data_8B5G # _entry.id 8B5G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8B5G pdb_00008b5g 10.2210/pdb8b5g/pdb WWPDB D_1292125802 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-30 2 'Structure model' 1 1 2022-12-07 3 'Structure model' 1 2 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8B5G _pdbx_database_status.recvd_initial_deposition_date 2022-09-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email cc16943@gsk.com _pdbx_contact_author.name_first Chun-wa _pdbx_contact_author.name_last Chung _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2480-3110 # _audit_author.name 'Chung, C.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-2480-3110 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 15174 _citation.page_last 15207 _citation.title ;Identification and Optimization of a Ligand-Efficient Benzoazepinone Bromodomain and Extra Terminal (BET) Family Acetyl-Lysine Mimetic into the Oral Candidate Quality Molecule I-BET432. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.2c01102 _citation.pdbx_database_id_PubMed 36378954 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Humphreys, P.G.' 1 ? primary 'Anderson, N.A.' 2 ? primary 'Bamborough, P.' 3 ? primary 'Baxter, A.' 4 ? primary 'Chung, C.W.' 5 ? primary 'Cookson, R.' 6 ? primary 'Craggs, P.D.' 7 ? primary 'Dalton, T.' 8 ? primary 'Fournier, J.C.L.' 9 ? primary 'Gordon, L.J.' 10 ? primary 'Gray, H.F.' 11 ? primary 'Gray, M.W.' 12 ? primary 'Gregory, R.' 13 ? primary 'Hirst, D.J.' 14 ? primary 'Jamieson, C.' 15 ? primary 'Jones, K.L.' 16 ? primary 'Kessedjian, H.' 17 ? primary 'Lugo, D.' 18 ? primary 'McGonagle, G.' 19 ? primary 'Patel, V.K.' 20 ? primary 'Patten, C.' 21 ? primary 'Poole, D.L.' 22 ? primary 'Prinjha, R.K.' 23 ? primary 'Ramirez-Molina, C.' 24 ? primary 'Rioja, I.' 25 ? primary 'Seal, G.' 26 ? primary 'Stafford, K.A.J.' 27 ? primary 'Shah, R.R.' 28 ? primary 'Tape, D.' 29 ? primary 'Theodoulou, N.H.' 30 ? primary 'Tomlinson, L.' 31 ? primary 'Ukuser, S.' 32 ? primary 'Wall, I.D.' 33 ? primary 'Wellaway, N.' 34 ? primary 'White, G.' 35 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain-containing protein 2' 13432.462 1 ? ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 3 non-polymer syn '7,8-dimethoxy-3-methyl-1~{H}-3-benzazepin-2-one' 233.263 1 ? ? ? ? 4 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237 1 ? ? ? ? 5 water nat water 18.015 260 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'O27.1.1,Really interesting new gene 3 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL MFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL MFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD ; _entity_poly.pdbx_strand_id AAA _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 '7,8-dimethoxy-3-methyl-1~{H}-3-benzazepin-2-one' P4M 4 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 GLY n 1 5 LYS n 1 6 LEU n 1 7 SER n 1 8 GLU n 1 9 GLN n 1 10 LEU n 1 11 LYS n 1 12 HIS n 1 13 CYS n 1 14 ASN n 1 15 GLY n 1 16 ILE n 1 17 LEU n 1 18 LYS n 1 19 GLU n 1 20 LEU n 1 21 LEU n 1 22 SER n 1 23 LYS n 1 24 LYS n 1 25 HIS n 1 26 ALA n 1 27 ALA n 1 28 TYR n 1 29 ALA n 1 30 TRP n 1 31 PRO n 1 32 PHE n 1 33 TYR n 1 34 LYS n 1 35 PRO n 1 36 VAL n 1 37 ASP n 1 38 ALA n 1 39 SER n 1 40 ALA n 1 41 LEU n 1 42 GLY n 1 43 LEU n 1 44 HIS n 1 45 ASP n 1 46 TYR n 1 47 HIS n 1 48 ASP n 1 49 ILE n 1 50 ILE n 1 51 LYS n 1 52 HIS n 1 53 PRO n 1 54 MET n 1 55 ASP n 1 56 LEU n 1 57 SER n 1 58 THR n 1 59 VAL n 1 60 LYS n 1 61 ARG n 1 62 LYS n 1 63 MET n 1 64 GLU n 1 65 ASN n 1 66 ARG n 1 67 ASP n 1 68 TYR n 1 69 ARG n 1 70 ASP n 1 71 ALA n 1 72 GLN n 1 73 GLU n 1 74 PHE n 1 75 ALA n 1 76 ALA n 1 77 ASP n 1 78 VAL n 1 79 ARG n 1 80 LEU n 1 81 MET n 1 82 PHE n 1 83 SER n 1 84 ASN n 1 85 CYS n 1 86 TYR n 1 87 LYS n 1 88 TYR n 1 89 ASN n 1 90 PRO n 1 91 PRO n 1 92 ASP n 1 93 HIS n 1 94 ASP n 1 95 VAL n 1 96 VAL n 1 97 ALA n 1 98 MET n 1 99 ALA n 1 100 ARG n 1 101 LYS n 1 102 LEU n 1 103 GLN n 1 104 ASP n 1 105 VAL n 1 106 PHE n 1 107 GLU n 1 108 PHE n 1 109 ARG n 1 110 TYR n 1 111 ALA n 1 112 LYS n 1 113 MET n 1 114 PRO n 1 115 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 115 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BRD2, KIAA9001, RING3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MES non-polymer . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S' 195.237 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 P4M non-polymer . '7,8-dimethoxy-3-methyl-1~{H}-3-benzazepin-2-one' '7,8-dimethoxy-3-methyl-1,3-dihydro-2H-benzo[d]azepin-2-one' 'C13 H15 N O3' 233.263 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 341 ? ? ? AAA . n A 1 2 SER 2 342 ? ? ? AAA . n A 1 3 MET 3 343 ? ? ? AAA . n A 1 4 GLY 4 344 ? ? ? AAA . n A 1 5 LYS 5 345 345 LYS LYS AAA . n A 1 6 LEU 6 346 346 LEU LEU AAA . n A 1 7 SER 7 347 347 SER SER AAA . n A 1 8 GLU 8 348 348 GLU GLU AAA . n A 1 9 GLN 9 349 349 GLN GLN AAA . n A 1 10 LEU 10 350 350 LEU LEU AAA . n A 1 11 LYS 11 351 351 LYS LYS AAA . n A 1 12 HIS 12 352 352 HIS HIS AAA . n A 1 13 CYS 13 353 353 CYS CYS AAA . n A 1 14 ASN 14 354 354 ASN ASN AAA . n A 1 15 GLY 15 355 355 GLY GLY AAA . n A 1 16 ILE 16 356 356 ILE ILE AAA . n A 1 17 LEU 17 357 357 LEU LEU AAA . n A 1 18 LYS 18 358 358 LYS LYS AAA . n A 1 19 GLU 19 359 359 GLU GLU AAA . n A 1 20 LEU 20 360 360 LEU LEU AAA . n A 1 21 LEU 21 361 361 LEU LEU AAA . n A 1 22 SER 22 362 362 SER SER AAA . n A 1 23 LYS 23 363 363 LYS LYS AAA . n A 1 24 LYS 24 364 364 LYS LYS AAA . n A 1 25 HIS 25 365 365 HIS HIS AAA . n A 1 26 ALA 26 366 366 ALA ALA AAA . n A 1 27 ALA 27 367 367 ALA ALA AAA . n A 1 28 TYR 28 368 368 TYR TYR AAA . n A 1 29 ALA 29 369 369 ALA ALA AAA . n A 1 30 TRP 30 370 370 TRP TRP AAA . n A 1 31 PRO 31 371 371 PRO PRO AAA . n A 1 32 PHE 32 372 372 PHE PHE AAA . n A 1 33 TYR 33 373 373 TYR TYR AAA . n A 1 34 LYS 34 374 374 LYS LYS AAA . n A 1 35 PRO 35 375 375 PRO PRO AAA . n A 1 36 VAL 36 376 376 VAL VAL AAA . n A 1 37 ASP 37 377 377 ASP ASP AAA . n A 1 38 ALA 38 378 378 ALA ALA AAA . n A 1 39 SER 39 379 379 SER SER AAA . n A 1 40 ALA 40 380 380 ALA ALA AAA . n A 1 41 LEU 41 381 381 LEU LEU AAA . n A 1 42 GLY 42 382 382 GLY GLY AAA . n A 1 43 LEU 43 383 383 LEU LEU AAA . n A 1 44 HIS 44 384 384 HIS HIS AAA . n A 1 45 ASP 45 385 385 ASP ASP AAA . n A 1 46 TYR 46 386 386 TYR TYR AAA . n A 1 47 HIS 47 387 387 HIS HIS AAA . n A 1 48 ASP 48 388 388 ASP ASP AAA . n A 1 49 ILE 49 389 389 ILE ILE AAA . n A 1 50 ILE 50 390 390 ILE ILE AAA . n A 1 51 LYS 51 391 391 LYS LYS AAA . n A 1 52 HIS 52 392 392 HIS HIS AAA . n A 1 53 PRO 53 393 393 PRO PRO AAA . n A 1 54 MET 54 394 394 MET MET AAA . n A 1 55 ASP 55 395 395 ASP ASP AAA . n A 1 56 LEU 56 396 396 LEU LEU AAA . n A 1 57 SER 57 397 397 SER SER AAA . n A 1 58 THR 58 398 398 THR THR AAA . n A 1 59 VAL 59 399 399 VAL VAL AAA . n A 1 60 LYS 60 400 400 LYS LYS AAA . n A 1 61 ARG 61 401 401 ARG ARG AAA . n A 1 62 LYS 62 402 402 LYS LYS AAA . n A 1 63 MET 63 403 403 MET MET AAA . n A 1 64 GLU 64 404 404 GLU GLU AAA . n A 1 65 ASN 65 405 405 ASN ASN AAA . n A 1 66 ARG 66 406 406 ARG ARG AAA . n A 1 67 ASP 67 407 407 ASP ASP AAA . n A 1 68 TYR 68 408 408 TYR TYR AAA . n A 1 69 ARG 69 409 409 ARG ARG AAA . n A 1 70 ASP 70 410 410 ASP ASP AAA . n A 1 71 ALA 71 411 411 ALA ALA AAA . n A 1 72 GLN 72 412 412 GLN GLN AAA . n A 1 73 GLU 73 413 413 GLU GLU AAA . n A 1 74 PHE 74 414 414 PHE PHE AAA . n A 1 75 ALA 75 415 415 ALA ALA AAA . n A 1 76 ALA 76 416 416 ALA ALA AAA . n A 1 77 ASP 77 417 417 ASP ASP AAA . n A 1 78 VAL 78 418 418 VAL VAL AAA . n A 1 79 ARG 79 419 419 ARG ARG AAA . n A 1 80 LEU 80 420 420 LEU LEU AAA . n A 1 81 MET 81 421 421 MET MET AAA . n A 1 82 PHE 82 422 422 PHE PHE AAA . n A 1 83 SER 83 423 423 SER SER AAA . n A 1 84 ASN 84 424 424 ASN ASN AAA . n A 1 85 CYS 85 425 425 CYS CYS AAA . n A 1 86 TYR 86 426 426 TYR TYR AAA . n A 1 87 LYS 87 427 427 LYS LYS AAA . n A 1 88 TYR 88 428 428 TYR TYR AAA . n A 1 89 ASN 89 429 429 ASN ASN AAA . n A 1 90 PRO 90 430 430 PRO PRO AAA . n A 1 91 PRO 91 431 431 PRO PRO AAA . n A 1 92 ASP 92 432 432 ASP ASP AAA . n A 1 93 HIS 93 433 433 HIS HIS AAA . n A 1 94 ASP 94 434 434 ASP ASP AAA . n A 1 95 VAL 95 435 435 VAL VAL AAA . n A 1 96 VAL 96 436 436 VAL VAL AAA . n A 1 97 ALA 97 437 437 ALA ALA AAA . n A 1 98 MET 98 438 438 MET MET AAA . n A 1 99 ALA 99 439 439 ALA ALA AAA . n A 1 100 ARG 100 440 440 ARG ARG AAA . n A 1 101 LYS 101 441 441 LYS LYS AAA . n A 1 102 LEU 102 442 442 LEU LEU AAA . n A 1 103 GLN 103 443 443 GLN GLN AAA . n A 1 104 ASP 104 444 444 ASP ASP AAA . n A 1 105 VAL 105 445 445 VAL VAL AAA . n A 1 106 PHE 106 446 446 PHE PHE AAA . n A 1 107 GLU 107 447 447 GLU GLU AAA . n A 1 108 PHE 108 448 448 PHE PHE AAA . n A 1 109 ARG 109 449 449 ARG ARG AAA . n A 1 110 TYR 110 450 450 TYR TYR AAA . n A 1 111 ALA 111 451 451 ALA ALA AAA . n A 1 112 LYS 112 452 452 LYS LYS AAA . n A 1 113 MET 113 453 453 MET MET AAA . n A 1 114 PRO 114 454 454 PRO PRO AAA . n A 1 115 ASP 115 455 455 ASP ASP AAA . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 501 1 EDO EDO AAA . C 2 EDO 1 502 2 EDO EDO AAA . D 3 P4M 1 503 1 P4M LIG AAA . E 4 MES 1 504 1 MES MES AAA . F 5 HOH 1 601 257 HOH HOH AAA . F 5 HOH 2 602 233 HOH HOH AAA . F 5 HOH 3 603 28 HOH HOH AAA . F 5 HOH 4 604 44 HOH HOH AAA . F 5 HOH 5 605 120 HOH HOH AAA . F 5 HOH 6 606 8 HOH HOH AAA . F 5 HOH 7 607 65 HOH HOH AAA . F 5 HOH 8 608 190 HOH HOH AAA . F 5 HOH 9 609 105 HOH HOH AAA . F 5 HOH 10 610 78 HOH HOH AAA . F 5 HOH 11 611 66 HOH HOH AAA . F 5 HOH 12 612 260 HOH HOH AAA . F 5 HOH 13 613 198 HOH HOH AAA . F 5 HOH 14 614 4 HOH HOH AAA . F 5 HOH 15 615 38 HOH HOH AAA . F 5 HOH 16 616 111 HOH HOH AAA . F 5 HOH 17 617 60 HOH HOH AAA . F 5 HOH 18 618 205 HOH HOH AAA . F 5 HOH 19 619 246 HOH HOH AAA . F 5 HOH 20 620 5 HOH HOH AAA . F 5 HOH 21 621 188 HOH HOH AAA . F 5 HOH 22 622 101 HOH HOH AAA . F 5 HOH 23 623 82 HOH HOH AAA . F 5 HOH 24 624 183 HOH HOH AAA . F 5 HOH 25 625 67 HOH HOH AAA . F 5 HOH 26 626 235 HOH HOH AAA . F 5 HOH 27 627 48 HOH HOH AAA . F 5 HOH 28 628 186 HOH HOH AAA . F 5 HOH 29 629 131 HOH HOH AAA . F 5 HOH 30 630 172 HOH HOH AAA . F 5 HOH 31 631 62 HOH HOH AAA . F 5 HOH 32 632 229 HOH HOH AAA . F 5 HOH 33 633 75 HOH HOH AAA . F 5 HOH 34 634 43 HOH HOH AAA . F 5 HOH 35 635 33 HOH HOH AAA . F 5 HOH 36 636 12 HOH HOH AAA . F 5 HOH 37 637 136 HOH HOH AAA . F 5 HOH 38 638 51 HOH HOH AAA . F 5 HOH 39 639 92 HOH HOH AAA . F 5 HOH 40 640 49 HOH HOH AAA . F 5 HOH 41 641 192 HOH HOH AAA . F 5 HOH 42 642 184 HOH HOH AAA . F 5 HOH 43 643 20 HOH HOH AAA . F 5 HOH 44 644 114 HOH HOH AAA . F 5 HOH 45 645 25 HOH HOH AAA . F 5 HOH 46 646 153 HOH HOH AAA . F 5 HOH 47 647 73 HOH HOH AAA . F 5 HOH 48 648 178 HOH HOH AAA . F 5 HOH 49 649 234 HOH HOH AAA . F 5 HOH 50 650 209 HOH HOH AAA . F 5 HOH 51 651 2 HOH HOH AAA . F 5 HOH 52 652 125 HOH HOH AAA . F 5 HOH 53 653 71 HOH HOH AAA . F 5 HOH 54 654 26 HOH HOH AAA . F 5 HOH 55 655 130 HOH HOH AAA . F 5 HOH 56 656 89 HOH HOH AAA . F 5 HOH 57 657 57 HOH HOH AAA . F 5 HOH 58 658 9 HOH HOH AAA . F 5 HOH 59 659 93 HOH HOH AAA . F 5 HOH 60 660 18 HOH HOH AAA . F 5 HOH 61 661 53 HOH HOH AAA . F 5 HOH 62 662 217 HOH HOH AAA . F 5 HOH 63 663 23 HOH HOH AAA . F 5 HOH 64 664 155 HOH HOH AAA . F 5 HOH 65 665 110 HOH HOH AAA . F 5 HOH 66 666 168 HOH HOH AAA . F 5 HOH 67 667 224 HOH HOH AAA . F 5 HOH 68 668 35 HOH HOH AAA . F 5 HOH 69 669 108 HOH HOH AAA . F 5 HOH 70 670 29 HOH HOH AAA . F 5 HOH 71 671 97 HOH HOH AAA . F 5 HOH 72 672 76 HOH HOH AAA . F 5 HOH 73 673 63 HOH HOH AAA . F 5 HOH 74 674 13 HOH HOH AAA . F 5 HOH 75 675 16 HOH HOH AAA . F 5 HOH 76 676 14 HOH HOH AAA . F 5 HOH 77 677 6 HOH HOH AAA . F 5 HOH 78 678 3 HOH HOH AAA . F 5 HOH 79 679 126 HOH HOH AAA . F 5 HOH 80 680 40 HOH HOH AAA . F 5 HOH 81 681 242 HOH HOH AAA . F 5 HOH 82 682 27 HOH HOH AAA . F 5 HOH 83 683 11 HOH HOH AAA . F 5 HOH 84 684 7 HOH HOH AAA . F 5 HOH 85 685 150 HOH HOH AAA . F 5 HOH 86 686 107 HOH HOH AAA . F 5 HOH 87 687 24 HOH HOH AAA . F 5 HOH 88 688 69 HOH HOH AAA . F 5 HOH 89 689 228 HOH HOH AAA . F 5 HOH 90 690 59 HOH HOH AAA . F 5 HOH 91 691 191 HOH HOH AAA . F 5 HOH 92 692 137 HOH HOH AAA . F 5 HOH 93 693 21 HOH HOH AAA . F 5 HOH 94 694 164 HOH HOH AAA . F 5 HOH 95 695 80 HOH HOH AAA . F 5 HOH 96 696 39 HOH HOH AAA . F 5 HOH 97 697 244 HOH HOH AAA . F 5 HOH 98 698 61 HOH HOH AAA . F 5 HOH 99 699 45 HOH HOH AAA . F 5 HOH 100 700 216 HOH HOH AAA . F 5 HOH 101 701 72 HOH HOH AAA . F 5 HOH 102 702 36 HOH HOH AAA . F 5 HOH 103 703 230 HOH HOH AAA . F 5 HOH 104 704 10 HOH HOH AAA . F 5 HOH 105 705 207 HOH HOH AAA . F 5 HOH 106 706 223 HOH HOH AAA . F 5 HOH 107 707 119 HOH HOH AAA . F 5 HOH 108 708 15 HOH HOH AAA . F 5 HOH 109 709 17 HOH HOH AAA . F 5 HOH 110 710 201 HOH HOH AAA . F 5 HOH 111 711 42 HOH HOH AAA . F 5 HOH 112 712 52 HOH HOH AAA . F 5 HOH 113 713 143 HOH HOH AAA . F 5 HOH 114 714 81 HOH HOH AAA . F 5 HOH 115 715 203 HOH HOH AAA . F 5 HOH 116 716 32 HOH HOH AAA . F 5 HOH 117 717 109 HOH HOH AAA . F 5 HOH 118 718 56 HOH HOH AAA . F 5 HOH 119 719 30 HOH HOH AAA . F 5 HOH 120 720 177 HOH HOH AAA . F 5 HOH 121 721 98 HOH HOH AAA . F 5 HOH 122 722 22 HOH HOH AAA . F 5 HOH 123 723 232 HOH HOH AAA . F 5 HOH 124 724 249 HOH HOH AAA . F 5 HOH 125 725 1 HOH HOH AAA . F 5 HOH 126 726 248 HOH HOH AAA . F 5 HOH 127 727 41 HOH HOH AAA . F 5 HOH 128 728 241 HOH HOH AAA . F 5 HOH 129 729 215 HOH HOH AAA . F 5 HOH 130 730 47 HOH HOH AAA . F 5 HOH 131 731 19 HOH HOH AAA . F 5 HOH 132 732 182 HOH HOH AAA . F 5 HOH 133 733 50 HOH HOH AAA . F 5 HOH 134 734 123 HOH HOH AAA . F 5 HOH 135 735 181 HOH HOH AAA . F 5 HOH 136 736 37 HOH HOH AAA . F 5 HOH 137 737 106 HOH HOH AAA . F 5 HOH 138 738 83 HOH HOH AAA . F 5 HOH 139 739 31 HOH HOH AAA . F 5 HOH 140 740 259 HOH HOH AAA . F 5 HOH 141 741 88 HOH HOH AAA . F 5 HOH 142 742 127 HOH HOH AAA . F 5 HOH 143 743 144 HOH HOH AAA . F 5 HOH 144 744 237 HOH HOH AAA . F 5 HOH 145 745 176 HOH HOH AAA . F 5 HOH 146 746 86 HOH HOH AAA . F 5 HOH 147 747 94 HOH HOH AAA . F 5 HOH 148 748 149 HOH HOH AAA . F 5 HOH 149 749 219 HOH HOH AAA . F 5 HOH 150 750 185 HOH HOH AAA . F 5 HOH 151 751 115 HOH HOH AAA . F 5 HOH 152 752 208 HOH HOH AAA . F 5 HOH 153 753 173 HOH HOH AAA . F 5 HOH 154 754 118 HOH HOH AAA . F 5 HOH 155 755 165 HOH HOH AAA . F 5 HOH 156 756 258 HOH HOH AAA . F 5 HOH 157 757 55 HOH HOH AAA . F 5 HOH 158 758 200 HOH HOH AAA . F 5 HOH 159 759 151 HOH HOH AAA . F 5 HOH 160 760 180 HOH HOH AAA . F 5 HOH 161 761 70 HOH HOH AAA . F 5 HOH 162 762 179 HOH HOH AAA . F 5 HOH 163 763 87 HOH HOH AAA . F 5 HOH 164 764 54 HOH HOH AAA . F 5 HOH 165 765 135 HOH HOH AAA . F 5 HOH 166 766 152 HOH HOH AAA . F 5 HOH 167 767 231 HOH HOH AAA . F 5 HOH 168 768 79 HOH HOH AAA . F 5 HOH 169 769 95 HOH HOH AAA . F 5 HOH 170 770 195 HOH HOH AAA . F 5 HOH 171 771 96 HOH HOH AAA . F 5 HOH 172 772 91 HOH HOH AAA . F 5 HOH 173 773 166 HOH HOH AAA . F 5 HOH 174 774 58 HOH HOH AAA . F 5 HOH 175 775 194 HOH HOH AAA . F 5 HOH 176 776 68 HOH HOH AAA . F 5 HOH 177 777 247 HOH HOH AAA . F 5 HOH 178 778 46 HOH HOH AAA . F 5 HOH 179 779 170 HOH HOH AAA . F 5 HOH 180 780 251 HOH HOH AAA . F 5 HOH 181 781 117 HOH HOH AAA . F 5 HOH 182 782 204 HOH HOH AAA . F 5 HOH 183 783 197 HOH HOH AAA . F 5 HOH 184 784 213 HOH HOH AAA . F 5 HOH 185 785 34 HOH HOH AAA . F 5 HOH 186 786 159 HOH HOH AAA . F 5 HOH 187 787 253 HOH HOH AAA . F 5 HOH 188 788 174 HOH HOH AAA . F 5 HOH 189 789 218 HOH HOH AAA . F 5 HOH 190 790 134 HOH HOH AAA . F 5 HOH 191 791 146 HOH HOH AAA . F 5 HOH 192 792 85 HOH HOH AAA . F 5 HOH 193 793 211 HOH HOH AAA . F 5 HOH 194 794 142 HOH HOH AAA . F 5 HOH 195 795 99 HOH HOH AAA . F 5 HOH 196 796 133 HOH HOH AAA . F 5 HOH 197 797 167 HOH HOH AAA . F 5 HOH 198 798 64 HOH HOH AAA . F 5 HOH 199 799 104 HOH HOH AAA . F 5 HOH 200 800 124 HOH HOH AAA . F 5 HOH 201 801 210 HOH HOH AAA . F 5 HOH 202 802 147 HOH HOH AAA . F 5 HOH 203 803 196 HOH HOH AAA . F 5 HOH 204 804 243 HOH HOH AAA . F 5 HOH 205 805 206 HOH HOH AAA . F 5 HOH 206 806 112 HOH HOH AAA . F 5 HOH 207 807 100 HOH HOH AAA . F 5 HOH 208 808 121 HOH HOH AAA . F 5 HOH 209 809 161 HOH HOH AAA . F 5 HOH 210 810 157 HOH HOH AAA . F 5 HOH 211 811 238 HOH HOH AAA . F 5 HOH 212 812 202 HOH HOH AAA . F 5 HOH 213 813 138 HOH HOH AAA . F 5 HOH 214 814 212 HOH HOH AAA . F 5 HOH 215 815 122 HOH HOH AAA . F 5 HOH 216 816 74 HOH HOH AAA . F 5 HOH 217 817 254 HOH HOH AAA . F 5 HOH 218 818 227 HOH HOH AAA . F 5 HOH 219 819 90 HOH HOH AAA . F 5 HOH 220 820 256 HOH HOH AAA . F 5 HOH 221 821 116 HOH HOH AAA . F 5 HOH 222 822 148 HOH HOH AAA . F 5 HOH 223 823 84 HOH HOH AAA . F 5 HOH 224 824 175 HOH HOH AAA . F 5 HOH 225 825 103 HOH HOH AAA . F 5 HOH 226 826 221 HOH HOH AAA . F 5 HOH 227 827 132 HOH HOH AAA . F 5 HOH 228 828 239 HOH HOH AAA . F 5 HOH 229 829 145 HOH HOH AAA . F 5 HOH 230 830 225 HOH HOH AAA . F 5 HOH 231 831 162 HOH HOH AAA . F 5 HOH 232 832 255 HOH HOH AAA . F 5 HOH 233 833 163 HOH HOH AAA . F 5 HOH 234 834 154 HOH HOH AAA . F 5 HOH 235 835 199 HOH HOH AAA . F 5 HOH 236 836 140 HOH HOH AAA . F 5 HOH 237 837 113 HOH HOH AAA . F 5 HOH 238 838 77 HOH HOH AAA . F 5 HOH 239 839 193 HOH HOH AAA . F 5 HOH 240 840 139 HOH HOH AAA . F 5 HOH 241 841 245 HOH HOH AAA . F 5 HOH 242 842 128 HOH HOH AAA . F 5 HOH 243 843 169 HOH HOH AAA . F 5 HOH 244 844 226 HOH HOH AAA . F 5 HOH 245 845 187 HOH HOH AAA . F 5 HOH 246 846 160 HOH HOH AAA . F 5 HOH 247 847 189 HOH HOH AAA . F 5 HOH 248 848 141 HOH HOH AAA . F 5 HOH 249 849 158 HOH HOH AAA . F 5 HOH 250 850 220 HOH HOH AAA . F 5 HOH 251 851 250 HOH HOH AAA . F 5 HOH 252 852 156 HOH HOH AAA . F 5 HOH 253 853 102 HOH HOH AAA . F 5 HOH 254 854 240 HOH HOH AAA . F 5 HOH 255 855 129 HOH HOH AAA . F 5 HOH 256 856 252 HOH HOH AAA . F 5 HOH 257 857 236 HOH HOH AAA . F 5 HOH 258 858 214 HOH HOH AAA . F 5 HOH 259 859 171 HOH HOH AAA . F 5 HOH 260 860 222 HOH HOH AAA . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 AAA LYS 345 ? CG ? A LYS 5 CG 2 1 Y 1 AAA LYS 345 ? CD ? A LYS 5 CD 3 1 Y 1 AAA LYS 345 ? CE ? A LYS 5 CE 4 1 Y 1 AAA LYS 345 ? NZ ? A LYS 5 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8B5G _cell.details ? _cell.formula_units_Z ? _cell.length_a 71.906 _cell.length_a_esd ? _cell.length_b 52.421 _cell.length_b_esd ? _cell.length_c 32.086 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8B5G _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8B5G _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.25 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.36 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG 300, 0.1M MES buffer pH6.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU SATURN A200' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-11-21 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-E SUPERBRIGHT' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54178 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8B5G _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.619 _reflns.d_resolution_low 71.39 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15360 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.5 _reflns.pdbx_Rmerge_I_obs 0.013 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 52.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 1.619 _reflns_shell.d_res_low 1.71 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 22.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1928 _reflns_shell.percent_possible_all 85.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.031 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.094 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -0.051 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -0.043 _refine.B_iso_max ? _refine.B_iso_mean 13.384 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.961 _refine.correlation_coeff_Fo_to_Fc_free 0.940 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8B5G _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.619 _refine.ls_d_res_low 21.808 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15248 _refine.ls_number_reflns_R_free 758 _refine.ls_number_reflns_R_work 14490 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.938 _refine.ls_percent_reflns_R_free 4.971 _refine.ls_R_factor_all 0.150 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.1827 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1483 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL PLUS MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'In house' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.090 _refine.pdbx_overall_ESU_R_Free 0.090 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.552 _refine.overall_SU_ML 0.048 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 915 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 37 _refine_hist.number_atoms_solvent 260 _refine_hist.number_atoms_total 1212 _refine_hist.d_res_high 1.619 _refine_hist.d_res_low 21.808 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 0.013 1024 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.015 959 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.230 1.654 1382 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.350 1.618 2220 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.939 5.000 120 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.061 21.754 57 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.322 15.000 180 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.736 15.000 7 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.068 0.200 118 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 1148 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 238 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.206 0.200 234 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.166 0.200 817 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.173 0.200 502 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.078 0.200 346 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.107 0.200 161 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.147 0.200 8 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.130 0.200 46 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.095 0.200 42 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.694 1.255 468 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 0.668 1.248 467 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.211 2.807 592 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.213 2.818 593 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 0.985 1.491 556 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 0.985 1.484 554 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 1.663 3.231 790 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 1.662 3.236 791 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.005 14.625 1322 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 5.003 14.639 1323 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.619 1.661 . . 50 843 76.1945 . . . 0.187 . 0.164 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.661 1.706 . . 47 976 92.4119 . . . 0.234 . 0.159 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.706 1.756 . . 38 1039 97.0270 . . . 0.184 . 0.145 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.756 1.809 . . 64 967 97.9107 . . . 0.176 . 0.148 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.809 1.868 . . 39 994 98.9464 . . . 0.224 . 0.151 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.868 1.933 . . 57 944 98.9130 . . . 0.206 . 0.149 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.933 2.006 . . 44 928 98.9817 . . . 0.151 . 0.140 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.006 2.087 . . 49 854 99.0132 . . . 0.176 . 0.135 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.087 2.179 . . 50 869 98.8172 . . . 0.145 . 0.138 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.179 2.285 . . 48 802 98.1524 . . . 0.166 . 0.131 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.285 2.407 . . 37 769 97.9344 . . . 0.146 . 0.130 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.407 2.552 . . 35 729 97.9487 . . . 0.167 . 0.148 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.552 2.726 . . 33 683 97.1506 . . . 0.204 . 0.147 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.726 2.941 . . 40 636 96.0227 . . . 0.221 . 0.159 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.941 3.217 . . 40 582 96.5838 . . . 0.183 . 0.152 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.217 3.590 . . 23 537 94.7547 . . . 0.195 . 0.148 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.590 4.130 . . 18 459 91.7308 . . . 0.162 . 0.141 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.130 5.023 . . 22 397 92.0879 . . . 0.194 . 0.154 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.023 6.961 . . 15 309 87.0968 . . . 0.182 . 0.193 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.961 21.626 . . 9 173 76.1506 . . . 0.233 . 0.195 . . . . . . . . . . . # _struct.entry_id 8B5G _struct.title 'C-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 7,8-dimethoxy-3-methyl-1,3-dihydro-2H-benzo[d]azepin-2-one' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8B5G _struct_keywords.text 'INHIBITOR COMPLEX BROMODOMAIN, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BRD2_HUMAN _struct_ref.pdbx_db_accession P25440 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFS NCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD ; _struct_ref.pdbx_align_begin 344 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8B5G _struct_ref_seq.pdbx_strand_id AAA _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 115 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P25440 _struct_ref_seq.db_align_beg 344 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 455 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 344 _struct_ref_seq.pdbx_auth_seq_align_end 455 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8B5G GLY AAA 1 ? UNP P25440 ? ? 'expression tag' 341 1 1 8B5G SER AAA 2 ? UNP P25440 ? ? 'expression tag' 342 2 1 8B5G MET AAA 3 ? UNP P25440 ? ? 'expression tag' 343 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 470 ? 1 MORE 6 ? 1 'SSA (A^2)' 6820 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 7 ? LEU A 21 ? SER AAA 347 LEU AAA 361 1 ? 15 HELX_P HELX_P2 AA2 SER A 22 ? LYS A 24 ? SER AAA 362 LYS AAA 364 5 ? 3 HELX_P HELX_P3 AA3 HIS A 25 ? TRP A 30 ? HIS AAA 365 TRP AAA 370 1 ? 6 HELX_P HELX_P4 AA4 PRO A 31 ? TYR A 33 ? PRO AAA 371 TYR AAA 373 5 ? 3 HELX_P HELX_P5 AA5 ASP A 37 ? GLY A 42 ? ASP AAA 377 GLY AAA 382 1 ? 6 HELX_P HELX_P6 AA6 ASP A 45 ? ILE A 50 ? ASP AAA 385 ILE AAA 390 1 ? 6 HELX_P HELX_P7 AA7 ASP A 55 ? ASN A 65 ? ASP AAA 395 ASN AAA 405 1 ? 11 HELX_P HELX_P8 AA8 ASP A 70 ? ASN A 89 ? ASP AAA 410 ASN AAA 429 1 ? 20 HELX_P HELX_P9 AA9 HIS A 93 ? ALA A 111 ? HIS AAA 433 ALA AAA 451 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 AAA _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 732 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 AAA _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 732 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_655 _pdbx_validate_symm_contact.dist 1.79 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 AAA HOH 805 ? F HOH . 2 1 AAA HOH 857 ? F HOH . # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 32.9867 _pdbx_refine_tls.origin_y 10.2494 _pdbx_refine_tls.origin_z 0.8053 _pdbx_refine_tls.T[1][1] 0.0030 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0003 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0025 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0010 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0008 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0034 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.9741 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.1047 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.2110 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.1724 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.0620 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.1009 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0151 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0032 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0115 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0034 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0084 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0002 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0089 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0017 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0067 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id AAA _pdbx_refine_tls_group.beg_auth_seq_id 345 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id AAA _pdbx_refine_tls_group.end_auth_seq_id 455 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ALL _pdbx_refine_tls_group.selection_details ? # _pdbx_entry_details.entry_id 8B5G _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? AAA HOH 856 ? 5.96 . 2 1 O ? AAA HOH 857 ? 5.98 . 3 1 O ? AAA HOH 858 ? 6.33 . 4 1 O ? AAA HOH 859 ? 7.18 . 5 1 O ? AAA HOH 860 ? 7.67 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA GLY 341 ? A GLY 1 2 1 Y 1 AAA SER 342 ? A SER 2 3 1 Y 1 AAA MET 343 ? A MET 3 4 1 Y 1 AAA GLY 344 ? A GLY 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MES O1 O N N 240 MES C2 C N N 241 MES C3 C N N 242 MES N4 N N N 243 MES C5 C N N 244 MES C6 C N N 245 MES C7 C N N 246 MES C8 C N N 247 MES S S N N 248 MES O1S O N N 249 MES O2S O N N 250 MES O3S O N N 251 MES H21 H N N 252 MES H22 H N N 253 MES H31 H N N 254 MES H32 H N N 255 MES HN4 H N N 256 MES H51 H N N 257 MES H52 H N N 258 MES H61 H N N 259 MES H62 H N N 260 MES H71 H N N 261 MES H72 H N N 262 MES H81 H N N 263 MES H82 H N N 264 MET N N N N 265 MET CA C N S 266 MET C C N N 267 MET O O N N 268 MET CB C N N 269 MET CG C N N 270 MET SD S N N 271 MET CE C N N 272 MET OXT O N N 273 MET H H N N 274 MET H2 H N N 275 MET HA H N N 276 MET HB2 H N N 277 MET HB3 H N N 278 MET HG2 H N N 279 MET HG3 H N N 280 MET HE1 H N N 281 MET HE2 H N N 282 MET HE3 H N N 283 MET HXT H N N 284 P4M C10 C N N 285 P4M C13 C N N 286 P4M C20 C N N 287 P4M C22 C N N 288 P4M C24 C Y N 289 P4M C01 C N N 290 P4M O05 O N N 291 P4M C06 C Y N 292 P4M C07 C Y N 293 P4M C09 C Y N 294 P4M O14 O N N 295 P4M N15 N N N 296 P4M C16 C N N 297 P4M C25 C Y N 298 P4M C27 C Y N 299 P4M O28 O N N 300 P4M C29 C N N 301 P4M H1 H N N 302 P4M H2 H N N 303 P4M H3 H N N 304 P4M H4 H N N 305 P4M H5 H N N 306 P4M H6 H N N 307 P4M H7 H N N 308 P4M H8 H N N 309 P4M H9 H N N 310 P4M H10 H N N 311 P4M H11 H N N 312 P4M H12 H N N 313 P4M H13 H N N 314 P4M H14 H N N 315 P4M H15 H N N 316 PHE N N N N 317 PHE CA C N S 318 PHE C C N N 319 PHE O O N N 320 PHE CB C N N 321 PHE CG C Y N 322 PHE CD1 C Y N 323 PHE CD2 C Y N 324 PHE CE1 C Y N 325 PHE CE2 C Y N 326 PHE CZ C Y N 327 PHE OXT O N N 328 PHE H H N N 329 PHE H2 H N N 330 PHE HA H N N 331 PHE HB2 H N N 332 PHE HB3 H N N 333 PHE HD1 H N N 334 PHE HD2 H N N 335 PHE HE1 H N N 336 PHE HE2 H N N 337 PHE HZ H N N 338 PHE HXT H N N 339 PRO N N N N 340 PRO CA C N S 341 PRO C C N N 342 PRO O O N N 343 PRO CB C N N 344 PRO CG C N N 345 PRO CD C N N 346 PRO OXT O N N 347 PRO H H N N 348 PRO HA H N N 349 PRO HB2 H N N 350 PRO HB3 H N N 351 PRO HG2 H N N 352 PRO HG3 H N N 353 PRO HD2 H N N 354 PRO HD3 H N N 355 PRO HXT H N N 356 SER N N N N 357 SER CA C N S 358 SER C C N N 359 SER O O N N 360 SER CB C N N 361 SER OG O N N 362 SER OXT O N N 363 SER H H N N 364 SER H2 H N N 365 SER HA H N N 366 SER HB2 H N N 367 SER HB3 H N N 368 SER HG H N N 369 SER HXT H N N 370 THR N N N N 371 THR CA C N S 372 THR C C N N 373 THR O O N N 374 THR CB C N R 375 THR OG1 O N N 376 THR CG2 C N N 377 THR OXT O N N 378 THR H H N N 379 THR H2 H N N 380 THR HA H N N 381 THR HB H N N 382 THR HG1 H N N 383 THR HG21 H N N 384 THR HG22 H N N 385 THR HG23 H N N 386 THR HXT H N N 387 TRP N N N N 388 TRP CA C N S 389 TRP C C N N 390 TRP O O N N 391 TRP CB C N N 392 TRP CG C Y N 393 TRP CD1 C Y N 394 TRP CD2 C Y N 395 TRP NE1 N Y N 396 TRP CE2 C Y N 397 TRP CE3 C Y N 398 TRP CZ2 C Y N 399 TRP CZ3 C Y N 400 TRP CH2 C Y N 401 TRP OXT O N N 402 TRP H H N N 403 TRP H2 H N N 404 TRP HA H N N 405 TRP HB2 H N N 406 TRP HB3 H N N 407 TRP HD1 H N N 408 TRP HE1 H N N 409 TRP HE3 H N N 410 TRP HZ2 H N N 411 TRP HZ3 H N N 412 TRP HH2 H N N 413 TRP HXT H N N 414 TYR N N N N 415 TYR CA C N S 416 TYR C C N N 417 TYR O O N N 418 TYR CB C N N 419 TYR CG C Y N 420 TYR CD1 C Y N 421 TYR CD2 C Y N 422 TYR CE1 C Y N 423 TYR CE2 C Y N 424 TYR CZ C Y N 425 TYR OH O N N 426 TYR OXT O N N 427 TYR H H N N 428 TYR H2 H N N 429 TYR HA H N N 430 TYR HB2 H N N 431 TYR HB3 H N N 432 TYR HD1 H N N 433 TYR HD2 H N N 434 TYR HE1 H N N 435 TYR HE2 H N N 436 TYR HH H N N 437 TYR HXT H N N 438 VAL N N N N 439 VAL CA C N S 440 VAL C C N N 441 VAL O O N N 442 VAL CB C N N 443 VAL CG1 C N N 444 VAL CG2 C N N 445 VAL OXT O N N 446 VAL H H N N 447 VAL H2 H N N 448 VAL HA H N N 449 VAL HB H N N 450 VAL HG11 H N N 451 VAL HG12 H N N 452 VAL HG13 H N N 453 VAL HG21 H N N 454 VAL HG22 H N N 455 VAL HG23 H N N 456 VAL HXT H N N 457 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MES O1 C2 sing N N 227 MES O1 C6 sing N N 228 MES C2 C3 sing N N 229 MES C2 H21 sing N N 230 MES C2 H22 sing N N 231 MES C3 N4 sing N N 232 MES C3 H31 sing N N 233 MES C3 H32 sing N N 234 MES N4 C5 sing N N 235 MES N4 C7 sing N N 236 MES N4 HN4 sing N N 237 MES C5 C6 sing N N 238 MES C5 H51 sing N N 239 MES C5 H52 sing N N 240 MES C6 H61 sing N N 241 MES C6 H62 sing N N 242 MES C7 C8 sing N N 243 MES C7 H71 sing N N 244 MES C7 H72 sing N N 245 MES C8 S sing N N 246 MES C8 H81 sing N N 247 MES C8 H82 sing N N 248 MES S O1S doub N N 249 MES S O2S doub N N 250 MES S O3S sing N N 251 MET N CA sing N N 252 MET N H sing N N 253 MET N H2 sing N N 254 MET CA C sing N N 255 MET CA CB sing N N 256 MET CA HA sing N N 257 MET C O doub N N 258 MET C OXT sing N N 259 MET CB CG sing N N 260 MET CB HB2 sing N N 261 MET CB HB3 sing N N 262 MET CG SD sing N N 263 MET CG HG2 sing N N 264 MET CG HG3 sing N N 265 MET SD CE sing N N 266 MET CE HE1 sing N N 267 MET CE HE2 sing N N 268 MET CE HE3 sing N N 269 MET OXT HXT sing N N 270 P4M C16 N15 sing N N 271 P4M O14 C13 doub N N 272 P4M N15 C13 sing N N 273 P4M N15 C20 sing N N 274 P4M C13 C10 sing N N 275 P4M C20 C22 doub N N 276 P4M C10 C09 sing N N 277 P4M C22 C24 sing N N 278 P4M C09 C24 doub Y N 279 P4M C09 C07 sing Y N 280 P4M C24 C25 sing Y N 281 P4M C07 C06 doub Y N 282 P4M C25 C27 doub Y N 283 P4M C06 C27 sing Y N 284 P4M C06 O05 sing N N 285 P4M C27 O28 sing N N 286 P4M C01 O05 sing N N 287 P4M O28 C29 sing N N 288 P4M C10 H1 sing N N 289 P4M C10 H2 sing N N 290 P4M C20 H3 sing N N 291 P4M C22 H4 sing N N 292 P4M C01 H5 sing N N 293 P4M C01 H6 sing N N 294 P4M C01 H7 sing N N 295 P4M C07 H8 sing N N 296 P4M C16 H9 sing N N 297 P4M C16 H10 sing N N 298 P4M C16 H11 sing N N 299 P4M C25 H12 sing N N 300 P4M C29 H13 sing N N 301 P4M C29 H14 sing N N 302 P4M C29 H15 sing N N 303 PHE N CA sing N N 304 PHE N H sing N N 305 PHE N H2 sing N N 306 PHE CA C sing N N 307 PHE CA CB sing N N 308 PHE CA HA sing N N 309 PHE C O doub N N 310 PHE C OXT sing N N 311 PHE CB CG sing N N 312 PHE CB HB2 sing N N 313 PHE CB HB3 sing N N 314 PHE CG CD1 doub Y N 315 PHE CG CD2 sing Y N 316 PHE CD1 CE1 sing Y N 317 PHE CD1 HD1 sing N N 318 PHE CD2 CE2 doub Y N 319 PHE CD2 HD2 sing N N 320 PHE CE1 CZ doub Y N 321 PHE CE1 HE1 sing N N 322 PHE CE2 CZ sing Y N 323 PHE CE2 HE2 sing N N 324 PHE CZ HZ sing N N 325 PHE OXT HXT sing N N 326 PRO N CA sing N N 327 PRO N CD sing N N 328 PRO N H sing N N 329 PRO CA C sing N N 330 PRO CA CB sing N N 331 PRO CA HA sing N N 332 PRO C O doub N N 333 PRO C OXT sing N N 334 PRO CB CG sing N N 335 PRO CB HB2 sing N N 336 PRO CB HB3 sing N N 337 PRO CG CD sing N N 338 PRO CG HG2 sing N N 339 PRO CG HG3 sing N N 340 PRO CD HD2 sing N N 341 PRO CD HD3 sing N N 342 PRO OXT HXT sing N N 343 SER N CA sing N N 344 SER N H sing N N 345 SER N H2 sing N N 346 SER CA C sing N N 347 SER CA CB sing N N 348 SER CA HA sing N N 349 SER C O doub N N 350 SER C OXT sing N N 351 SER CB OG sing N N 352 SER CB HB2 sing N N 353 SER CB HB3 sing N N 354 SER OG HG sing N N 355 SER OXT HXT sing N N 356 THR N CA sing N N 357 THR N H sing N N 358 THR N H2 sing N N 359 THR CA C sing N N 360 THR CA CB sing N N 361 THR CA HA sing N N 362 THR C O doub N N 363 THR C OXT sing N N 364 THR CB OG1 sing N N 365 THR CB CG2 sing N N 366 THR CB HB sing N N 367 THR OG1 HG1 sing N N 368 THR CG2 HG21 sing N N 369 THR CG2 HG22 sing N N 370 THR CG2 HG23 sing N N 371 THR OXT HXT sing N N 372 TRP N CA sing N N 373 TRP N H sing N N 374 TRP N H2 sing N N 375 TRP CA C sing N N 376 TRP CA CB sing N N 377 TRP CA HA sing N N 378 TRP C O doub N N 379 TRP C OXT sing N N 380 TRP CB CG sing N N 381 TRP CB HB2 sing N N 382 TRP CB HB3 sing N N 383 TRP CG CD1 doub Y N 384 TRP CG CD2 sing Y N 385 TRP CD1 NE1 sing Y N 386 TRP CD1 HD1 sing N N 387 TRP CD2 CE2 doub Y N 388 TRP CD2 CE3 sing Y N 389 TRP NE1 CE2 sing Y N 390 TRP NE1 HE1 sing N N 391 TRP CE2 CZ2 sing Y N 392 TRP CE3 CZ3 doub Y N 393 TRP CE3 HE3 sing N N 394 TRP CZ2 CH2 doub Y N 395 TRP CZ2 HZ2 sing N N 396 TRP CZ3 CH2 sing Y N 397 TRP CZ3 HZ3 sing N N 398 TRP CH2 HH2 sing N N 399 TRP OXT HXT sing N N 400 TYR N CA sing N N 401 TYR N H sing N N 402 TYR N H2 sing N N 403 TYR CA C sing N N 404 TYR CA CB sing N N 405 TYR CA HA sing N N 406 TYR C O doub N N 407 TYR C OXT sing N N 408 TYR CB CG sing N N 409 TYR CB HB2 sing N N 410 TYR CB HB3 sing N N 411 TYR CG CD1 doub Y N 412 TYR CG CD2 sing Y N 413 TYR CD1 CE1 sing Y N 414 TYR CD1 HD1 sing N N 415 TYR CD2 CE2 doub Y N 416 TYR CD2 HD2 sing N N 417 TYR CE1 CZ doub Y N 418 TYR CE1 HE1 sing N N 419 TYR CE2 CZ sing Y N 420 TYR CE2 HE2 sing N N 421 TYR CZ OH sing N N 422 TYR OH HH sing N N 423 TYR OXT HXT sing N N 424 VAL N CA sing N N 425 VAL N H sing N N 426 VAL N H2 sing N N 427 VAL CA C sing N N 428 VAL CA CB sing N N 429 VAL CA HA sing N N 430 VAL C O doub N N 431 VAL C OXT sing N N 432 VAL CB CG1 sing N N 433 VAL CB CG2 sing N N 434 VAL CB HB sing N N 435 VAL CG1 HG11 sing N N 436 VAL CG1 HG12 sing N N 437 VAL CG1 HG13 sing N N 438 VAL CG2 HG21 sing N N 439 VAL CG2 HG22 sing N N 440 VAL CG2 HG23 sing N N 441 VAL OXT HXT sing N N 442 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id P4M _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id P4M _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details 'In house' # _atom_sites.entry_id 8B5G _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013907 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019076 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.031166 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.184 # loop_