data_8B6N # _entry.id 8B6N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8B6N pdb_00008b6n 10.2210/pdb8b6n/pdb WWPDB D_1292125777 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-10-11 2 'Structure model' 1 1 2024-02-14 3 'Structure model' 1 2 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 3 'Structure model' '_citation.pdbx_database_id_PubMed' 13 3 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8B6N _pdbx_database_status.recvd_initial_deposition_date 2022-09-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 8B6O unspecified PDB . 8B6P unspecified PDB . 8B6Q unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email kjohnsson@mr.mpg.de _pdbx_contact_author.name_first Kai _pdbx_contact_author.name_last Johnsson _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8002-1981 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tarnawski, M.' 1 ? 'Johnsson, K.' 2 ? 'Hiblot, J.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 383 _citation.language ? _citation.page_first 890 _citation.page_last 897 _citation.title 'Recording physiological history of cells with chemical labeling.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.adg0812 _citation.pdbx_database_id_PubMed 38386755 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huppertz, M.C.' 1 ? primary 'Wilhelm, J.' 2 ? primary 'Grenier, V.' 3 ? primary 'Schneider, M.W.' 4 ? primary 'Falt, T.' 5 ? primary 'Porzberg, N.' 6 ? primary 'Hausmann, D.' 7 ? primary 'Hoffmann, D.C.' 8 ? primary 'Hai, L.' 9 ? primary 'Tarnawski, M.' 10 ? primary 'Pino, G.' 11 ? primary 'Slanchev, K.' 12 ? primary 'Kolb, I.' 13 ? primary 'Acuna, C.' 14 ? primary 'Fenk, L.M.' 15 ? primary 'Baier, H.' 16 ? primary 'Hiblot, J.' 17 ? primary 'Johnsson, K.' 18 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Haloalkane dehalogenase' 32575.094 1 3.8.1.5 ? ? ? 2 non-polymer syn '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID' 207.290 1 ? ? ? ? 3 water nat water 18.015 13 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GDVGRKLIIDQNVFIEGTLPMGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMDWLHQSPV PKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARWLSTLEIGGTGGSGGTGGSGGSIGTG FPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRCIAPDLIGMGKSDKPDLGYFFDDHVRF MDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIAFMEFIRPIPTWDEW ; _entity_poly.pdbx_seq_one_letter_code_can ;GDVGRKLIIDQNVFIEGTLPMGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMDWLHQSPV PKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARWLSTLEIGGTGGSGGTGGSGGSIGTG FPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRCIAPDLIGMGKSDKPDLGYFFDDHVRF MDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIAFMEFIRPIPTWDEW ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID' NHE 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASP n 1 3 VAL n 1 4 GLY n 1 5 ARG n 1 6 LYS n 1 7 LEU n 1 8 ILE n 1 9 ILE n 1 10 ASP n 1 11 GLN n 1 12 ASN n 1 13 VAL n 1 14 PHE n 1 15 ILE n 1 16 GLU n 1 17 GLY n 1 18 THR n 1 19 LEU n 1 20 PRO n 1 21 MET n 1 22 GLY n 1 23 VAL n 1 24 VAL n 1 25 ARG n 1 26 PRO n 1 27 LEU n 1 28 THR n 1 29 GLU n 1 30 VAL n 1 31 GLU n 1 32 MET n 1 33 ASP n 1 34 HIS n 1 35 TYR n 1 36 ARG n 1 37 GLU n 1 38 PRO n 1 39 PHE n 1 40 LEU n 1 41 ASN n 1 42 PRO n 1 43 VAL n 1 44 ASP n 1 45 ARG n 1 46 GLU n 1 47 PRO n 1 48 LEU n 1 49 TRP n 1 50 ARG n 1 51 PHE n 1 52 PRO n 1 53 ASN n 1 54 GLU n 1 55 LEU n 1 56 PRO n 1 57 ILE n 1 58 ALA n 1 59 GLY n 1 60 GLU n 1 61 PRO n 1 62 ALA n 1 63 ASN n 1 64 ILE n 1 65 VAL n 1 66 ALA n 1 67 LEU n 1 68 VAL n 1 69 GLU n 1 70 GLU n 1 71 TYR n 1 72 MET n 1 73 ASP n 1 74 TRP n 1 75 LEU n 1 76 HIS n 1 77 GLN n 1 78 SER n 1 79 PRO n 1 80 VAL n 1 81 PRO n 1 82 LYS n 1 83 LEU n 1 84 LEU n 1 85 PHE n 1 86 TRP n 1 87 GLY n 1 88 THR n 1 89 PRO n 1 90 GLY n 1 91 VAL n 1 92 LEU n 1 93 ILE n 1 94 PRO n 1 95 PRO n 1 96 ALA n 1 97 GLU n 1 98 ALA n 1 99 ALA n 1 100 ARG n 1 101 LEU n 1 102 ALA n 1 103 LYS n 1 104 SER n 1 105 LEU n 1 106 PRO n 1 107 ASN n 1 108 CYS n 1 109 LYS n 1 110 ALA n 1 111 VAL n 1 112 ASP n 1 113 ILE n 1 114 GLY n 1 115 PRO n 1 116 GLY n 1 117 LEU n 1 118 ASN n 1 119 LEU n 1 120 LEU n 1 121 GLN n 1 122 GLU n 1 123 ASP n 1 124 ASN n 1 125 PRO n 1 126 ASP n 1 127 LEU n 1 128 ILE n 1 129 GLY n 1 130 SER n 1 131 GLU n 1 132 ILE n 1 133 ALA n 1 134 ARG n 1 135 TRP n 1 136 LEU n 1 137 SER n 1 138 THR n 1 139 LEU n 1 140 GLU n 1 141 ILE n 1 142 GLY n 1 143 GLY n 1 144 THR n 1 145 GLY n 1 146 GLY n 1 147 SER n 1 148 GLY n 1 149 GLY n 1 150 THR n 1 151 GLY n 1 152 GLY n 1 153 SER n 1 154 GLY n 1 155 GLY n 1 156 SER n 1 157 ILE n 1 158 GLY n 1 159 THR n 1 160 GLY n 1 161 PHE n 1 162 PRO n 1 163 PHE n 1 164 ASP n 1 165 PRO n 1 166 HIS n 1 167 TYR n 1 168 VAL n 1 169 GLU n 1 170 VAL n 1 171 LEU n 1 172 GLY n 1 173 GLU n 1 174 ARG n 1 175 MET n 1 176 HIS n 1 177 TYR n 1 178 VAL n 1 179 ASP n 1 180 VAL n 1 181 GLY n 1 182 PRO n 1 183 ARG n 1 184 ASP n 1 185 GLY n 1 186 THR n 1 187 PRO n 1 188 VAL n 1 189 LEU n 1 190 PHE n 1 191 LEU n 1 192 HIS n 1 193 GLY n 1 194 ASN n 1 195 PRO n 1 196 THR n 1 197 SER n 1 198 SER n 1 199 TYR n 1 200 VAL n 1 201 TRP n 1 202 ARG n 1 203 ASN n 1 204 ILE n 1 205 ILE n 1 206 PRO n 1 207 HIS n 1 208 VAL n 1 209 ALA n 1 210 PRO n 1 211 THR n 1 212 HIS n 1 213 ARG n 1 214 CYS n 1 215 ILE n 1 216 ALA n 1 217 PRO n 1 218 ASP n 1 219 LEU n 1 220 ILE n 1 221 GLY n 1 222 MET n 1 223 GLY n 1 224 LYS n 1 225 SER n 1 226 ASP n 1 227 LYS n 1 228 PRO n 1 229 ASP n 1 230 LEU n 1 231 GLY n 1 232 TYR n 1 233 PHE n 1 234 PHE n 1 235 ASP n 1 236 ASP n 1 237 HIS n 1 238 VAL n 1 239 ARG n 1 240 PHE n 1 241 MET n 1 242 ASP n 1 243 ALA n 1 244 PHE n 1 245 ILE n 1 246 GLU n 1 247 ALA n 1 248 LEU n 1 249 GLY n 1 250 LEU n 1 251 GLU n 1 252 GLU n 1 253 VAL n 1 254 VAL n 1 255 LEU n 1 256 VAL n 1 257 ILE n 1 258 HIS n 1 259 ASP n 1 260 TRP n 1 261 GLY n 1 262 SER n 1 263 ALA n 1 264 LEU n 1 265 GLY n 1 266 PHE n 1 267 HIS n 1 268 TRP n 1 269 ALA n 1 270 LYS n 1 271 ARG n 1 272 ASN n 1 273 PRO n 1 274 GLU n 1 275 ARG n 1 276 VAL n 1 277 LYS n 1 278 GLY n 1 279 ILE n 1 280 ALA n 1 281 PHE n 1 282 MET n 1 283 GLU n 1 284 PHE n 1 285 ILE n 1 286 ARG n 1 287 PRO n 1 288 ILE n 1 289 PRO n 1 290 THR n 1 291 TRP n 1 292 ASP n 1 293 GLU n 1 294 TRP n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 156 ? ? dhaA ? ? ? ? ? ? 'Rhodococcus sp.' 1831 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 157 294 ? ? dhaA ? ? ? ? ? ? 'Rhodococcus sp.' 1831 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NHE non-polymer . '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID' 'N-CYCLOHEXYLTAURINE; CHES' 'C8 H17 N O3 S' 207.290 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 TRP 74 74 74 TRP TRP A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 CYS 108 108 108 CYS CYS A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 TRP 135 135 135 TRP TRP A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 GLU 140 140 ? ? ? A . n A 1 141 ILE 141 141 ? ? ? A . n A 1 142 GLY 142 142 ? ? ? A . n A 1 143 GLY 143 143 ? ? ? A . n A 1 144 THR 144 144 ? ? ? A . n A 1 145 GLY 145 145 ? ? ? A . n A 1 146 GLY 146 146 ? ? ? A . n A 1 147 SER 147 147 ? ? ? A . n A 1 148 GLY 148 148 ? ? ? A . n A 1 149 GLY 149 149 ? ? ? A . n A 1 150 THR 150 150 ? ? ? A . n A 1 151 GLY 151 151 ? ? ? A . n A 1 152 GLY 152 152 ? ? ? A . n A 1 153 SER 153 153 ? ? ? A . n A 1 154 GLY 154 154 ? ? ? A . n A 1 155 GLY 155 155 ? ? ? A . n A 1 156 SER 156 156 ? ? ? A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 PHE 163 163 163 PHE PHE A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 HIS 166 166 166 HIS HIS A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 ARG 174 174 174 ARG ARG A . n A 1 175 MET 175 175 175 MET MET A . n A 1 176 HIS 176 176 176 HIS HIS A . n A 1 177 TYR 177 177 177 TYR TYR A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 ASP 184 184 184 ASP ASP A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 PHE 190 190 190 PHE PHE A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 HIS 192 192 192 HIS HIS A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 ASN 194 194 194 ASN ASN A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 THR 196 196 196 THR THR A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 TYR 199 199 199 TYR TYR A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 TRP 201 201 201 TRP TRP A . n A 1 202 ARG 202 202 202 ARG ARG A . n A 1 203 ASN 203 203 203 ASN ASN A . n A 1 204 ILE 204 204 204 ILE ILE A . n A 1 205 ILE 205 205 205 ILE ILE A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 PRO 210 210 210 PRO PRO A . n A 1 211 THR 211 211 211 THR THR A . n A 1 212 HIS 212 212 212 HIS HIS A . n A 1 213 ARG 213 213 213 ARG ARG A . n A 1 214 CYS 214 214 214 CYS CYS A . n A 1 215 ILE 215 215 215 ILE ILE A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 PRO 217 217 217 PRO PRO A . n A 1 218 ASP 218 218 218 ASP ASP A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 ILE 220 220 220 ILE ILE A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 MET 222 222 222 MET MET A . n A 1 223 GLY 223 223 223 GLY GLY A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 ASP 226 226 226 ASP ASP A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 PRO 228 228 228 PRO PRO A . n A 1 229 ASP 229 229 229 ASP ASP A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 TYR 232 232 232 TYR TYR A . n A 1 233 PHE 233 233 233 PHE PHE A . n A 1 234 PHE 234 234 234 PHE PHE A . n A 1 235 ASP 235 235 235 ASP ASP A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 HIS 237 237 237 HIS HIS A . n A 1 238 VAL 238 238 238 VAL VAL A . n A 1 239 ARG 239 239 239 ARG ARG A . n A 1 240 PHE 240 240 240 PHE PHE A . n A 1 241 MET 241 241 241 MET MET A . n A 1 242 ASP 242 242 242 ASP ASP A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 PHE 244 244 244 PHE PHE A . n A 1 245 ILE 245 245 245 ILE ILE A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 ALA 247 247 247 ALA ALA A . n A 1 248 LEU 248 248 248 LEU LEU A . n A 1 249 GLY 249 249 249 GLY GLY A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 GLU 251 251 251 GLU GLU A . n A 1 252 GLU 252 252 252 GLU GLU A . n A 1 253 VAL 253 253 253 VAL VAL A . n A 1 254 VAL 254 254 254 VAL VAL A . n A 1 255 LEU 255 255 255 LEU LEU A . n A 1 256 VAL 256 256 256 VAL VAL A . n A 1 257 ILE 257 257 257 ILE ILE A . n A 1 258 HIS 258 258 258 HIS HIS A . n A 1 259 ASP 259 259 259 ASP ASP A . n A 1 260 TRP 260 260 260 TRP TRP A . n A 1 261 GLY 261 261 261 GLY GLY A . n A 1 262 SER 262 262 262 SER SER A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 LEU 264 264 264 LEU LEU A . n A 1 265 GLY 265 265 265 GLY GLY A . n A 1 266 PHE 266 266 266 PHE PHE A . n A 1 267 HIS 267 267 267 HIS HIS A . n A 1 268 TRP 268 268 268 TRP TRP A . n A 1 269 ALA 269 269 269 ALA ALA A . n A 1 270 LYS 270 270 270 LYS LYS A . n A 1 271 ARG 271 271 271 ARG ARG A . n A 1 272 ASN 272 272 272 ASN ASN A . n A 1 273 PRO 273 273 273 PRO PRO A . n A 1 274 GLU 274 274 274 GLU GLU A . n A 1 275 ARG 275 275 275 ARG ARG A . n A 1 276 VAL 276 276 276 VAL VAL A . n A 1 277 LYS 277 277 277 LYS LYS A . n A 1 278 GLY 278 278 278 GLY GLY A . n A 1 279 ILE 279 279 279 ILE ILE A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 PHE 281 281 281 PHE PHE A . n A 1 282 MET 282 282 282 MET MET A . n A 1 283 GLU 283 283 283 GLU GLU A . n A 1 284 PHE 284 284 284 PHE PHE A . n A 1 285 ILE 285 285 285 ILE ILE A . n A 1 286 ARG 286 286 286 ARG ARG A . n A 1 287 PRO 287 287 287 PRO PRO A . n A 1 288 ILE 288 288 288 ILE ILE A . n A 1 289 PRO 289 289 289 PRO PRO A . n A 1 290 THR 290 290 290 THR THR A . n A 1 291 TRP 291 291 ? ? ? A . n A 1 292 ASP 292 292 ? ? ? A . n A 1 293 GLU 293 293 ? ? ? A . n A 1 294 TRP 294 294 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NHE 1 301 1 NHE NHE A . C 3 HOH 1 401 10 HOH HOH A . C 3 HOH 2 402 1 HOH HOH A . C 3 HOH 3 403 2 HOH HOH A . C 3 HOH 4 404 11 HOH HOH A . C 3 HOH 5 405 6 HOH HOH A . C 3 HOH 6 406 9 HOH HOH A . C 3 HOH 7 407 4 HOH HOH A . C 3 HOH 8 408 5 HOH HOH A . C 3 HOH 9 409 12 HOH HOH A . C 3 HOH 10 410 14 HOH HOH A . C 3 HOH 11 411 3 HOH HOH A . C 3 HOH 12 412 7 HOH HOH A . C 3 HOH 13 413 13 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8B6N _cell.details ? _cell.formula_units_Z ? _cell.length_a 45.850 _cell.length_a_esd ? _cell.length_b 79.320 _cell.length_b_esd ? _cell.length_c 154.180 _cell.length_c_esd ? _cell.volume 560725.216 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8B6N _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8B6N _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.83 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M CHES pH 9.5, 1.0 M trisodium citrate with 40% (v/v) polypropylene glycol P400 additive' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'PSI PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-02-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97797 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97797 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 52.48 _reflns.entry_id 8B6N _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.30 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12786 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.2 _reflns.pdbx_Rmerge_I_obs 0.065 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.83 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.40 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.20 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1438 _reflns_shell.percent_possible_all 94.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.651 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.768 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 57.84 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8B6N _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 39.70 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12781 _refine.ls_number_reflns_R_free 640 _refine.ls_number_reflns_R_work 12141 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.10 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2165 _refine.ls_R_factor_R_free 0.2500 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2146 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5Y2X _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.2934 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4627 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 39.70 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 2189 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2163 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0039 ? 2246 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.6588 ? 3069 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0478 ? 330 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0058 ? 400 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 9.6008 ? 297 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.30 2.48 . . 122 2310 96.47 . . . 0.4633 . 0.4078 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.48 2.73 . . 127 2408 99.76 . . . 0.3382 . 0.2959 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.73 3.12 . . 127 2418 99.69 . . . 0.3031 . 0.2728 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.12 3.93 . . 129 2454 99.81 . . . 0.2271 . 0.2137 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.93 39.70 . . 135 2551 99.70 . . . 0.2101 . 0.1621 . . . . . . . . . . . # _struct.entry_id 8B6N _struct.title 'X-ray structure of the haloalkane dehalogenase HaloTag7 circular permutated at positions 141-156 (cpHaloTagDelta)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8B6N _struct_keywords.text 'haloalkane dehalogenase, HaloTag, HaloTag7, Self-Labeling Protein, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP DHAA_RHOSO P0A3G3 ? 1 ;DVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVP KLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL ; 156 2 UNP DHAA_RHOSO P0A3G3 ? 1 ;IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDD HVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEW ; 4 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8B6N A 2 ? 139 ? P0A3G3 156 ? 293 ? 2 139 2 2 8B6N A 157 ? 294 ? P0A3G3 4 ? 141 ? 157 294 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8B6N GLY A 1 ? UNP P0A3G3 ? ? 'expression tag' 1 1 1 8B6N LYS A 6 ? UNP P0A3G3 GLU 160 conflict 6 2 1 8B6N VAL A 13 ? UNP P0A3G3 ALA 167 conflict 13 3 1 8B6N THR A 18 ? UNP P0A3G3 ALA 172 conflict 18 4 1 8B6N MET A 21 ? UNP P0A3G3 LYS 175 conflict 21 5 1 8B6N GLY A 22 ? UNP P0A3G3 CYS 176 conflict 22 6 1 8B6N ASN A 41 ? UNP P0A3G3 LYS 195 conflict 41 7 1 8B6N GLU A 70 ? UNP P0A3G3 ALA 224 conflict 70 8 1 8B6N ASP A 73 ? UNP P0A3G3 ASN 227 conflict 73 9 1 8B6N LYS A 103 ? UNP P0A3G3 GLU 257 conflict 103 10 1 8B6N ALA A 110 ? UNP P0A3G3 THR 264 conflict 110 11 1 8B6N ASN A 118 ? UNP P0A3G3 HIS 272 conflict 118 12 1 8B6N LEU A 119 ? UNP P0A3G3 TYR 273 conflict 119 13 1 8B6N SER A 137 ? UNP P0A3G3 PRO 291 conflict 137 14 1 8B6N THR A 138 ? UNP P0A3G3 ALA 292 conflict 138 15 1 8B6N GLU A 140 ? UNP P0A3G3 ? ? linker 140 16 1 8B6N ILE A 141 ? UNP P0A3G3 ? ? linker 141 17 1 8B6N GLY A 142 ? UNP P0A3G3 ? ? linker 142 18 1 8B6N GLY A 143 ? UNP P0A3G3 ? ? linker 143 19 1 8B6N THR A 144 ? UNP P0A3G3 ? ? linker 144 20 1 8B6N GLY A 145 ? UNP P0A3G3 ? ? linker 145 21 1 8B6N GLY A 146 ? UNP P0A3G3 ? ? linker 146 22 1 8B6N SER A 147 ? UNP P0A3G3 ? ? linker 147 23 1 8B6N GLY A 148 ? UNP P0A3G3 ? ? linker 148 24 1 8B6N GLY A 149 ? UNP P0A3G3 ? ? linker 149 25 1 8B6N THR A 150 ? UNP P0A3G3 ? ? linker 150 26 1 8B6N GLY A 151 ? UNP P0A3G3 ? ? linker 151 27 1 8B6N GLY A 152 ? UNP P0A3G3 ? ? linker 152 28 1 8B6N SER A 153 ? UNP P0A3G3 ? ? linker 153 29 1 8B6N GLY A 154 ? UNP P0A3G3 ? ? linker 154 30 1 8B6N GLY A 155 ? UNP P0A3G3 ? ? linker 155 31 1 8B6N SER A 156 ? UNP P0A3G3 ? ? linker 156 32 2 8B6N VAL A 200 ? UNP P0A3G3 LEU 47 conflict 200 33 2 8B6N THR A 211 ? UNP P0A3G3 SER 58 conflict 211 34 2 8B6N GLY A 231 ? UNP P0A3G3 ASP 78 conflict 231 35 2 8B6N PHE A 240 ? UNP P0A3G3 TYR 87 conflict 240 36 2 8B6N MET A 241 ? UNP P0A3G3 LEU 88 conflict 241 37 2 8B6N PHE A 281 ? UNP P0A3G3 CYS 128 conflict 281 38 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 470 ? 1 MORE 5 ? 1 'SSA (A^2)' 11060 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? ASP A 10 ? ASP A 2 ASP A 10 1 ? 9 HELX_P HELX_P2 AA2 ASN A 12 ? GLY A 17 ? ASN A 12 GLY A 17 1 ? 6 HELX_P HELX_P3 AA3 LEU A 19 ? VAL A 23 ? LEU A 19 VAL A 23 5 ? 5 HELX_P HELX_P4 AA4 THR A 28 ? GLU A 37 ? THR A 28 GLU A 37 1 ? 10 HELX_P HELX_P5 AA5 PRO A 38 ? LEU A 40 ? PRO A 38 LEU A 40 5 ? 3 HELX_P HELX_P6 AA6 ASN A 41 ? ASP A 44 ? ASN A 41 ASP A 44 5 ? 4 HELX_P HELX_P7 AA7 ARG A 45 ? PHE A 51 ? ARG A 45 PHE A 51 1 ? 7 HELX_P HELX_P8 AA8 PRO A 52 ? LEU A 55 ? PRO A 52 LEU A 55 5 ? 4 HELX_P HELX_P9 AA9 PRO A 61 ? SER A 78 ? PRO A 61 SER A 78 1 ? 18 HELX_P HELX_P10 AB1 PRO A 94 ? LEU A 105 ? PRO A 94 LEU A 105 1 ? 12 HELX_P HELX_P11 AB2 LEU A 119 ? ASN A 124 ? LEU A 119 ASN A 124 1 ? 6 HELX_P HELX_P12 AB3 ASN A 124 ? SER A 137 ? ASN A 124 SER A 137 1 ? 14 HELX_P HELX_P13 AB4 SER A 197 ? ARG A 202 ? SER A 197 ARG A 202 5 ? 6 HELX_P HELX_P14 AB5 ILE A 204 ? VAL A 208 ? ILE A 204 VAL A 208 5 ? 5 HELX_P HELX_P15 AB6 PHE A 233 ? LEU A 248 ? PHE A 233 LEU A 248 1 ? 16 HELX_P HELX_P16 AB7 ASP A 259 ? ASN A 272 ? ASP A 259 ASN A 272 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 60 A . ? GLU 60 A PRO 61 A ? PRO 61 A 1 -4.41 2 THR 88 A . ? THR 88 A PRO 89 A ? PRO 89 A 1 1.06 3 ASN 194 A . ? ASN 194 A PRO 195 A ? PRO 195 A 1 0.08 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 108 ? GLY A 116 ? CYS A 108 GLY A 116 AA1 2 LYS A 82 ? PRO A 89 ? LYS A 82 PRO A 89 AA1 3 VAL A 276 ? MET A 282 ? VAL A 276 MET A 282 AA1 4 VAL A 253 ? HIS A 258 ? VAL A 253 HIS A 258 AA1 5 VAL A 188 ? LEU A 191 ? VAL A 188 LEU A 191 AA1 6 CYS A 214 ? PRO A 217 ? CYS A 214 PRO A 217 AA1 7 GLU A 173 ? VAL A 180 ? GLU A 173 VAL A 180 AA1 8 HIS A 166 ? VAL A 170 ? HIS A 166 VAL A 170 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 109 ? O LYS A 109 N LEU A 84 ? N LEU A 84 AA1 2 3 N LEU A 83 ? N LEU A 83 O PHE A 281 ? O PHE A 281 AA1 3 4 O ALA A 280 ? O ALA A 280 N LEU A 255 ? N LEU A 255 AA1 4 5 O VAL A 254 ? O VAL A 254 N LEU A 189 ? N LEU A 189 AA1 5 6 N PHE A 190 ? N PHE A 190 O ILE A 215 ? O ILE A 215 AA1 6 7 O CYS A 214 ? O CYS A 214 N VAL A 180 ? N VAL A 180 AA1 7 8 O GLU A 173 ? O GLU A 173 N VAL A 170 ? N VAL A 170 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 91 ? ? -132.78 -63.53 2 1 LEU A 117 ? ? -116.83 -96.38 3 1 ASN A 124 ? ? -156.21 64.90 4 1 PRO A 195 ? ? -109.83 47.76 5 1 THR A 196 ? ? -98.97 -154.09 6 1 SER A 197 ? ? -161.15 -168.47 7 1 GLU A 251 ? ? -104.80 -82.83 8 1 ASP A 259 ? ? 58.00 -131.28 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -17.1998031309 -10.3726568505 -25.7062089781 0.32796414623 ? 0.0340919472982 ? 0.0230154440206 ? 0.29957652696 ? 0.0478542816189 ? 0.387951439657 ? 2.51835876036 ? 1.18984266223 ? 1.61035815385 ? 2.32135498224 ? 1.13058194337 ? 5.08650990106 ? 0.0131186702117 ? 0.140550276017 ? -0.00803655584961 ? 0.0703861915477 ? 0.00543749511215 ? 0.151605343145 ? 0.168079711196 ? -0.0611810207669 ? 0.0133911093197 ? 2 'X-RAY DIFFRACTION' ? refined -3.8704686161 5.07906853815 -21.7036913713 0.571425629671 ? -0.270401141225 ? 0.00198069038186 ? 0.711697903145 ? 0.050977396978 ? 0.463196829629 ? 1.03149006436 ? 0.737213419177 ? 1.45199748559 ? 0.540671535829 ? 1.07141071168 ? 2.07467927416 ? -0.411810587094 ? 0.707066234677 ? 0.278754733263 ? -0.16171655761 ? 0.37918765673 ? 0.0422426118187 ? -1.15639933321 ? 1.34864449484 ? 0.117628467496 ? 3 'X-RAY DIFFRACTION' ? refined -2.34714784794 -13.9764244417 -19.2087620117 0.446519504302 ? 0.148813908946 ? -0.0336322532914 ? 0.671056804054 ? -0.101260034658 ? 0.475149228631 ? 1.96190802861 ? 0.902520713809 ? 1.66285036817 ? 1.78158350452 ? 0.766331499037 ? 4.07750978496 ? 0.0251259392159 ? 0.434172498697 ? -0.256237771274 ? 0.175601426548 ? 0.350600641429 ? -0.398146393635 ? 0.48206080159 ? 1.2004044223 ? -0.3368772173 ? 4 'X-RAY DIFFRACTION' ? refined -9.32390988641 -7.38088301972 -11.5307322777 0.406550285526 ? 0.0382613831077 ? 0.0120779759398 ? 0.334989336774 ? -0.0394944098178 ? 0.409800352122 ? 3.11916959882 ? 1.37981377603 ? -0.604919385988 ? 2.74242868864 ? 1.74158653718 ? 5.72862755727 ? 0.0669711537433 ? -0.124525387299 ? 0.0236107192622 ? 0.443592210542 ? 0.158684907271 ? -0.125638282784 ? 0.187837558822 ? 0.529906732108 ? -0.216388955101 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 2 ? A 76 A 77 ? ? ;chain 'A' and (resid 2 through 77 ) ; 2 'X-RAY DIFFRACTION' 2 A 77 A 78 ? A 103 A 104 ? ? ;chain 'A' and (resid 78 through 104 ) ; 3 'X-RAY DIFFRACTION' 3 A 104 A 105 ? A 215 A 233 ? ? ;chain 'A' and (resid 105 through 233 ) ; 4 'X-RAY DIFFRACTION' 4 A 216 A 234 ? A 272 A 290 ? ? ;chain 'A' and (resid 234 through 290 ) ; # _pdbx_entry_details.entry_id 8B6N _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A GLU 140 ? A GLU 140 3 1 Y 1 A ILE 141 ? A ILE 141 4 1 Y 1 A GLY 142 ? A GLY 142 5 1 Y 1 A GLY 143 ? A GLY 143 6 1 Y 1 A THR 144 ? A THR 144 7 1 Y 1 A GLY 145 ? A GLY 145 8 1 Y 1 A GLY 146 ? A GLY 146 9 1 Y 1 A SER 147 ? A SER 147 10 1 Y 1 A GLY 148 ? A GLY 148 11 1 Y 1 A GLY 149 ? A GLY 149 12 1 Y 1 A THR 150 ? A THR 150 13 1 Y 1 A GLY 151 ? A GLY 151 14 1 Y 1 A GLY 152 ? A GLY 152 15 1 Y 1 A SER 153 ? A SER 153 16 1 Y 1 A GLY 154 ? A GLY 154 17 1 Y 1 A GLY 155 ? A GLY 155 18 1 Y 1 A SER 156 ? A SER 156 19 1 Y 1 A TRP 291 ? A TRP 291 20 1 Y 1 A ASP 292 ? A ASP 292 21 1 Y 1 A GLU 293 ? A GLU 293 22 1 Y 1 A TRP 294 ? A TRP 294 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 NHE "C3'" C N N 250 NHE "C2'" C N N 251 NHE "C1'" C N N 252 NHE "C6'" C N N 253 NHE N N N N 254 NHE C1 C N N 255 NHE C2 C N N 256 NHE S S N N 257 NHE O1 O N N 258 NHE O2 O N N 259 NHE O3 O N N 260 NHE "C5'" C N N 261 NHE "C4'" C N N 262 NHE "H3'1" H N N 263 NHE "H3'2" H N N 264 NHE "H2'1" H N N 265 NHE "H2'2" H N N 266 NHE "HC'1" H N N 267 NHE "H6'1" H N N 268 NHE "H6'2" H N N 269 NHE HN H N N 270 NHE HC11 H N N 271 NHE HC12 H N N 272 NHE HC21 H N N 273 NHE HC22 H N N 274 NHE HO3 H N N 275 NHE "H5'1" H N N 276 NHE "H5'2" H N N 277 NHE "H4'1" H N N 278 NHE "H4'2" H N N 279 PHE N N N N 280 PHE CA C N S 281 PHE C C N N 282 PHE O O N N 283 PHE CB C N N 284 PHE CG C Y N 285 PHE CD1 C Y N 286 PHE CD2 C Y N 287 PHE CE1 C Y N 288 PHE CE2 C Y N 289 PHE CZ C Y N 290 PHE OXT O N N 291 PHE H H N N 292 PHE H2 H N N 293 PHE HA H N N 294 PHE HB2 H N N 295 PHE HB3 H N N 296 PHE HD1 H N N 297 PHE HD2 H N N 298 PHE HE1 H N N 299 PHE HE2 H N N 300 PHE HZ H N N 301 PHE HXT H N N 302 PRO N N N N 303 PRO CA C N S 304 PRO C C N N 305 PRO O O N N 306 PRO CB C N N 307 PRO CG C N N 308 PRO CD C N N 309 PRO OXT O N N 310 PRO H H N N 311 PRO HA H N N 312 PRO HB2 H N N 313 PRO HB3 H N N 314 PRO HG2 H N N 315 PRO HG3 H N N 316 PRO HD2 H N N 317 PRO HD3 H N N 318 PRO HXT H N N 319 SER N N N N 320 SER CA C N S 321 SER C C N N 322 SER O O N N 323 SER CB C N N 324 SER OG O N N 325 SER OXT O N N 326 SER H H N N 327 SER H2 H N N 328 SER HA H N N 329 SER HB2 H N N 330 SER HB3 H N N 331 SER HG H N N 332 SER HXT H N N 333 THR N N N N 334 THR CA C N S 335 THR C C N N 336 THR O O N N 337 THR CB C N R 338 THR OG1 O N N 339 THR CG2 C N N 340 THR OXT O N N 341 THR H H N N 342 THR H2 H N N 343 THR HA H N N 344 THR HB H N N 345 THR HG1 H N N 346 THR HG21 H N N 347 THR HG22 H N N 348 THR HG23 H N N 349 THR HXT H N N 350 TRP N N N N 351 TRP CA C N S 352 TRP C C N N 353 TRP O O N N 354 TRP CB C N N 355 TRP CG C Y N 356 TRP CD1 C Y N 357 TRP CD2 C Y N 358 TRP NE1 N Y N 359 TRP CE2 C Y N 360 TRP CE3 C Y N 361 TRP CZ2 C Y N 362 TRP CZ3 C Y N 363 TRP CH2 C Y N 364 TRP OXT O N N 365 TRP H H N N 366 TRP H2 H N N 367 TRP HA H N N 368 TRP HB2 H N N 369 TRP HB3 H N N 370 TRP HD1 H N N 371 TRP HE1 H N N 372 TRP HE3 H N N 373 TRP HZ2 H N N 374 TRP HZ3 H N N 375 TRP HH2 H N N 376 TRP HXT H N N 377 TYR N N N N 378 TYR CA C N S 379 TYR C C N N 380 TYR O O N N 381 TYR CB C N N 382 TYR CG C Y N 383 TYR CD1 C Y N 384 TYR CD2 C Y N 385 TYR CE1 C Y N 386 TYR CE2 C Y N 387 TYR CZ C Y N 388 TYR OH O N N 389 TYR OXT O N N 390 TYR H H N N 391 TYR H2 H N N 392 TYR HA H N N 393 TYR HB2 H N N 394 TYR HB3 H N N 395 TYR HD1 H N N 396 TYR HD2 H N N 397 TYR HE1 H N N 398 TYR HE2 H N N 399 TYR HH H N N 400 TYR HXT H N N 401 VAL N N N N 402 VAL CA C N S 403 VAL C C N N 404 VAL O O N N 405 VAL CB C N N 406 VAL CG1 C N N 407 VAL CG2 C N N 408 VAL OXT O N N 409 VAL H H N N 410 VAL H2 H N N 411 VAL HA H N N 412 VAL HB H N N 413 VAL HG11 H N N 414 VAL HG12 H N N 415 VAL HG13 H N N 416 VAL HG21 H N N 417 VAL HG22 H N N 418 VAL HG23 H N N 419 VAL HXT H N N 420 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 NHE "C3'" "C2'" sing N N 237 NHE "C3'" "C4'" sing N N 238 NHE "C3'" "H3'1" sing N N 239 NHE "C3'" "H3'2" sing N N 240 NHE "C2'" "C1'" sing N N 241 NHE "C2'" "H2'1" sing N N 242 NHE "C2'" "H2'2" sing N N 243 NHE "C1'" "C6'" sing N N 244 NHE "C1'" N sing N N 245 NHE "C1'" "HC'1" sing N N 246 NHE "C6'" "C5'" sing N N 247 NHE "C6'" "H6'1" sing N N 248 NHE "C6'" "H6'2" sing N N 249 NHE N C1 sing N N 250 NHE N HN sing N N 251 NHE C1 C2 sing N N 252 NHE C1 HC11 sing N N 253 NHE C1 HC12 sing N N 254 NHE C2 S sing N N 255 NHE C2 HC21 sing N N 256 NHE C2 HC22 sing N N 257 NHE S O1 doub N N 258 NHE S O2 doub N N 259 NHE S O3 sing N N 260 NHE O3 HO3 sing N N 261 NHE "C5'" "C4'" sing N N 262 NHE "C5'" "H5'1" sing N N 263 NHE "C5'" "H5'2" sing N N 264 NHE "C4'" "H4'1" sing N N 265 NHE "C4'" "H4'2" sing N N 266 PHE N CA sing N N 267 PHE N H sing N N 268 PHE N H2 sing N N 269 PHE CA C sing N N 270 PHE CA CB sing N N 271 PHE CA HA sing N N 272 PHE C O doub N N 273 PHE C OXT sing N N 274 PHE CB CG sing N N 275 PHE CB HB2 sing N N 276 PHE CB HB3 sing N N 277 PHE CG CD1 doub Y N 278 PHE CG CD2 sing Y N 279 PHE CD1 CE1 sing Y N 280 PHE CD1 HD1 sing N N 281 PHE CD2 CE2 doub Y N 282 PHE CD2 HD2 sing N N 283 PHE CE1 CZ doub Y N 284 PHE CE1 HE1 sing N N 285 PHE CE2 CZ sing Y N 286 PHE CE2 HE2 sing N N 287 PHE CZ HZ sing N N 288 PHE OXT HXT sing N N 289 PRO N CA sing N N 290 PRO N CD sing N N 291 PRO N H sing N N 292 PRO CA C sing N N 293 PRO CA CB sing N N 294 PRO CA HA sing N N 295 PRO C O doub N N 296 PRO C OXT sing N N 297 PRO CB CG sing N N 298 PRO CB HB2 sing N N 299 PRO CB HB3 sing N N 300 PRO CG CD sing N N 301 PRO CG HG2 sing N N 302 PRO CG HG3 sing N N 303 PRO CD HD2 sing N N 304 PRO CD HD3 sing N N 305 PRO OXT HXT sing N N 306 SER N CA sing N N 307 SER N H sing N N 308 SER N H2 sing N N 309 SER CA C sing N N 310 SER CA CB sing N N 311 SER CA HA sing N N 312 SER C O doub N N 313 SER C OXT sing N N 314 SER CB OG sing N N 315 SER CB HB2 sing N N 316 SER CB HB3 sing N N 317 SER OG HG sing N N 318 SER OXT HXT sing N N 319 THR N CA sing N N 320 THR N H sing N N 321 THR N H2 sing N N 322 THR CA C sing N N 323 THR CA CB sing N N 324 THR CA HA sing N N 325 THR C O doub N N 326 THR C OXT sing N N 327 THR CB OG1 sing N N 328 THR CB CG2 sing N N 329 THR CB HB sing N N 330 THR OG1 HG1 sing N N 331 THR CG2 HG21 sing N N 332 THR CG2 HG22 sing N N 333 THR CG2 HG23 sing N N 334 THR OXT HXT sing N N 335 TRP N CA sing N N 336 TRP N H sing N N 337 TRP N H2 sing N N 338 TRP CA C sing N N 339 TRP CA CB sing N N 340 TRP CA HA sing N N 341 TRP C O doub N N 342 TRP C OXT sing N N 343 TRP CB CG sing N N 344 TRP CB HB2 sing N N 345 TRP CB HB3 sing N N 346 TRP CG CD1 doub Y N 347 TRP CG CD2 sing Y N 348 TRP CD1 NE1 sing Y N 349 TRP CD1 HD1 sing N N 350 TRP CD2 CE2 doub Y N 351 TRP CD2 CE3 sing Y N 352 TRP NE1 CE2 sing Y N 353 TRP NE1 HE1 sing N N 354 TRP CE2 CZ2 sing Y N 355 TRP CE3 CZ3 doub Y N 356 TRP CE3 HE3 sing N N 357 TRP CZ2 CH2 doub Y N 358 TRP CZ2 HZ2 sing N N 359 TRP CZ3 CH2 sing Y N 360 TRP CZ3 HZ3 sing N N 361 TRP CH2 HH2 sing N N 362 TRP OXT HXT sing N N 363 TYR N CA sing N N 364 TYR N H sing N N 365 TYR N H2 sing N N 366 TYR CA C sing N N 367 TYR CA CB sing N N 368 TYR CA HA sing N N 369 TYR C O doub N N 370 TYR C OXT sing N N 371 TYR CB CG sing N N 372 TYR CB HB2 sing N N 373 TYR CB HB3 sing N N 374 TYR CG CD1 doub Y N 375 TYR CG CD2 sing Y N 376 TYR CD1 CE1 sing Y N 377 TYR CD1 HD1 sing N N 378 TYR CD2 CE2 doub Y N 379 TYR CD2 HD2 sing N N 380 TYR CE1 CZ doub Y N 381 TYR CE1 HE1 sing N N 382 TYR CE2 CZ sing Y N 383 TYR CE2 HE2 sing N N 384 TYR CZ OH sing N N 385 TYR OH HH sing N N 386 TYR OXT HXT sing N N 387 VAL N CA sing N N 388 VAL N H sing N N 389 VAL N H2 sing N N 390 VAL CA C sing N N 391 VAL CA CB sing N N 392 VAL CA HA sing N N 393 VAL C O doub N N 394 VAL C OXT sing N N 395 VAL CB CG1 sing N N 396 VAL CB CG2 sing N N 397 VAL CB HB sing N N 398 VAL CG1 HG11 sing N N 399 VAL CG1 HG12 sing N N 400 VAL CG1 HG13 sing N N 401 VAL CG2 HG21 sing N N 402 VAL CG2 HG22 sing N N 403 VAL CG2 HG23 sing N N 404 VAL OXT HXT sing N N 405 # _pdbx_audit_support.funding_organization 'Max Planck Society' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 8B6N _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.021810 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012607 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006486 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_