data_8AWY # _entry.id 8AWY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.385 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8AWY pdb_00008awy 10.2210/pdb8awy/pdb WWPDB D_1292125265 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-05-24 2 'Structure model' 1 1 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8AWY _pdbx_database_status.recvd_initial_deposition_date 2022-08-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 4 pedram.mehrabi@uni-hamburg.de Pedram Mehrabi ? 'principal investigator/group leader' 0000-0003-3211-6959 5 ei.schulz@uke.de Eike Schulz C 'principal investigator/group leader' 0000-0002-1685-8605 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mehrabi, P.' 1 ? 'Sung, S.' 2 ? 'von Stetten, D.' 3 ? 'Prester, A.' 4 ? 'Hatton, C.E.' 5 ? 'Kleine-Doepke, S.' 6 ? 'Berkes, A.' 7 ? 'Gore, G.' 8 ? 'Leimkohl, J.P.' 9 ? 'Schikora, H.' 10 ? 'Kollewe, M.' 11 ? 'Rohde, H.' 12 ? 'Wilmanns, M.' 13 ? 'Tellkamp, F.' 14 ? 'Schulz, E.C.' 15 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 2365 _citation.page_last 2365 _citation.title 'Millisecond cryo-trapping by the spitrobot crystal plunger simplifies time-resolved crystallography.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-023-37834-w _citation.pdbx_database_id_PubMed 37185266 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mehrabi, P.' 1 0000-0003-3211-6959 primary 'Sung, S.' 2 0000-0001-5820-4696 primary 'von Stetten, D.' 3 0000-0001-7906-9788 primary 'Prester, A.' 4 0000-0003-2738-7682 primary 'Hatton, C.E.' 5 0000-0002-8446-0711 primary 'Kleine-Dopke, S.' 6 0009-0001-5513-9873 primary 'Berkes, A.' 7 0009-0000-9579-2255 primary 'Gore, G.' 8 0009-0003-0585-7038 primary 'Leimkohl, J.P.' 9 0009-0008-8944-4244 primary 'Schikora, H.' 10 ? primary 'Kollewe, M.' 11 ? primary 'Rohde, H.' 12 0000-0001-8587-4433 primary 'Wilmanns, M.' 13 0000-0002-4643-5435 primary 'Tellkamp, F.' 14 0000-0002-5670-3544 primary 'Schulz, E.C.' 15 0000-0002-1685-8605 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Xylose isomerase' 43283.297 1 5.3.1.5 ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 3 ? ? ? ? 3 non-polymer syn Meso-2,3-Butanediol 90.121 1 ? ? ? ? 4 water nat water 18.015 486 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVESVRRLAELGAHGVTFHDDDLIPFGSSDSEREEHVKRFRQALD DTGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKE AFDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK LFHIDLNGQNGIKYDQDLRFGAGDLRAAFWLVDLLESAGYSGPRHFDFKPPRTEDFDGVWASAAGCMRNYLILKERAAAF RADPEVQEALRASRLDELARPTAADGLQALLDDRSAFEEFDVDAAAARGMAFERLDQLAMDHLLGARG ; _entity_poly.pdbx_seq_one_letter_code_can ;MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVESVRRLAELGAHGVTFHDDDLIPFGSSDSEREEHVKRFRQALD DTGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKE AFDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK LFHIDLNGQNGIKYDQDLRFGAGDLRAAFWLVDLLESAGYSGPRHFDFKPPRTEDFDGVWASAAGCMRNYLILKERAAAF RADPEVQEALRASRLDELARPTAADGLQALLDDRSAFEEFDVDAAAARGMAFERLDQLAMDHLLGARG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 Meso-2,3-Butanediol BU9 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 TYR n 1 4 GLN n 1 5 PRO n 1 6 THR n 1 7 PRO n 1 8 GLU n 1 9 ASP n 1 10 ARG n 1 11 PHE n 1 12 THR n 1 13 PHE n 1 14 GLY n 1 15 LEU n 1 16 TRP n 1 17 THR n 1 18 VAL n 1 19 GLY n 1 20 TRP n 1 21 GLN n 1 22 GLY n 1 23 ARG n 1 24 ASP n 1 25 PRO n 1 26 PHE n 1 27 GLY n 1 28 ASP n 1 29 ALA n 1 30 THR n 1 31 ARG n 1 32 ARG n 1 33 ALA n 1 34 LEU n 1 35 ASP n 1 36 PRO n 1 37 VAL n 1 38 GLU n 1 39 SER n 1 40 VAL n 1 41 ARG n 1 42 ARG n 1 43 LEU n 1 44 ALA n 1 45 GLU n 1 46 LEU n 1 47 GLY n 1 48 ALA n 1 49 HIS n 1 50 GLY n 1 51 VAL n 1 52 THR n 1 53 PHE n 1 54 HIS n 1 55 ASP n 1 56 ASP n 1 57 ASP n 1 58 LEU n 1 59 ILE n 1 60 PRO n 1 61 PHE n 1 62 GLY n 1 63 SER n 1 64 SER n 1 65 ASP n 1 66 SER n 1 67 GLU n 1 68 ARG n 1 69 GLU n 1 70 GLU n 1 71 HIS n 1 72 VAL n 1 73 LYS n 1 74 ARG n 1 75 PHE n 1 76 ARG n 1 77 GLN n 1 78 ALA n 1 79 LEU n 1 80 ASP n 1 81 ASP n 1 82 THR n 1 83 GLY n 1 84 MET n 1 85 LYS n 1 86 VAL n 1 87 PRO n 1 88 MET n 1 89 ALA n 1 90 THR n 1 91 THR n 1 92 ASN n 1 93 LEU n 1 94 PHE n 1 95 THR n 1 96 HIS n 1 97 PRO n 1 98 VAL n 1 99 PHE n 1 100 LYS n 1 101 ASP n 1 102 GLY n 1 103 GLY n 1 104 PHE n 1 105 THR n 1 106 ALA n 1 107 ASN n 1 108 ASP n 1 109 ARG n 1 110 ASP n 1 111 VAL n 1 112 ARG n 1 113 ARG n 1 114 TYR n 1 115 ALA n 1 116 LEU n 1 117 ARG n 1 118 LYS n 1 119 THR n 1 120 ILE n 1 121 ARG n 1 122 ASN n 1 123 ILE n 1 124 ASP n 1 125 LEU n 1 126 ALA n 1 127 VAL n 1 128 GLU n 1 129 LEU n 1 130 GLY n 1 131 ALA n 1 132 GLU n 1 133 THR n 1 134 TYR n 1 135 VAL n 1 136 ALA n 1 137 TRP n 1 138 GLY n 1 139 GLY n 1 140 ARG n 1 141 GLU n 1 142 GLY n 1 143 ALA n 1 144 GLU n 1 145 SER n 1 146 GLY n 1 147 GLY n 1 148 ALA n 1 149 LYS n 1 150 ASP n 1 151 VAL n 1 152 ARG n 1 153 ASP n 1 154 ALA n 1 155 LEU n 1 156 ASP n 1 157 ARG n 1 158 MET n 1 159 LYS n 1 160 GLU n 1 161 ALA n 1 162 PHE n 1 163 ASP n 1 164 LEU n 1 165 LEU n 1 166 GLY n 1 167 GLU n 1 168 TYR n 1 169 VAL n 1 170 THR n 1 171 SER n 1 172 GLN n 1 173 GLY n 1 174 TYR n 1 175 ASP n 1 176 ILE n 1 177 ARG n 1 178 PHE n 1 179 ALA n 1 180 ILE n 1 181 GLU n 1 182 PRO n 1 183 LYS n 1 184 PRO n 1 185 ASN n 1 186 GLU n 1 187 PRO n 1 188 ARG n 1 189 GLY n 1 190 ASP n 1 191 ILE n 1 192 LEU n 1 193 LEU n 1 194 PRO n 1 195 THR n 1 196 VAL n 1 197 GLY n 1 198 HIS n 1 199 ALA n 1 200 LEU n 1 201 ALA n 1 202 PHE n 1 203 ILE n 1 204 GLU n 1 205 ARG n 1 206 LEU n 1 207 GLU n 1 208 ARG n 1 209 PRO n 1 210 GLU n 1 211 LEU n 1 212 TYR n 1 213 GLY n 1 214 VAL n 1 215 ASN n 1 216 PRO n 1 217 GLU n 1 218 VAL n 1 219 GLY n 1 220 HIS n 1 221 GLU n 1 222 GLN n 1 223 MET n 1 224 ALA n 1 225 GLY n 1 226 LEU n 1 227 ASN n 1 228 PHE n 1 229 PRO n 1 230 HIS n 1 231 GLY n 1 232 ILE n 1 233 ALA n 1 234 GLN n 1 235 ALA n 1 236 LEU n 1 237 TRP n 1 238 ALA n 1 239 GLY n 1 240 LYS n 1 241 LEU n 1 242 PHE n 1 243 HIS n 1 244 ILE n 1 245 ASP n 1 246 LEU n 1 247 ASN n 1 248 GLY n 1 249 GLN n 1 250 ASN n 1 251 GLY n 1 252 ILE n 1 253 LYS n 1 254 TYR n 1 255 ASP n 1 256 GLN n 1 257 ASP n 1 258 LEU n 1 259 ARG n 1 260 PHE n 1 261 GLY n 1 262 ALA n 1 263 GLY n 1 264 ASP n 1 265 LEU n 1 266 ARG n 1 267 ALA n 1 268 ALA n 1 269 PHE n 1 270 TRP n 1 271 LEU n 1 272 VAL n 1 273 ASP n 1 274 LEU n 1 275 LEU n 1 276 GLU n 1 277 SER n 1 278 ALA n 1 279 GLY n 1 280 TYR n 1 281 SER n 1 282 GLY n 1 283 PRO n 1 284 ARG n 1 285 HIS n 1 286 PHE n 1 287 ASP n 1 288 PHE n 1 289 LYS n 1 290 PRO n 1 291 PRO n 1 292 ARG n 1 293 THR n 1 294 GLU n 1 295 ASP n 1 296 PHE n 1 297 ASP n 1 298 GLY n 1 299 VAL n 1 300 TRP n 1 301 ALA n 1 302 SER n 1 303 ALA n 1 304 ALA n 1 305 GLY n 1 306 CYS n 1 307 MET n 1 308 ARG n 1 309 ASN n 1 310 TYR n 1 311 LEU n 1 312 ILE n 1 313 LEU n 1 314 LYS n 1 315 GLU n 1 316 ARG n 1 317 ALA n 1 318 ALA n 1 319 ALA n 1 320 PHE n 1 321 ARG n 1 322 ALA n 1 323 ASP n 1 324 PRO n 1 325 GLU n 1 326 VAL n 1 327 GLN n 1 328 GLU n 1 329 ALA n 1 330 LEU n 1 331 ARG n 1 332 ALA n 1 333 SER n 1 334 ARG n 1 335 LEU n 1 336 ASP n 1 337 GLU n 1 338 LEU n 1 339 ALA n 1 340 ARG n 1 341 PRO n 1 342 THR n 1 343 ALA n 1 344 ALA n 1 345 ASP n 1 346 GLY n 1 347 LEU n 1 348 GLN n 1 349 ALA n 1 350 LEU n 1 351 LEU n 1 352 ASP n 1 353 ASP n 1 354 ARG n 1 355 SER n 1 356 ALA n 1 357 PHE n 1 358 GLU n 1 359 GLU n 1 360 PHE n 1 361 ASP n 1 362 VAL n 1 363 ASP n 1 364 ALA n 1 365 ALA n 1 366 ALA n 1 367 ALA n 1 368 ARG n 1 369 GLY n 1 370 MET n 1 371 ALA n 1 372 PHE n 1 373 GLU n 1 374 ARG n 1 375 LEU n 1 376 ASP n 1 377 GLN n 1 378 LEU n 1 379 ALA n 1 380 MET n 1 381 ASP n 1 382 HIS n 1 383 LEU n 1 384 LEU n 1 385 GLY n 1 386 ALA n 1 387 ARG n 1 388 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 388 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene xylA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces rubiginosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1929 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Streptomyces rubiginosus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 1929 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BU9 non-polymer . Meso-2,3-Butanediol ? 'C4 H10 O2' 90.121 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 TRP 137 137 137 TRP TRP A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 MET 158 158 158 MET MET A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 TYR 174 174 174 TYR TYR A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 PHE 178 178 178 PHE PHE A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 PRO 184 184 184 PRO PRO A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 HIS 198 198 198 HIS HIS A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 ALA 201 201 201 ALA ALA A . n A 1 202 PHE 202 202 202 PHE PHE A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 ARG 205 205 205 ARG ARG A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 ARG 208 208 208 ARG ARG A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 GLU 210 210 210 GLU GLU A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 TYR 212 212 212 TYR TYR A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 ASN 215 215 215 ASN ASN A . n A 1 216 PRO 216 216 216 PRO PRO A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 GLY 219 219 219 GLY GLY A . n A 1 220 HIS 220 220 220 HIS HIS A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 GLN 222 222 222 GLN GLN A . n A 1 223 MET 223 223 223 MET MET A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 ASN 227 227 227 ASN ASN A . n A 1 228 PHE 228 228 228 PHE PHE A . n A 1 229 PRO 229 229 229 PRO PRO A . n A 1 230 HIS 230 230 230 HIS HIS A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 GLN 234 234 234 GLN GLN A . n A 1 235 ALA 235 235 235 ALA ALA A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 TRP 237 237 237 TRP TRP A . n A 1 238 ALA 238 238 238 ALA ALA A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 LYS 240 240 240 LYS LYS A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 PHE 242 242 242 PHE PHE A . n A 1 243 HIS 243 243 243 HIS HIS A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 ASN 247 247 247 ASN ASN A . n A 1 248 GLY 248 248 248 GLY GLY A . n A 1 249 GLN 249 249 249 GLN GLN A . n A 1 250 ASN 250 250 250 ASN ASN A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 ILE 252 252 252 ILE ILE A . n A 1 253 LYS 253 253 253 LYS LYS A . n A 1 254 TYR 254 254 254 TYR TYR A . n A 1 255 ASP 255 255 255 ASP ASP A . n A 1 256 GLN 256 256 256 GLN GLN A . n A 1 257 ASP 257 257 257 ASP ASP A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 PHE 260 260 260 PHE PHE A . n A 1 261 GLY 261 261 261 GLY GLY A . n A 1 262 ALA 262 262 262 ALA ALA A . n A 1 263 GLY 263 263 263 GLY GLY A . n A 1 264 ASP 264 264 264 ASP ASP A . n A 1 265 LEU 265 265 265 LEU LEU A . n A 1 266 ARG 266 266 266 ARG ARG A . n A 1 267 ALA 267 267 267 ALA ALA A . n A 1 268 ALA 268 268 268 ALA ALA A . n A 1 269 PHE 269 269 269 PHE PHE A . n A 1 270 TRP 270 270 270 TRP TRP A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 VAL 272 272 272 VAL VAL A . n A 1 273 ASP 273 273 273 ASP ASP A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 LEU 275 275 275 LEU LEU A . n A 1 276 GLU 276 276 276 GLU GLU A . n A 1 277 SER 277 277 277 SER SER A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 GLY 279 279 279 GLY GLY A . n A 1 280 TYR 280 280 280 TYR TYR A . n A 1 281 SER 281 281 281 SER SER A . n A 1 282 GLY 282 282 282 GLY GLY A . n A 1 283 PRO 283 283 283 PRO PRO A . n A 1 284 ARG 284 284 284 ARG ARG A . n A 1 285 HIS 285 285 285 HIS HIS A . n A 1 286 PHE 286 286 286 PHE PHE A . n A 1 287 ASP 287 287 287 ASP ASP A . n A 1 288 PHE 288 288 288 PHE PHE A . n A 1 289 LYS 289 289 289 LYS LYS A . n A 1 290 PRO 290 290 290 PRO PRO A . n A 1 291 PRO 291 291 291 PRO PRO A . n A 1 292 ARG 292 292 292 ARG ARG A . n A 1 293 THR 293 293 293 THR THR A . n A 1 294 GLU 294 294 294 GLU GLU A . n A 1 295 ASP 295 295 295 ASP ASP A . n A 1 296 PHE 296 296 296 PHE PHE A . n A 1 297 ASP 297 297 297 ASP ASP A . n A 1 298 GLY 298 298 298 GLY GLY A . n A 1 299 VAL 299 299 299 VAL VAL A . n A 1 300 TRP 300 300 300 TRP TRP A . n A 1 301 ALA 301 301 301 ALA ALA A . n A 1 302 SER 302 302 302 SER SER A . n A 1 303 ALA 303 303 303 ALA ALA A . n A 1 304 ALA 304 304 304 ALA ALA A . n A 1 305 GLY 305 305 305 GLY GLY A . n A 1 306 CYS 306 306 306 CYS CYS A . n A 1 307 MET 307 307 307 MET MET A . n A 1 308 ARG 308 308 308 ARG ARG A . n A 1 309 ASN 309 309 309 ASN ASN A . n A 1 310 TYR 310 310 310 TYR TYR A . n A 1 311 LEU 311 311 311 LEU LEU A . n A 1 312 ILE 312 312 312 ILE ILE A . n A 1 313 LEU 313 313 313 LEU LEU A . n A 1 314 LYS 314 314 314 LYS LYS A . n A 1 315 GLU 315 315 315 GLU GLU A . n A 1 316 ARG 316 316 316 ARG ARG A . n A 1 317 ALA 317 317 317 ALA ALA A . n A 1 318 ALA 318 318 318 ALA ALA A . n A 1 319 ALA 319 319 319 ALA ALA A . n A 1 320 PHE 320 320 320 PHE PHE A . n A 1 321 ARG 321 321 321 ARG ARG A . n A 1 322 ALA 322 322 322 ALA ALA A . n A 1 323 ASP 323 323 323 ASP ASP A . n A 1 324 PRO 324 324 324 PRO PRO A . n A 1 325 GLU 325 325 325 GLU GLU A . n A 1 326 VAL 326 326 326 VAL VAL A . n A 1 327 GLN 327 327 327 GLN GLN A . n A 1 328 GLU 328 328 328 GLU GLU A . n A 1 329 ALA 329 329 329 ALA ALA A . n A 1 330 LEU 330 330 330 LEU LEU A . n A 1 331 ARG 331 331 331 ARG ARG A . n A 1 332 ALA 332 332 332 ALA ALA A . n A 1 333 SER 333 333 333 SER SER A . n A 1 334 ARG 334 334 334 ARG ARG A . n A 1 335 LEU 335 335 335 LEU LEU A . n A 1 336 ASP 336 336 336 ASP ASP A . n A 1 337 GLU 337 337 337 GLU GLU A . n A 1 338 LEU 338 338 338 LEU LEU A . n A 1 339 ALA 339 339 339 ALA ALA A . n A 1 340 ARG 340 340 340 ARG ARG A . n A 1 341 PRO 341 341 341 PRO PRO A . n A 1 342 THR 342 342 342 THR THR A . n A 1 343 ALA 343 343 343 ALA ALA A . n A 1 344 ALA 344 344 344 ALA ALA A . n A 1 345 ASP 345 345 345 ASP ASP A . n A 1 346 GLY 346 346 346 GLY GLY A . n A 1 347 LEU 347 347 347 LEU LEU A . n A 1 348 GLN 348 348 348 GLN GLN A . n A 1 349 ALA 349 349 349 ALA ALA A . n A 1 350 LEU 350 350 350 LEU LEU A . n A 1 351 LEU 351 351 351 LEU LEU A . n A 1 352 ASP 352 352 352 ASP ASP A . n A 1 353 ASP 353 353 353 ASP ASP A . n A 1 354 ARG 354 354 354 ARG ARG A . n A 1 355 SER 355 355 355 SER SER A . n A 1 356 ALA 356 356 356 ALA ALA A . n A 1 357 PHE 357 357 357 PHE PHE A . n A 1 358 GLU 358 358 358 GLU GLU A . n A 1 359 GLU 359 359 359 GLU GLU A . n A 1 360 PHE 360 360 360 PHE PHE A . n A 1 361 ASP 361 361 361 ASP ASP A . n A 1 362 VAL 362 362 362 VAL VAL A . n A 1 363 ASP 363 363 363 ASP ASP A . n A 1 364 ALA 364 364 364 ALA ALA A . n A 1 365 ALA 365 365 365 ALA ALA A . n A 1 366 ALA 366 366 366 ALA ALA A . n A 1 367 ALA 367 367 367 ALA ALA A . n A 1 368 ARG 368 368 368 ARG ARG A . n A 1 369 GLY 369 369 369 GLY GLY A . n A 1 370 MET 370 370 370 MET MET A . n A 1 371 ALA 371 371 371 ALA ALA A . n A 1 372 PHE 372 372 372 PHE PHE A . n A 1 373 GLU 373 373 373 GLU GLU A . n A 1 374 ARG 374 374 374 ARG ARG A . n A 1 375 LEU 375 375 375 LEU LEU A . n A 1 376 ASP 376 376 376 ASP ASP A . n A 1 377 GLN 377 377 377 GLN GLN A . n A 1 378 LEU 378 378 378 LEU LEU A . n A 1 379 ALA 379 379 379 ALA ALA A . n A 1 380 MET 380 380 380 MET MET A . n A 1 381 ASP 381 381 381 ASP ASP A . n A 1 382 HIS 382 382 382 HIS HIS A . n A 1 383 LEU 383 383 383 LEU LEU A . n A 1 384 LEU 384 384 384 LEU LEU A . n A 1 385 GLY 385 385 385 GLY GLY A . n A 1 386 ALA 386 386 386 ALA ALA A . n A 1 387 ARG 387 387 387 ARG ARG A . n A 1 388 GLY 388 388 388 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 401 401 MG MG A . C 2 MG 1 402 402 MG MG A . D 3 BU9 1 403 403 BU9 BU9 A . E 2 MG 1 404 1 MG MG A . F 4 HOH 1 501 357 HOH HOH A . F 4 HOH 2 502 455 HOH HOH A . F 4 HOH 3 503 352 HOH HOH A . F 4 HOH 4 504 375 HOH HOH A . F 4 HOH 5 505 390 HOH HOH A . F 4 HOH 6 506 376 HOH HOH A . F 4 HOH 7 507 270 HOH HOH A . F 4 HOH 8 508 421 HOH HOH A . F 4 HOH 9 509 288 HOH HOH A . F 4 HOH 10 510 277 HOH HOH A . F 4 HOH 11 511 380 HOH HOH A . F 4 HOH 12 512 196 HOH HOH A . F 4 HOH 13 513 296 HOH HOH A . F 4 HOH 14 514 442 HOH HOH A . F 4 HOH 15 515 309 HOH HOH A . F 4 HOH 16 516 403 HOH HOH A . F 4 HOH 17 517 386 HOH HOH A . F 4 HOH 18 518 267 HOH HOH A . F 4 HOH 19 519 342 HOH HOH A . F 4 HOH 20 520 205 HOH HOH A . F 4 HOH 21 521 240 HOH HOH A . F 4 HOH 22 522 385 HOH HOH A . F 4 HOH 23 523 454 HOH HOH A . F 4 HOH 24 524 306 HOH HOH A . F 4 HOH 25 525 203 HOH HOH A . F 4 HOH 26 526 129 HOH HOH A . F 4 HOH 27 527 132 HOH HOH A . F 4 HOH 28 528 369 HOH HOH A . F 4 HOH 29 529 41 HOH HOH A . F 4 HOH 30 530 219 HOH HOH A . F 4 HOH 31 531 398 HOH HOH A . F 4 HOH 32 532 79 HOH HOH A . F 4 HOH 33 533 148 HOH HOH A . F 4 HOH 34 534 381 HOH HOH A . F 4 HOH 35 535 145 HOH HOH A . F 4 HOH 36 536 93 HOH HOH A . F 4 HOH 37 537 226 HOH HOH A . F 4 HOH 38 538 474 HOH HOH A . F 4 HOH 39 539 222 HOH HOH A . F 4 HOH 40 540 318 HOH HOH A . F 4 HOH 41 541 225 HOH HOH A . F 4 HOH 42 542 335 HOH HOH A . F 4 HOH 43 543 52 HOH HOH A . F 4 HOH 44 544 208 HOH HOH A . F 4 HOH 45 545 157 HOH HOH A . F 4 HOH 46 546 297 HOH HOH A . F 4 HOH 47 547 162 HOH HOH A . F 4 HOH 48 548 127 HOH HOH A . F 4 HOH 49 549 218 HOH HOH A . F 4 HOH 50 550 410 HOH HOH A . F 4 HOH 51 551 36 HOH HOH A . F 4 HOH 52 552 84 HOH HOH A . F 4 HOH 53 553 24 HOH HOH A . F 4 HOH 54 554 341 HOH HOH A . F 4 HOH 55 555 144 HOH HOH A . F 4 HOH 56 556 244 HOH HOH A . F 4 HOH 57 557 92 HOH HOH A . F 4 HOH 58 558 60 HOH HOH A . F 4 HOH 59 559 72 HOH HOH A . F 4 HOH 60 560 161 HOH HOH A . F 4 HOH 61 561 103 HOH HOH A . F 4 HOH 62 562 447 HOH HOH A . F 4 HOH 63 563 191 HOH HOH A . F 4 HOH 64 564 370 HOH HOH A . F 4 HOH 65 565 301 HOH HOH A . F 4 HOH 66 566 18 HOH HOH A . F 4 HOH 67 567 44 HOH HOH A . F 4 HOH 68 568 180 HOH HOH A . F 4 HOH 69 569 23 HOH HOH A . F 4 HOH 70 570 233 HOH HOH A . F 4 HOH 71 571 73 HOH HOH A . F 4 HOH 72 572 182 HOH HOH A . F 4 HOH 73 573 428 HOH HOH A . F 4 HOH 74 574 459 HOH HOH A . F 4 HOH 75 575 479 HOH HOH A . F 4 HOH 76 576 20 HOH HOH A . F 4 HOH 77 577 260 HOH HOH A . F 4 HOH 78 578 74 HOH HOH A . F 4 HOH 79 579 322 HOH HOH A . F 4 HOH 80 580 257 HOH HOH A . F 4 HOH 81 581 278 HOH HOH A . F 4 HOH 82 582 338 HOH HOH A . F 4 HOH 83 583 88 HOH HOH A . F 4 HOH 84 584 275 HOH HOH A . F 4 HOH 85 585 54 HOH HOH A . F 4 HOH 86 586 45 HOH HOH A . F 4 HOH 87 587 115 HOH HOH A . F 4 HOH 88 588 46 HOH HOH A . F 4 HOH 89 589 137 HOH HOH A . F 4 HOH 90 590 135 HOH HOH A . F 4 HOH 91 591 238 HOH HOH A . F 4 HOH 92 592 417 HOH HOH A . F 4 HOH 93 593 81 HOH HOH A . F 4 HOH 94 594 89 HOH HOH A . F 4 HOH 95 595 246 HOH HOH A . F 4 HOH 96 596 80 HOH HOH A . F 4 HOH 97 597 105 HOH HOH A . F 4 HOH 98 598 102 HOH HOH A . F 4 HOH 99 599 58 HOH HOH A . F 4 HOH 100 600 326 HOH HOH A . F 4 HOH 101 601 408 HOH HOH A . F 4 HOH 102 602 6 HOH HOH A . F 4 HOH 103 603 378 HOH HOH A . F 4 HOH 104 604 230 HOH HOH A . F 4 HOH 105 605 339 HOH HOH A . F 4 HOH 106 606 64 HOH HOH A . F 4 HOH 107 607 85 HOH HOH A . F 4 HOH 108 608 201 HOH HOH A . F 4 HOH 109 609 108 HOH HOH A . F 4 HOH 110 610 126 HOH HOH A . F 4 HOH 111 611 312 HOH HOH A . F 4 HOH 112 612 98 HOH HOH A . F 4 HOH 113 613 75 HOH HOH A . F 4 HOH 114 614 101 HOH HOH A . F 4 HOH 115 615 175 HOH HOH A . F 4 HOH 116 616 106 HOH HOH A . F 4 HOH 117 617 242 HOH HOH A . F 4 HOH 118 618 40 HOH HOH A . F 4 HOH 119 619 291 HOH HOH A . F 4 HOH 120 620 139 HOH HOH A . F 4 HOH 121 621 158 HOH HOH A . F 4 HOH 122 622 90 HOH HOH A . F 4 HOH 123 623 272 HOH HOH A . F 4 HOH 124 624 11 HOH HOH A . F 4 HOH 125 625 198 HOH HOH A . F 4 HOH 126 626 53 HOH HOH A . F 4 HOH 127 627 143 HOH HOH A . F 4 HOH 128 628 109 HOH HOH A . F 4 HOH 129 629 431 HOH HOH A . F 4 HOH 130 630 287 HOH HOH A . F 4 HOH 131 631 331 HOH HOH A . F 4 HOH 132 632 107 HOH HOH A . F 4 HOH 133 633 1 HOH HOH A . F 4 HOH 134 634 259 HOH HOH A . F 4 HOH 135 635 293 HOH HOH A . F 4 HOH 136 636 183 HOH HOH A . F 4 HOH 137 637 123 HOH HOH A . F 4 HOH 138 638 405 HOH HOH A . F 4 HOH 139 639 165 HOH HOH A . F 4 HOH 140 640 99 HOH HOH A . F 4 HOH 141 641 273 HOH HOH A . F 4 HOH 142 642 292 HOH HOH A . F 4 HOH 143 643 313 HOH HOH A . F 4 HOH 144 644 197 HOH HOH A . F 4 HOH 145 645 206 HOH HOH A . F 4 HOH 146 646 2 HOH HOH A . F 4 HOH 147 647 243 HOH HOH A . F 4 HOH 148 648 329 HOH HOH A . F 4 HOH 149 649 176 HOH HOH A . F 4 HOH 150 650 26 HOH HOH A . F 4 HOH 151 651 83 HOH HOH A . F 4 HOH 152 652 7 HOH HOH A . F 4 HOH 153 653 200 HOH HOH A . F 4 HOH 154 654 100 HOH HOH A . F 4 HOH 155 655 25 HOH HOH A . F 4 HOH 156 656 282 HOH HOH A . F 4 HOH 157 657 164 HOH HOH A . F 4 HOH 158 658 22 HOH HOH A . F 4 HOH 159 659 21 HOH HOH A . F 4 HOH 160 660 14 HOH HOH A . F 4 HOH 161 661 62 HOH HOH A . F 4 HOH 162 662 453 HOH HOH A . F 4 HOH 163 663 8 HOH HOH A . F 4 HOH 164 664 153 HOH HOH A . F 4 HOH 165 665 188 HOH HOH A . F 4 HOH 166 666 10 HOH HOH A . F 4 HOH 167 667 439 HOH HOH A . F 4 HOH 168 668 66 HOH HOH A . F 4 HOH 169 669 57 HOH HOH A . F 4 HOH 170 670 12 HOH HOH A . F 4 HOH 171 671 43 HOH HOH A . F 4 HOH 172 672 199 HOH HOH A . F 4 HOH 173 673 86 HOH HOH A . F 4 HOH 174 674 359 HOH HOH A . F 4 HOH 175 675 4 HOH HOH A . F 4 HOH 176 676 299 HOH HOH A . F 4 HOH 177 677 304 HOH HOH A . F 4 HOH 178 678 28 HOH HOH A . F 4 HOH 179 679 77 HOH HOH A . F 4 HOH 180 680 330 HOH HOH A . F 4 HOH 181 681 211 HOH HOH A . F 4 HOH 182 682 42 HOH HOH A . F 4 HOH 183 683 13 HOH HOH A . F 4 HOH 184 684 255 HOH HOH A . F 4 HOH 185 685 117 HOH HOH A . F 4 HOH 186 686 5 HOH HOH A . F 4 HOH 187 687 321 HOH HOH A . F 4 HOH 188 688 131 HOH HOH A . F 4 HOH 189 689 110 HOH HOH A . F 4 HOH 190 690 55 HOH HOH A . F 4 HOH 191 691 9 HOH HOH A . F 4 HOH 192 692 467 HOH HOH A . F 4 HOH 193 693 351 HOH HOH A . F 4 HOH 194 694 435 HOH HOH A . F 4 HOH 195 695 234 HOH HOH A . F 4 HOH 196 696 425 HOH HOH A . F 4 HOH 197 697 35 HOH HOH A . F 4 HOH 198 698 114 HOH HOH A . F 4 HOH 199 699 16 HOH HOH A . F 4 HOH 200 700 214 HOH HOH A . F 4 HOH 201 701 160 HOH HOH A . F 4 HOH 202 702 104 HOH HOH A . F 4 HOH 203 703 391 HOH HOH A . F 4 HOH 204 704 71 HOH HOH A . F 4 HOH 205 705 337 HOH HOH A . F 4 HOH 206 706 70 HOH HOH A . F 4 HOH 207 707 47 HOH HOH A . F 4 HOH 208 708 38 HOH HOH A . F 4 HOH 209 709 27 HOH HOH A . F 4 HOH 210 710 258 HOH HOH A . F 4 HOH 211 711 163 HOH HOH A . F 4 HOH 212 712 119 HOH HOH A . F 4 HOH 213 713 189 HOH HOH A . F 4 HOH 214 714 344 HOH HOH A . F 4 HOH 215 715 396 HOH HOH A . F 4 HOH 216 716 166 HOH HOH A . F 4 HOH 217 717 87 HOH HOH A . F 4 HOH 218 718 194 HOH HOH A . F 4 HOH 219 719 3 HOH HOH A . F 4 HOH 220 720 37 HOH HOH A . F 4 HOH 221 721 213 HOH HOH A . F 4 HOH 222 722 33 HOH HOH A . F 4 HOH 223 723 195 HOH HOH A . F 4 HOH 224 724 31 HOH HOH A . F 4 HOH 225 725 256 HOH HOH A . F 4 HOH 226 726 266 HOH HOH A . F 4 HOH 227 727 215 HOH HOH A . F 4 HOH 228 728 185 HOH HOH A . F 4 HOH 229 729 154 HOH HOH A . F 4 HOH 230 730 433 HOH HOH A . F 4 HOH 231 731 221 HOH HOH A . F 4 HOH 232 732 76 HOH HOH A . F 4 HOH 233 733 300 HOH HOH A . F 4 HOH 234 734 324 HOH HOH A . F 4 HOH 235 735 136 HOH HOH A . F 4 HOH 236 736 368 HOH HOH A . F 4 HOH 237 737 61 HOH HOH A . F 4 HOH 238 738 224 HOH HOH A . F 4 HOH 239 739 122 HOH HOH A . F 4 HOH 240 740 124 HOH HOH A . F 4 HOH 241 741 34 HOH HOH A . F 4 HOH 242 742 172 HOH HOH A . F 4 HOH 243 743 146 HOH HOH A . F 4 HOH 244 744 317 HOH HOH A . F 4 HOH 245 745 177 HOH HOH A . F 4 HOH 246 746 91 HOH HOH A . F 4 HOH 247 747 231 HOH HOH A . F 4 HOH 248 748 171 HOH HOH A . F 4 HOH 249 749 94 HOH HOH A . F 4 HOH 250 750 32 HOH HOH A . F 4 HOH 251 751 147 HOH HOH A . F 4 HOH 252 752 209 HOH HOH A . F 4 HOH 253 753 307 HOH HOH A . F 4 HOH 254 754 477 HOH HOH A . F 4 HOH 255 755 19 HOH HOH A . F 4 HOH 256 756 65 HOH HOH A . F 4 HOH 257 757 193 HOH HOH A . F 4 HOH 258 758 239 HOH HOH A . F 4 HOH 259 759 446 HOH HOH A . F 4 HOH 260 760 465 HOH HOH A . F 4 HOH 261 761 152 HOH HOH A . F 4 HOH 262 762 68 HOH HOH A . F 4 HOH 263 763 116 HOH HOH A . F 4 HOH 264 764 457 HOH HOH A . F 4 HOH 265 765 253 HOH HOH A . F 4 HOH 266 766 140 HOH HOH A . F 4 HOH 267 767 95 HOH HOH A . F 4 HOH 268 768 280 HOH HOH A . F 4 HOH 269 769 121 HOH HOH A . F 4 HOH 270 770 15 HOH HOH A . F 4 HOH 271 771 401 HOH HOH A . F 4 HOH 272 772 440 HOH HOH A . F 4 HOH 273 773 134 HOH HOH A . F 4 HOH 274 774 478 HOH HOH A . F 4 HOH 275 775 372 HOH HOH A . F 4 HOH 276 776 223 HOH HOH A . F 4 HOH 277 777 285 HOH HOH A . F 4 HOH 278 778 17 HOH HOH A . F 4 HOH 279 779 63 HOH HOH A . F 4 HOH 280 780 59 HOH HOH A . F 4 HOH 281 781 202 HOH HOH A . F 4 HOH 282 782 151 HOH HOH A . F 4 HOH 283 783 39 HOH HOH A . F 4 HOH 284 784 67 HOH HOH A . F 4 HOH 285 785 429 HOH HOH A . F 4 HOH 286 786 236 HOH HOH A . F 4 HOH 287 787 232 HOH HOH A . F 4 HOH 288 788 237 HOH HOH A . F 4 HOH 289 789 48 HOH HOH A . F 4 HOH 290 790 159 HOH HOH A . F 4 HOH 291 791 249 HOH HOH A . F 4 HOH 292 792 49 HOH HOH A . F 4 HOH 293 793 420 HOH HOH A . F 4 HOH 294 794 334 HOH HOH A . F 4 HOH 295 795 415 HOH HOH A . F 4 HOH 296 796 29 HOH HOH A . F 4 HOH 297 797 423 HOH HOH A . F 4 HOH 298 798 227 HOH HOH A . F 4 HOH 299 799 170 HOH HOH A . F 4 HOH 300 800 142 HOH HOH A . F 4 HOH 301 801 69 HOH HOH A . F 4 HOH 302 802 343 HOH HOH A . F 4 HOH 303 803 332 HOH HOH A . F 4 HOH 304 804 283 HOH HOH A . F 4 HOH 305 805 264 HOH HOH A . F 4 HOH 306 806 254 HOH HOH A . F 4 HOH 307 807 96 HOH HOH A . F 4 HOH 308 808 184 HOH HOH A . F 4 HOH 309 809 78 HOH HOH A . F 4 HOH 310 810 279 HOH HOH A . F 4 HOH 311 811 346 HOH HOH A . F 4 HOH 312 812 82 HOH HOH A . F 4 HOH 313 813 392 HOH HOH A . F 4 HOH 314 814 281 HOH HOH A . F 4 HOH 315 815 362 HOH HOH A . F 4 HOH 316 816 30 HOH HOH A . F 4 HOH 317 817 174 HOH HOH A . F 4 HOH 318 818 179 HOH HOH A . F 4 HOH 319 819 51 HOH HOH A . F 4 HOH 320 820 290 HOH HOH A . F 4 HOH 321 821 371 HOH HOH A . F 4 HOH 322 822 56 HOH HOH A . F 4 HOH 323 823 111 HOH HOH A . F 4 HOH 324 824 128 HOH HOH A . F 4 HOH 325 825 397 HOH HOH A . F 4 HOH 326 826 190 HOH HOH A . F 4 HOH 327 827 316 HOH HOH A . F 4 HOH 328 828 444 HOH HOH A . F 4 HOH 329 829 118 HOH HOH A . F 4 HOH 330 830 443 HOH HOH A . F 4 HOH 331 831 461 HOH HOH A . F 4 HOH 332 832 384 HOH HOH A . F 4 HOH 333 833 480 HOH HOH A . F 4 HOH 334 834 150 HOH HOH A . F 4 HOH 335 835 463 HOH HOH A . F 4 HOH 336 836 393 HOH HOH A . F 4 HOH 337 837 298 HOH HOH A . F 4 HOH 338 838 473 HOH HOH A . F 4 HOH 339 839 263 HOH HOH A . F 4 HOH 340 840 416 HOH HOH A . F 4 HOH 341 841 113 HOH HOH A . F 4 HOH 342 842 379 HOH HOH A . F 4 HOH 343 843 437 HOH HOH A . F 4 HOH 344 844 138 HOH HOH A . F 4 HOH 345 845 156 HOH HOH A . F 4 HOH 346 846 448 HOH HOH A . F 4 HOH 347 847 426 HOH HOH A . F 4 HOH 348 848 373 HOH HOH A . F 4 HOH 349 849 414 HOH HOH A . F 4 HOH 350 850 358 HOH HOH A . F 4 HOH 351 851 308 HOH HOH A . F 4 HOH 352 852 365 HOH HOH A . F 4 HOH 353 853 450 HOH HOH A . F 4 HOH 354 854 413 HOH HOH A . F 4 HOH 355 855 323 HOH HOH A . F 4 HOH 356 856 367 HOH HOH A . F 4 HOH 357 857 167 HOH HOH A . F 4 HOH 358 858 363 HOH HOH A . F 4 HOH 359 859 210 HOH HOH A . F 4 HOH 360 860 354 HOH HOH A . F 4 HOH 361 861 186 HOH HOH A . F 4 HOH 362 862 412 HOH HOH A . F 4 HOH 363 863 387 HOH HOH A . F 4 HOH 364 864 422 HOH HOH A . F 4 HOH 365 865 427 HOH HOH A . F 4 HOH 366 866 395 HOH HOH A . F 4 HOH 367 867 327 HOH HOH A . F 4 HOH 368 868 340 HOH HOH A . F 4 HOH 369 869 320 HOH HOH A . F 4 HOH 370 870 361 HOH HOH A . F 4 HOH 371 871 445 HOH HOH A . F 4 HOH 372 872 404 HOH HOH A . F 4 HOH 373 873 269 HOH HOH A . F 4 HOH 374 874 483 HOH HOH A . F 4 HOH 375 875 482 HOH HOH A . F 4 HOH 376 876 315 HOH HOH A . F 4 HOH 377 877 481 HOH HOH A . F 4 HOH 378 878 169 HOH HOH A . F 4 HOH 379 879 319 HOH HOH A . F 4 HOH 380 880 356 HOH HOH A . F 4 HOH 381 881 476 HOH HOH A . F 4 HOH 382 882 212 HOH HOH A . F 4 HOH 383 883 235 HOH HOH A . F 4 HOH 384 884 348 HOH HOH A . F 4 HOH 385 885 468 HOH HOH A . F 4 HOH 386 886 217 HOH HOH A . F 4 HOH 387 887 294 HOH HOH A . F 4 HOH 388 888 328 HOH HOH A . F 4 HOH 389 889 192 HOH HOH A . F 4 HOH 390 890 475 HOH HOH A . F 4 HOH 391 891 336 HOH HOH A . F 4 HOH 392 892 377 HOH HOH A . F 4 HOH 393 893 149 HOH HOH A . F 4 HOH 394 894 394 HOH HOH A . F 4 HOH 395 895 187 HOH HOH A . F 4 HOH 396 896 141 HOH HOH A . F 4 HOH 397 897 399 HOH HOH A . F 4 HOH 398 898 112 HOH HOH A . F 4 HOH 399 899 364 HOH HOH A . F 4 HOH 400 900 50 HOH HOH A . F 4 HOH 401 901 265 HOH HOH A . F 4 HOH 402 902 245 HOH HOH A . F 4 HOH 403 903 181 HOH HOH A . F 4 HOH 404 904 484 HOH HOH A . F 4 HOH 405 905 460 HOH HOH A . F 4 HOH 406 906 207 HOH HOH A . F 4 HOH 407 907 173 HOH HOH A . F 4 HOH 408 908 485 HOH HOH A . F 4 HOH 409 909 400 HOH HOH A . F 4 HOH 410 910 349 HOH HOH A . F 4 HOH 411 911 302 HOH HOH A . F 4 HOH 412 912 355 HOH HOH A . F 4 HOH 413 913 133 HOH HOH A . F 4 HOH 414 914 418 HOH HOH A . F 4 HOH 415 915 295 HOH HOH A . F 4 HOH 416 916 360 HOH HOH A . F 4 HOH 417 917 374 HOH HOH A . F 4 HOH 418 918 262 HOH HOH A . F 4 HOH 419 919 432 HOH HOH A . F 4 HOH 420 920 168 HOH HOH A . F 4 HOH 421 921 456 HOH HOH A . F 4 HOH 422 922 229 HOH HOH A . F 4 HOH 423 923 305 HOH HOH A . F 4 HOH 424 924 120 HOH HOH A . F 4 HOH 425 925 388 HOH HOH A . F 4 HOH 426 926 464 HOH HOH A . F 4 HOH 427 927 472 HOH HOH A . F 4 HOH 428 928 284 HOH HOH A . F 4 HOH 429 929 155 HOH HOH A . F 4 HOH 430 930 402 HOH HOH A . F 4 HOH 431 931 241 HOH HOH A . F 4 HOH 432 932 97 HOH HOH A . F 4 HOH 433 933 347 HOH HOH A . F 4 HOH 434 934 268 HOH HOH A . F 4 HOH 435 935 366 HOH HOH A . F 4 HOH 436 936 470 HOH HOH A . F 4 HOH 437 937 251 HOH HOH A . F 4 HOH 438 938 407 HOH HOH A . F 4 HOH 439 939 406 HOH HOH A . F 4 HOH 440 940 411 HOH HOH A . F 4 HOH 441 941 441 HOH HOH A . F 4 HOH 442 942 125 HOH HOH A . F 4 HOH 443 943 247 HOH HOH A . F 4 HOH 444 944 314 HOH HOH A . F 4 HOH 445 945 430 HOH HOH A . F 4 HOH 446 946 382 HOH HOH A . F 4 HOH 447 947 216 HOH HOH A . F 4 HOH 448 948 451 HOH HOH A . F 4 HOH 449 949 286 HOH HOH A . F 4 HOH 450 950 486 HOH HOH A . F 4 HOH 451 951 353 HOH HOH A . F 4 HOH 452 952 345 HOH HOH A . F 4 HOH 453 953 204 HOH HOH A . F 4 HOH 454 954 289 HOH HOH A . F 4 HOH 455 955 325 HOH HOH A . F 4 HOH 456 956 452 HOH HOH A . F 4 HOH 457 957 130 HOH HOH A . F 4 HOH 458 958 271 HOH HOH A . F 4 HOH 459 959 178 HOH HOH A . F 4 HOH 460 960 471 HOH HOH A . F 4 HOH 461 961 434 HOH HOH A . F 4 HOH 462 962 252 HOH HOH A . F 4 HOH 463 963 248 HOH HOH A . F 4 HOH 464 964 250 HOH HOH A . F 4 HOH 465 965 458 HOH HOH A . F 4 HOH 466 966 466 HOH HOH A . F 4 HOH 467 967 228 HOH HOH A . F 4 HOH 468 968 449 HOH HOH A . F 4 HOH 469 969 409 HOH HOH A . F 4 HOH 470 970 436 HOH HOH A . F 4 HOH 471 971 424 HOH HOH A . F 4 HOH 472 972 462 HOH HOH A . F 4 HOH 473 973 276 HOH HOH A . F 4 HOH 474 974 389 HOH HOH A . F 4 HOH 475 975 419 HOH HOH A . F 4 HOH 476 976 310 HOH HOH A . F 4 HOH 477 977 469 HOH HOH A . F 4 HOH 478 978 303 HOH HOH A . F 4 HOH 479 979 220 HOH HOH A . F 4 HOH 480 980 261 HOH HOH A . F 4 HOH 481 981 274 HOH HOH A . F 4 HOH 482 982 438 HOH HOH A . F 4 HOH 483 983 383 HOH HOH A . F 4 HOH 484 984 333 HOH HOH A . F 4 HOH 485 985 350 HOH HOH A . F 4 HOH 486 986 311 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8AWY _cell.details ? _cell.formula_units_Z ? _cell.length_a 92.700 _cell.length_a_esd ? _cell.length_b 102.350 _cell.length_b_esd ? _cell.length_c 99.300 _cell.length_c_esd ? _cell.volume 942143.008 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8AWY _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall 'I 2 2' _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8AWY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.72 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'BATCH MODE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '35% (w/v) PEG3350, 200 mM lithium sulfate and 10 mM Hepes/NaOH pH 7.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment Y # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-02-22 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9763 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P14 (MX2)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9763 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P14 (MX2)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate 11.75 _reflns.entry_id 8AWY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.6 _reflns.d_resolution_low 71.27 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 62424 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.97 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 662 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half .9792 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 1.6 _reflns_shell.d_res_low 1.657 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 6154 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.9519 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 15.22 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8AWY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.60 _refine.ls_d_res_low 71.27 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 62421 _refine.ls_number_reflns_R_free 3219 _refine.ls_number_reflns_R_work 59202 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.97 _refine.ls_percent_reflns_R_free 5.16 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1753 _refine.ls_R_factor_R_free 0.1940 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1743 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6RNF _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 16.7186 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1418 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.60 _refine_hist.d_res_low 71.27 _refine_hist.number_atoms_solvent 486 _refine_hist.number_atoms_total 3541 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3046 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0050 ? 3196 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8465 ? 4338 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0481 ? 447 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0090 ? 595 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 5.0000 ? 448 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.60 1.62 . . 130 2527 100.00 . . . 0.2605 . 0.2303 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.62 1.65 . . 127 2553 99.96 . . . 0.2033 . 0.2023 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.65 1.68 . . 144 2551 100.00 . . . 0.2061 . 0.1892 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.68 1.71 . . 122 2578 100.00 . . . 0.1733 . 0.1857 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.71 1.74 . . 148 2539 99.93 . . . 0.1850 . 0.1830 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.74 1.77 . . 133 2560 100.00 . . . 0.1990 . 0.1754 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.77 1.81 . . 158 2542 100.00 . . . 0.1974 . 0.1708 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.81 1.84 . . 128 2548 100.00 . . . 0.2060 . 0.1791 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.85 1.89 . . 147 2556 100.00 . . . 0.2188 . 0.1869 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.89 1.94 . . 165 2536 100.00 . . . 0.2208 . 0.1919 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.94 1.99 . . 190 2465 99.92 . . . 0.2173 . 0.2124 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.99 2.05 . . 170 2534 99.96 . . . 0.1954 . 0.1835 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.05 2.11 . . 139 2572 99.96 . . . 0.1929 . 0.1745 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.11 2.19 . . 144 2571 100.00 . . . 0.1908 . 0.1636 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.19 2.27 . . 135 2557 99.89 . . . 0.1797 . 0.1690 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.28 2.38 . . 156 2570 100.00 . . . 0.1773 . 0.1612 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.38 2.50 . . 135 2584 100.00 . . . 0.1619 . 0.1621 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.50 2.66 . . 112 2616 99.96 . . . 0.1975 . 0.1772 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.66 2.87 . . 144 2549 100.00 . . . 0.1868 . 0.1725 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.87 3.15 . . 141 2624 100.00 . . . 0.1767 . 0.1690 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.15 3.61 . . 113 2622 100.00 . . . 0.1812 . 0.1578 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.61 4.55 . . 115 2676 100.00 . . . 0.1839 . 0.1557 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.55 71.27 . . 123 2772 99.86 . . . 0.2250 . 0.1866 . . . . . . . . . . . # _struct.entry_id 8AWY _struct.title 'Millisecond cryo-trapping by the spitrobot crystal plunger, Serial measurement Xylose Isomerase with 2,3-butanediol at 50ms' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8AWY _struct_keywords.text 'Xylose Isomerase, Glucose Isomerase, Humidity serial measurement, time-resolved crystallography, ISOMERASE' _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 2 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code XYLA_STRRU _struct_ref.pdbx_db_accession P24300 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVESVRRLAELGAHGVTFHDDDLIPFGSSDSEREEHVKRFRQALD DTGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKE AFDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK LFHIDLNGQNGIKYDQDLRFGAGDLRAAFWLVDLLESAGYSGPRHFDFKPPRTEDFDGVWASAAGCMRNYLILKERAAAF RADPEVQEALRASRLDELARPTAADGLQALLDDRSAFEEFDVDAAAARGMAFERLDQLAMDHLLGARG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8AWY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 388 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P24300 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 388 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 388 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 31150 ? 1 MORE -166 ? 1 'SSA (A^2)' 46020 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 92.7000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 92.7000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 6 ? ASP A 9 ? THR A 6 ASP A 9 5 ? 4 HELX_P HELX_P2 AA2 LEU A 15 ? GLY A 19 ? LEU A 15 GLY A 19 1 ? 5 HELX_P HELX_P3 AA3 ASP A 35 ? LEU A 46 ? ASP A 35 LEU A 46 1 ? 12 HELX_P HELX_P4 AA4 ASP A 55 ? ILE A 59 ? ASP A 55 ILE A 59 1 ? 5 HELX_P HELX_P5 AA5 SER A 64 ? GLY A 83 ? SER A 64 GLY A 83 1 ? 20 HELX_P HELX_P6 AA6 HIS A 96 ? LYS A 100 ? HIS A 96 LYS A 100 5 ? 5 HELX_P HELX_P7 AA7 ASP A 108 ? LEU A 129 ? ASP A 108 LEU A 129 1 ? 22 HELX_P HELX_P8 AA8 ASP A 150 ? GLY A 173 ? ASP A 150 GLY A 173 1 ? 24 HELX_P HELX_P9 AA9 THR A 195 ? GLU A 204 ? THR A 195 GLU A 204 1 ? 10 HELX_P HELX_P10 AB1 ARG A 208 ? GLU A 210 ? ARG A 208 GLU A 210 5 ? 3 HELX_P HELX_P11 AB2 GLU A 217 ? MET A 223 ? GLU A 217 MET A 223 1 ? 7 HELX_P HELX_P12 AB3 ASN A 227 ? ALA A 238 ? ASN A 227 ALA A 238 1 ? 12 HELX_P HELX_P13 AB4 ASP A 264 ? GLY A 279 ? ASP A 264 GLY A 279 1 ? 16 HELX_P HELX_P14 AB5 ASP A 295 ? ASP A 323 ? ASP A 295 ASP A 323 1 ? 29 HELX_P HELX_P15 AB6 ASP A 323 ? SER A 333 ? ASP A 323 SER A 333 1 ? 11 HELX_P HELX_P16 AB7 ARG A 334 ? ALA A 339 ? ARG A 334 ALA A 339 1 ? 6 HELX_P HELX_P17 AB8 GLY A 346 ? ASP A 353 ? GLY A 346 ASP A 353 1 ? 8 HELX_P HELX_P18 AB9 ARG A 354 ? PHE A 357 ? ARG A 354 PHE A 357 5 ? 4 HELX_P HELX_P19 AC1 ASP A 361 ? ARG A 368 ? ASP A 361 ARG A 368 1 ? 8 HELX_P HELX_P20 AC2 ALA A 371 ? GLY A 385 ? ALA A 371 GLY A 385 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 181 OE2 ? ? ? 1_555 B MG . MG ? ? A GLU 181 A MG 401 1_555 ? ? ? ? ? ? ? 1.913 ? ? metalc2 metalc ? ? A GLU 210 OE1 ? ? ? 1_555 E MG . MG ? ? A GLU 210 A MG 404 1_555 ? ? ? ? ? ? ? 2.762 ? ? metalc3 metalc ? ? A GLU 217 OE1 ? ? ? 1_555 B MG . MG ? ? A GLU 217 A MG 401 1_555 ? ? ? ? ? ? ? 2.073 ? ? metalc4 metalc ? ? A ASP 245 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 245 A MG 401 1_555 ? ? ? ? ? ? ? 2.102 ? ? metalc5 metalc ? ? A ASP 287 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 287 A MG 401 1_555 ? ? ? ? ? ? ? 1.921 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 D BU9 . O6 ? ? A MG 401 A BU9 403 1_555 ? ? ? ? ? ? ? 2.334 ? ? metalc7 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 640 1_555 ? ? ? ? ? ? ? 2.891 ? ? metalc8 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 404 A HOH 560 1_555 ? ? ? ? ? ? ? 2.980 ? ? metalc9 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 404 A HOH 625 1_555 ? ? ? ? ? ? ? 2.716 ? ? metalc10 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 404 A HOH 912 1_555 ? ? ? ? ? ? ? 1.870 ? ? metalc11 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 404 A HOH 933 1_555 ? ? ? ? ? ? ? 2.974 ? ? metalc12 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 404 A HOH 948 1_555 ? ? ? ? ? ? ? 2.806 ? ? metalc13 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 404 A HOH 955 1_555 ? ? ? ? ? ? ? 2.976 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 181 ? A GLU 181 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OE1 ? A GLU 217 ? A GLU 217 ? 1_555 94.2 ? 2 OE2 ? A GLU 181 ? A GLU 181 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD2 ? A ASP 245 ? A ASP 245 ? 1_555 99.0 ? 3 OE1 ? A GLU 217 ? A GLU 217 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD2 ? A ASP 245 ? A ASP 245 ? 1_555 107.1 ? 4 OE2 ? A GLU 181 ? A GLU 181 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD2 ? A ASP 287 ? A ASP 287 ? 1_555 151.9 ? 5 OE1 ? A GLU 217 ? A GLU 217 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD2 ? A ASP 287 ? A ASP 287 ? 1_555 91.5 ? 6 OD2 ? A ASP 245 ? A ASP 245 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD2 ? A ASP 287 ? A ASP 287 ? 1_555 105.6 ? 7 OE2 ? A GLU 181 ? A GLU 181 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O6 ? D BU9 . ? A BU9 403 ? 1_555 85.6 ? 8 OE1 ? A GLU 217 ? A GLU 217 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O6 ? D BU9 . ? A BU9 403 ? 1_555 162.4 ? 9 OD2 ? A ASP 245 ? A ASP 245 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O6 ? D BU9 . ? A BU9 403 ? 1_555 90.2 ? 10 OD2 ? A ASP 287 ? A ASP 287 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O6 ? D BU9 . ? A BU9 403 ? 1_555 80.9 ? 11 OE1 ? A GLU 210 ? A GLU 210 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 560 ? 1_555 86.1 ? 12 OE1 ? A GLU 210 ? A GLU 210 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 625 ? 1_555 134.6 ? 13 O ? F HOH . ? A HOH 560 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 625 ? 1_555 64.4 ? 14 OE1 ? A GLU 210 ? A GLU 210 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 912 ? 1_555 127.8 ? 15 O ? F HOH . ? A HOH 560 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 912 ? 1_555 44.2 ? 16 O ? F HOH . ? A HOH 625 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 912 ? 1_555 46.9 ? 17 OE1 ? A GLU 210 ? A GLU 210 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 933 ? 1_555 101.3 ? 18 O ? F HOH . ? A HOH 560 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 933 ? 1_555 60.9 ? 19 O ? F HOH . ? A HOH 625 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 933 ? 1_555 93.8 ? 20 O ? F HOH . ? A HOH 912 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 933 ? 1_555 47.0 ? 21 OE1 ? A GLU 210 ? A GLU 210 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 948 ? 1_555 110.1 ? 22 O ? F HOH . ? A HOH 560 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 948 ? 1_555 163.6 ? 23 O ? F HOH . ? A HOH 625 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 948 ? 1_555 103.3 ? 24 O ? F HOH . ? A HOH 912 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 948 ? 1_555 119.6 ? 25 O ? F HOH . ? A HOH 933 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 948 ? 1_555 111.6 ? 26 OE1 ? A GLU 210 ? A GLU 210 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 955 ? 1_555 166.4 ? 27 O ? F HOH . ? A HOH 560 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 955 ? 1_555 85.4 ? 28 O ? F HOH . ? A HOH 625 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 955 ? 1_555 48.9 ? 29 O ? F HOH . ? A HOH 912 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 955 ? 1_555 41.7 ? 30 O ? F HOH . ? A HOH 933 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 955 ? 1_555 65.3 ? 31 O ? F HOH . ? A HOH 948 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 955 ? 1_555 78.3 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 186 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 186 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 187 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 187 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 13.39 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 212 ? VAL A 214 ? TYR A 212 VAL A 214 AA1 2 ARG A 177 ? ILE A 180 ? ARG A 177 ILE A 180 AA1 3 THR A 133 ? ALA A 136 ? THR A 133 ALA A 136 AA1 4 LYS A 85 ? THR A 90 ? LYS A 85 THR A 90 AA1 5 GLY A 50 ? HIS A 54 ? GLY A 50 HIS A 54 AA1 6 PHE A 11 ? GLY A 14 ? PHE A 11 GLY A 14 AA1 7 ARG A 284 ? PHE A 286 ? ARG A 284 PHE A 286 AA1 8 ASP A 245 ? LEU A 246 ? ASP A 245 LEU A 246 AA2 1 GLY A 142 ? ALA A 143 ? GLY A 142 ALA A 143 AA2 2 ASP A 190 ? ILE A 191 ? ASP A 190 ILE A 191 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLY A 213 ? O GLY A 213 N ILE A 180 ? N ILE A 180 AA1 2 3 O ARG A 177 ? O ARG A 177 N TYR A 134 ? N TYR A 134 AA1 3 4 O VAL A 135 ? O VAL A 135 N ALA A 89 ? N ALA A 89 AA1 4 5 O LYS A 85 ? O LYS A 85 N VAL A 51 ? N VAL A 51 AA1 5 6 O THR A 52 ? O THR A 52 N PHE A 13 ? N PHE A 13 AA1 6 7 N THR A 12 ? N THR A 12 O PHE A 286 ? O PHE A 286 AA1 7 8 O HIS A 285 ? O HIS A 285 N LEU A 246 ? N LEU A 246 AA2 1 2 N ALA A 143 ? N ALA A 143 O ASP A 190 ? O ASP A 190 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 867 ? ? O A HOH 869 ? ? 1.85 2 1 O A HOH 530 ? ? O A HOH 891 ? ? 1.91 3 1 O A HOH 866 ? ? O A HOH 885 ? ? 1.92 4 1 O A HOH 662 ? ? O A HOH 847 ? ? 1.92 5 1 OD2 A ASP 28 ? ? O A HOH 501 ? ? 1.92 6 1 OD1 A ASN 2 ? ? O A HOH 502 ? ? 1.93 7 1 O A HOH 794 ? ? O A HOH 938 ? ? 1.94 8 1 O A HOH 504 ? ? O A HOH 687 ? ? 1.98 9 1 O A HOH 805 ? ? O A HOH 931 ? ? 1.98 10 1 O A HOH 625 ? ? O A HOH 912 ? ? 1.98 11 1 O A HOH 912 ? ? O A HOH 955 ? ? 2.01 12 1 O A HOH 506 ? ? O A HOH 758 ? ? 2.03 13 1 O A HOH 577 ? ? O A HOH 894 ? ? 2.03 14 1 O A HOH 513 ? ? O A HOH 924 ? ? 2.03 15 1 O A HOH 977 ? ? O A HOH 986 ? ? 2.06 16 1 O A HOH 560 ? ? O A HOH 912 ? ? 2.09 17 1 OE2 A GLU 217 ? ? O A HOH 503 ? ? 2.10 18 1 O A HOH 924 ? ? O A HOH 979 ? ? 2.10 19 1 OD1 A ASP 81 ? ? O A HOH 504 ? ? 2.10 20 1 O A HOH 866 ? ? O A HOH 905 ? ? 2.14 21 1 O A HOH 827 ? ? O A HOH 973 ? ? 2.16 22 1 O A HOH 820 ? ? O A HOH 852 ? ? 2.16 23 1 O A HOH 926 ? ? O A HOH 965 ? ? 2.16 24 1 O A HOH 522 ? ? O A HOH 952 ? ? 2.17 25 1 O A HOH 680 ? ? O A HOH 853 ? ? 2.17 26 1 O A HOH 912 ? ? O A HOH 933 ? ? 2.18 27 1 O A HOH 742 ? ? O A HOH 856 ? ? 2.19 28 1 O A HOH 830 ? ? O A HOH 950 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 17 ? ? -86.62 -75.49 2 1 PHE A 94 ? ? -144.80 -22.05 3 1 GLU A 186 ? ? 77.20 111.66 4 1 ASN A 247 ? ? -167.91 -167.28 5 1 ASN A 250 ? ? -100.37 76.94 6 1 PHE A 357 ? ? -158.74 -73.48 7 1 ARG A 387 ? ? -89.60 -131.17 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 533 ? F HOH . 2 1 A HOH 681 ? F HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z 4 -x,-y,z 5 x+1/2,y+1/2,z+1/2 6 x+1/2,-y+1/2,-z+1/2 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # _pdbx_entry_details.entry_id 8AWY _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 984 ? 5.81 . 2 1 O ? A HOH 985 ? 5.84 . 3 1 O ? A HOH 986 ? 5.96 . # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BU9 C03 C N N 74 BU9 C04 C N S 75 BU9 O06 O N N 76 BU9 C05 C N R 77 BU9 C01 C N N 78 BU9 O6 O N N 79 BU9 H011 H N N 80 BU9 H012 H N N 81 BU9 H013 H N N 82 BU9 H05 H N N 83 BU9 H031 H N N 84 BU9 H032 H N N 85 BU9 H033 H N N 86 BU9 H04 H N N 87 BU9 H06 H N N 88 BU9 H6 H N N 89 CYS N N N N 90 CYS CA C N R 91 CYS C C N N 92 CYS O O N N 93 CYS CB C N N 94 CYS SG S N N 95 CYS OXT O N N 96 CYS H H N N 97 CYS H2 H N N 98 CYS HA H N N 99 CYS HB2 H N N 100 CYS HB3 H N N 101 CYS HG H N N 102 CYS HXT H N N 103 GLN N N N N 104 GLN CA C N S 105 GLN C C N N 106 GLN O O N N 107 GLN CB C N N 108 GLN CG C N N 109 GLN CD C N N 110 GLN OE1 O N N 111 GLN NE2 N N N 112 GLN OXT O N N 113 GLN H H N N 114 GLN H2 H N N 115 GLN HA H N N 116 GLN HB2 H N N 117 GLN HB3 H N N 118 GLN HG2 H N N 119 GLN HG3 H N N 120 GLN HE21 H N N 121 GLN HE22 H N N 122 GLN HXT H N N 123 GLU N N N N 124 GLU CA C N S 125 GLU C C N N 126 GLU O O N N 127 GLU CB C N N 128 GLU CG C N N 129 GLU CD C N N 130 GLU OE1 O N N 131 GLU OE2 O N N 132 GLU OXT O N N 133 GLU H H N N 134 GLU H2 H N N 135 GLU HA H N N 136 GLU HB2 H N N 137 GLU HB3 H N N 138 GLU HG2 H N N 139 GLU HG3 H N N 140 GLU HE2 H N N 141 GLU HXT H N N 142 GLY N N N N 143 GLY CA C N N 144 GLY C C N N 145 GLY O O N N 146 GLY OXT O N N 147 GLY H H N N 148 GLY H2 H N N 149 GLY HA2 H N N 150 GLY HA3 H N N 151 GLY HXT H N N 152 HIS N N N N 153 HIS CA C N S 154 HIS C C N N 155 HIS O O N N 156 HIS CB C N N 157 HIS CG C Y N 158 HIS ND1 N Y N 159 HIS CD2 C Y N 160 HIS CE1 C Y N 161 HIS NE2 N Y N 162 HIS OXT O N N 163 HIS H H N N 164 HIS H2 H N N 165 HIS HA H N N 166 HIS HB2 H N N 167 HIS HB3 H N N 168 HIS HD1 H N N 169 HIS HD2 H N N 170 HIS HE1 H N N 171 HIS HE2 H N N 172 HIS HXT H N N 173 HOH O O N N 174 HOH H1 H N N 175 HOH H2 H N N 176 ILE N N N N 177 ILE CA C N S 178 ILE C C N N 179 ILE O O N N 180 ILE CB C N S 181 ILE CG1 C N N 182 ILE CG2 C N N 183 ILE CD1 C N N 184 ILE OXT O N N 185 ILE H H N N 186 ILE H2 H N N 187 ILE HA H N N 188 ILE HB H N N 189 ILE HG12 H N N 190 ILE HG13 H N N 191 ILE HG21 H N N 192 ILE HG22 H N N 193 ILE HG23 H N N 194 ILE HD11 H N N 195 ILE HD12 H N N 196 ILE HD13 H N N 197 ILE HXT H N N 198 LEU N N N N 199 LEU CA C N S 200 LEU C C N N 201 LEU O O N N 202 LEU CB C N N 203 LEU CG C N N 204 LEU CD1 C N N 205 LEU CD2 C N N 206 LEU OXT O N N 207 LEU H H N N 208 LEU H2 H N N 209 LEU HA H N N 210 LEU HB2 H N N 211 LEU HB3 H N N 212 LEU HG H N N 213 LEU HD11 H N N 214 LEU HD12 H N N 215 LEU HD13 H N N 216 LEU HD21 H N N 217 LEU HD22 H N N 218 LEU HD23 H N N 219 LEU HXT H N N 220 LYS N N N N 221 LYS CA C N S 222 LYS C C N N 223 LYS O O N N 224 LYS CB C N N 225 LYS CG C N N 226 LYS CD C N N 227 LYS CE C N N 228 LYS NZ N N N 229 LYS OXT O N N 230 LYS H H N N 231 LYS H2 H N N 232 LYS HA H N N 233 LYS HB2 H N N 234 LYS HB3 H N N 235 LYS HG2 H N N 236 LYS HG3 H N N 237 LYS HD2 H N N 238 LYS HD3 H N N 239 LYS HE2 H N N 240 LYS HE3 H N N 241 LYS HZ1 H N N 242 LYS HZ2 H N N 243 LYS HZ3 H N N 244 LYS HXT H N N 245 MET N N N N 246 MET CA C N S 247 MET C C N N 248 MET O O N N 249 MET CB C N N 250 MET CG C N N 251 MET SD S N N 252 MET CE C N N 253 MET OXT O N N 254 MET H H N N 255 MET H2 H N N 256 MET HA H N N 257 MET HB2 H N N 258 MET HB3 H N N 259 MET HG2 H N N 260 MET HG3 H N N 261 MET HE1 H N N 262 MET HE2 H N N 263 MET HE3 H N N 264 MET HXT H N N 265 MG MG MG N N 266 PHE N N N N 267 PHE CA C N S 268 PHE C C N N 269 PHE O O N N 270 PHE CB C N N 271 PHE CG C Y N 272 PHE CD1 C Y N 273 PHE CD2 C Y N 274 PHE CE1 C Y N 275 PHE CE2 C Y N 276 PHE CZ C Y N 277 PHE OXT O N N 278 PHE H H N N 279 PHE H2 H N N 280 PHE HA H N N 281 PHE HB2 H N N 282 PHE HB3 H N N 283 PHE HD1 H N N 284 PHE HD2 H N N 285 PHE HE1 H N N 286 PHE HE2 H N N 287 PHE HZ H N N 288 PHE HXT H N N 289 PRO N N N N 290 PRO CA C N S 291 PRO C C N N 292 PRO O O N N 293 PRO CB C N N 294 PRO CG C N N 295 PRO CD C N N 296 PRO OXT O N N 297 PRO H H N N 298 PRO HA H N N 299 PRO HB2 H N N 300 PRO HB3 H N N 301 PRO HG2 H N N 302 PRO HG3 H N N 303 PRO HD2 H N N 304 PRO HD3 H N N 305 PRO HXT H N N 306 SER N N N N 307 SER CA C N S 308 SER C C N N 309 SER O O N N 310 SER CB C N N 311 SER OG O N N 312 SER OXT O N N 313 SER H H N N 314 SER H2 H N N 315 SER HA H N N 316 SER HB2 H N N 317 SER HB3 H N N 318 SER HG H N N 319 SER HXT H N N 320 THR N N N N 321 THR CA C N S 322 THR C C N N 323 THR O O N N 324 THR CB C N R 325 THR OG1 O N N 326 THR CG2 C N N 327 THR OXT O N N 328 THR H H N N 329 THR H2 H N N 330 THR HA H N N 331 THR HB H N N 332 THR HG1 H N N 333 THR HG21 H N N 334 THR HG22 H N N 335 THR HG23 H N N 336 THR HXT H N N 337 TRP N N N N 338 TRP CA C N S 339 TRP C C N N 340 TRP O O N N 341 TRP CB C N N 342 TRP CG C Y N 343 TRP CD1 C Y N 344 TRP CD2 C Y N 345 TRP NE1 N Y N 346 TRP CE2 C Y N 347 TRP CE3 C Y N 348 TRP CZ2 C Y N 349 TRP CZ3 C Y N 350 TRP CH2 C Y N 351 TRP OXT O N N 352 TRP H H N N 353 TRP H2 H N N 354 TRP HA H N N 355 TRP HB2 H N N 356 TRP HB3 H N N 357 TRP HD1 H N N 358 TRP HE1 H N N 359 TRP HE3 H N N 360 TRP HZ2 H N N 361 TRP HZ3 H N N 362 TRP HH2 H N N 363 TRP HXT H N N 364 TYR N N N N 365 TYR CA C N S 366 TYR C C N N 367 TYR O O N N 368 TYR CB C N N 369 TYR CG C Y N 370 TYR CD1 C Y N 371 TYR CD2 C Y N 372 TYR CE1 C Y N 373 TYR CE2 C Y N 374 TYR CZ C Y N 375 TYR OH O N N 376 TYR OXT O N N 377 TYR H H N N 378 TYR H2 H N N 379 TYR HA H N N 380 TYR HB2 H N N 381 TYR HB3 H N N 382 TYR HD1 H N N 383 TYR HD2 H N N 384 TYR HE1 H N N 385 TYR HE2 H N N 386 TYR HH H N N 387 TYR HXT H N N 388 VAL N N N N 389 VAL CA C N S 390 VAL C C N N 391 VAL O O N N 392 VAL CB C N N 393 VAL CG1 C N N 394 VAL CG2 C N N 395 VAL OXT O N N 396 VAL H H N N 397 VAL H2 H N N 398 VAL HA H N N 399 VAL HB H N N 400 VAL HG11 H N N 401 VAL HG12 H N N 402 VAL HG13 H N N 403 VAL HG21 H N N 404 VAL HG22 H N N 405 VAL HG23 H N N 406 VAL HXT H N N 407 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BU9 C01 C05 sing N N 70 BU9 C03 C04 sing N N 71 BU9 C04 C05 sing N N 72 BU9 C04 O06 sing N N 73 BU9 C05 O6 sing N N 74 BU9 C01 H011 sing N N 75 BU9 C01 H012 sing N N 76 BU9 C01 H013 sing N N 77 BU9 C05 H05 sing N N 78 BU9 C03 H031 sing N N 79 BU9 C03 H032 sing N N 80 BU9 C03 H033 sing N N 81 BU9 C04 H04 sing N N 82 BU9 O06 H06 sing N N 83 BU9 O6 H6 sing N N 84 CYS N CA sing N N 85 CYS N H sing N N 86 CYS N H2 sing N N 87 CYS CA C sing N N 88 CYS CA CB sing N N 89 CYS CA HA sing N N 90 CYS C O doub N N 91 CYS C OXT sing N N 92 CYS CB SG sing N N 93 CYS CB HB2 sing N N 94 CYS CB HB3 sing N N 95 CYS SG HG sing N N 96 CYS OXT HXT sing N N 97 GLN N CA sing N N 98 GLN N H sing N N 99 GLN N H2 sing N N 100 GLN CA C sing N N 101 GLN CA CB sing N N 102 GLN CA HA sing N N 103 GLN C O doub N N 104 GLN C OXT sing N N 105 GLN CB CG sing N N 106 GLN CB HB2 sing N N 107 GLN CB HB3 sing N N 108 GLN CG CD sing N N 109 GLN CG HG2 sing N N 110 GLN CG HG3 sing N N 111 GLN CD OE1 doub N N 112 GLN CD NE2 sing N N 113 GLN NE2 HE21 sing N N 114 GLN NE2 HE22 sing N N 115 GLN OXT HXT sing N N 116 GLU N CA sing N N 117 GLU N H sing N N 118 GLU N H2 sing N N 119 GLU CA C sing N N 120 GLU CA CB sing N N 121 GLU CA HA sing N N 122 GLU C O doub N N 123 GLU C OXT sing N N 124 GLU CB CG sing N N 125 GLU CB HB2 sing N N 126 GLU CB HB3 sing N N 127 GLU CG CD sing N N 128 GLU CG HG2 sing N N 129 GLU CG HG3 sing N N 130 GLU CD OE1 doub N N 131 GLU CD OE2 sing N N 132 GLU OE2 HE2 sing N N 133 GLU OXT HXT sing N N 134 GLY N CA sing N N 135 GLY N H sing N N 136 GLY N H2 sing N N 137 GLY CA C sing N N 138 GLY CA HA2 sing N N 139 GLY CA HA3 sing N N 140 GLY C O doub N N 141 GLY C OXT sing N N 142 GLY OXT HXT sing N N 143 HIS N CA sing N N 144 HIS N H sing N N 145 HIS N H2 sing N N 146 HIS CA C sing N N 147 HIS CA CB sing N N 148 HIS CA HA sing N N 149 HIS C O doub N N 150 HIS C OXT sing N N 151 HIS CB CG sing N N 152 HIS CB HB2 sing N N 153 HIS CB HB3 sing N N 154 HIS CG ND1 sing Y N 155 HIS CG CD2 doub Y N 156 HIS ND1 CE1 doub Y N 157 HIS ND1 HD1 sing N N 158 HIS CD2 NE2 sing Y N 159 HIS CD2 HD2 sing N N 160 HIS CE1 NE2 sing Y N 161 HIS CE1 HE1 sing N N 162 HIS NE2 HE2 sing N N 163 HIS OXT HXT sing N N 164 HOH O H1 sing N N 165 HOH O H2 sing N N 166 ILE N CA sing N N 167 ILE N H sing N N 168 ILE N H2 sing N N 169 ILE CA C sing N N 170 ILE CA CB sing N N 171 ILE CA HA sing N N 172 ILE C O doub N N 173 ILE C OXT sing N N 174 ILE CB CG1 sing N N 175 ILE CB CG2 sing N N 176 ILE CB HB sing N N 177 ILE CG1 CD1 sing N N 178 ILE CG1 HG12 sing N N 179 ILE CG1 HG13 sing N N 180 ILE CG2 HG21 sing N N 181 ILE CG2 HG22 sing N N 182 ILE CG2 HG23 sing N N 183 ILE CD1 HD11 sing N N 184 ILE CD1 HD12 sing N N 185 ILE CD1 HD13 sing N N 186 ILE OXT HXT sing N N 187 LEU N CA sing N N 188 LEU N H sing N N 189 LEU N H2 sing N N 190 LEU CA C sing N N 191 LEU CA CB sing N N 192 LEU CA HA sing N N 193 LEU C O doub N N 194 LEU C OXT sing N N 195 LEU CB CG sing N N 196 LEU CB HB2 sing N N 197 LEU CB HB3 sing N N 198 LEU CG CD1 sing N N 199 LEU CG CD2 sing N N 200 LEU CG HG sing N N 201 LEU CD1 HD11 sing N N 202 LEU CD1 HD12 sing N N 203 LEU CD1 HD13 sing N N 204 LEU CD2 HD21 sing N N 205 LEU CD2 HD22 sing N N 206 LEU CD2 HD23 sing N N 207 LEU OXT HXT sing N N 208 LYS N CA sing N N 209 LYS N H sing N N 210 LYS N H2 sing N N 211 LYS CA C sing N N 212 LYS CA CB sing N N 213 LYS CA HA sing N N 214 LYS C O doub N N 215 LYS C OXT sing N N 216 LYS CB CG sing N N 217 LYS CB HB2 sing N N 218 LYS CB HB3 sing N N 219 LYS CG CD sing N N 220 LYS CG HG2 sing N N 221 LYS CG HG3 sing N N 222 LYS CD CE sing N N 223 LYS CD HD2 sing N N 224 LYS CD HD3 sing N N 225 LYS CE NZ sing N N 226 LYS CE HE2 sing N N 227 LYS CE HE3 sing N N 228 LYS NZ HZ1 sing N N 229 LYS NZ HZ2 sing N N 230 LYS NZ HZ3 sing N N 231 LYS OXT HXT sing N N 232 MET N CA sing N N 233 MET N H sing N N 234 MET N H2 sing N N 235 MET CA C sing N N 236 MET CA CB sing N N 237 MET CA HA sing N N 238 MET C O doub N N 239 MET C OXT sing N N 240 MET CB CG sing N N 241 MET CB HB2 sing N N 242 MET CB HB3 sing N N 243 MET CG SD sing N N 244 MET CG HG2 sing N N 245 MET CG HG3 sing N N 246 MET SD CE sing N N 247 MET CE HE1 sing N N 248 MET CE HE2 sing N N 249 MET CE HE3 sing N N 250 MET OXT HXT sing N N 251 PHE N CA sing N N 252 PHE N H sing N N 253 PHE N H2 sing N N 254 PHE CA C sing N N 255 PHE CA CB sing N N 256 PHE CA HA sing N N 257 PHE C O doub N N 258 PHE C OXT sing N N 259 PHE CB CG sing N N 260 PHE CB HB2 sing N N 261 PHE CB HB3 sing N N 262 PHE CG CD1 doub Y N 263 PHE CG CD2 sing Y N 264 PHE CD1 CE1 sing Y N 265 PHE CD1 HD1 sing N N 266 PHE CD2 CE2 doub Y N 267 PHE CD2 HD2 sing N N 268 PHE CE1 CZ doub Y N 269 PHE CE1 HE1 sing N N 270 PHE CE2 CZ sing Y N 271 PHE CE2 HE2 sing N N 272 PHE CZ HZ sing N N 273 PHE OXT HXT sing N N 274 PRO N CA sing N N 275 PRO N CD sing N N 276 PRO N H sing N N 277 PRO CA C sing N N 278 PRO CA CB sing N N 279 PRO CA HA sing N N 280 PRO C O doub N N 281 PRO C OXT sing N N 282 PRO CB CG sing N N 283 PRO CB HB2 sing N N 284 PRO CB HB3 sing N N 285 PRO CG CD sing N N 286 PRO CG HG2 sing N N 287 PRO CG HG3 sing N N 288 PRO CD HD2 sing N N 289 PRO CD HD3 sing N N 290 PRO OXT HXT sing N N 291 SER N CA sing N N 292 SER N H sing N N 293 SER N H2 sing N N 294 SER CA C sing N N 295 SER CA CB sing N N 296 SER CA HA sing N N 297 SER C O doub N N 298 SER C OXT sing N N 299 SER CB OG sing N N 300 SER CB HB2 sing N N 301 SER CB HB3 sing N N 302 SER OG HG sing N N 303 SER OXT HXT sing N N 304 THR N CA sing N N 305 THR N H sing N N 306 THR N H2 sing N N 307 THR CA C sing N N 308 THR CA CB sing N N 309 THR CA HA sing N N 310 THR C O doub N N 311 THR C OXT sing N N 312 THR CB OG1 sing N N 313 THR CB CG2 sing N N 314 THR CB HB sing N N 315 THR OG1 HG1 sing N N 316 THR CG2 HG21 sing N N 317 THR CG2 HG22 sing N N 318 THR CG2 HG23 sing N N 319 THR OXT HXT sing N N 320 TRP N CA sing N N 321 TRP N H sing N N 322 TRP N H2 sing N N 323 TRP CA C sing N N 324 TRP CA CB sing N N 325 TRP CA HA sing N N 326 TRP C O doub N N 327 TRP C OXT sing N N 328 TRP CB CG sing N N 329 TRP CB HB2 sing N N 330 TRP CB HB3 sing N N 331 TRP CG CD1 doub Y N 332 TRP CG CD2 sing Y N 333 TRP CD1 NE1 sing Y N 334 TRP CD1 HD1 sing N N 335 TRP CD2 CE2 doub Y N 336 TRP CD2 CE3 sing Y N 337 TRP NE1 CE2 sing Y N 338 TRP NE1 HE1 sing N N 339 TRP CE2 CZ2 sing Y N 340 TRP CE3 CZ3 doub Y N 341 TRP CE3 HE3 sing N N 342 TRP CZ2 CH2 doub Y N 343 TRP CZ2 HZ2 sing N N 344 TRP CZ3 CH2 sing Y N 345 TRP CZ3 HZ3 sing N N 346 TRP CH2 HH2 sing N N 347 TRP OXT HXT sing N N 348 TYR N CA sing N N 349 TYR N H sing N N 350 TYR N H2 sing N N 351 TYR CA C sing N N 352 TYR CA CB sing N N 353 TYR CA HA sing N N 354 TYR C O doub N N 355 TYR C OXT sing N N 356 TYR CB CG sing N N 357 TYR CB HB2 sing N N 358 TYR CB HB3 sing N N 359 TYR CG CD1 doub Y N 360 TYR CG CD2 sing Y N 361 TYR CD1 CE1 sing Y N 362 TYR CD1 HD1 sing N N 363 TYR CD2 CE2 doub Y N 364 TYR CD2 HD2 sing N N 365 TYR CE1 CZ doub Y N 366 TYR CE1 HE1 sing N N 367 TYR CE2 CZ sing Y N 368 TYR CE2 HE2 sing N N 369 TYR CZ OH sing N N 370 TYR OH HH sing N N 371 TYR OXT HXT sing N N 372 VAL N CA sing N N 373 VAL N H sing N N 374 VAL N H2 sing N N 375 VAL CA C sing N N 376 VAL CA CB sing N N 377 VAL CA HA sing N N 378 VAL C O doub N N 379 VAL C OXT sing N N 380 VAL CB CG1 sing N N 381 VAL CB CG2 sing N N 382 VAL CB HB sing N N 383 VAL CG1 HG11 sing N N 384 VAL CG1 HG12 sing N N 385 VAL CG1 HG13 sing N N 386 VAL CG2 HG21 sing N N 387 VAL CG2 HG22 sing N N 388 VAL CG2 HG23 sing N N 389 VAL OXT HXT sing N N 390 # _pdbx_audit_support.funding_organization 'Max Planck Society' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id BU9 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id BU9 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6RNF _pdbx_initial_refinement_model.details ? # _pdbx_serial_crystallography_sample_delivery.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery.description ? _pdbx_serial_crystallography_sample_delivery.method 'fixed target' # _space_group.name_H-M_alt 'I 2 2 2' _space_group.name_Hall 'I 2 2' _space_group.IT_number 23 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 8AWY _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010787 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009770 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010070 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 ? ? 2.59044 63.03566 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_