HB3 sing N N 307 TRP CG CD1 doub Y N 308 TRP CG CD2 sing Y N 309 TRP CD1 NE1 sing Y N 310 TRP CD1 HD1 sing N N 311 TRP CD2 CE2 doub Y N 312 TRP CD2 CE3 sing Y N 313 TRP NE1 CE2 sing Y N 314 TRP NE1 HE1 sing N N 315 TRP CE2 CZ2 sing Y N 316 TRP CE3 CZ3 doub Y N 317 TRP CE3 HE3 sing N N 318 TRP CZ2 CH2 doub Y N 319 TRP CZ2 HZ2 sing N N 320 TRP CZ3 CH2 sing Y N 321 TRP CZ3 HZ3 sing N N 322 TRP CH2 HH2 sing N N 323 TRP OXT HXT sing N N 324 VAL N CA sing N N 325 VAL N H sing N N 326 VAL N H2 sing N N 327 VAL CA C sing N N 328 VAL CA CB sing N N 329 VAL CA HA sing N N 330 VAL C O doub N N 331 VAL C OXT sing N N 332 VAL CB CG1 sing N N 333 VAL CB CG2 sing N N 334 VAL CB HB sing N N 335 VAL CG1 HG11 sing N N 336 VAL CG1 HG12 sing N N 337 VAL CG1 HG13 sing N N 338 VAL CG2 HG21 sing N N 339 VAL CG2 HG22 sing N N 340 VAL CG2 HG23 sing N N 341 VAL OXT HXT sing N N 342 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number Kr1321/9-1 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2F44 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8ATJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017394 _atom_sites.fract_transf_matrix[1][2] 0.010043 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020085 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020819 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 CL 17 17 11.460 0.010 7.196 1.166 6.255 18.519 1.645 47.778 -9.345 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.049 ZN 30 30 14.081 3.266 7.035 0.233 5.168 10.316 2.411 58.710 1.004 # loop_