data_8B78 # _entry.id 8B78 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8B78 pdb_00008b78 10.2210/pdb8b78/pdb WWPDB D_1292125850 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-07-12 2 'Structure model' 2 0 2023-07-19 3 'Structure model' 2 1 2023-07-26 4 'Structure model' 2 2 2024-02-07 5 'Structure model' 2 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Data collection' 4 2 'Structure model' 'Database references' 5 2 'Structure model' 'Derived calculations' 6 2 'Structure model' 'Polymer sequence' 7 2 'Structure model' 'Source and taxonomy' 8 2 'Structure model' 'Structure summary' 9 3 'Structure model' 'Data collection' 10 3 'Structure model' 'Database references' 11 4 'Structure model' 'Data collection' 12 4 'Structure model' 'Refinement description' 13 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' citation 3 2 'Structure model' citation_author 4 2 'Structure model' entity 5 2 'Structure model' entity_name_com 6 2 'Structure model' entity_poly 7 2 'Structure model' entity_poly_seq 8 2 'Structure model' entity_src_gen 9 2 'Structure model' pdbx_nonpoly_scheme 10 2 'Structure model' pdbx_poly_seq_scheme 11 2 'Structure model' pdbx_unobs_or_zero_occ_atoms 12 2 'Structure model' pdbx_validate_torsion 13 2 'Structure model' struct_conf 14 2 'Structure model' struct_ref 15 2 'Structure model' struct_ref_seq 16 2 'Structure model' struct_ref_seq_dif 17 3 'Structure model' citation 18 3 'Structure model' citation_author 19 3 'Structure model' diffrn_source 20 4 'Structure model' chem_comp_atom 21 4 'Structure model' chem_comp_bond 22 4 'Structure model' pdbx_initial_refinement_model 23 5 'Structure model' pdbx_entry_details 24 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.B_iso_or_equiv' 2 2 'Structure model' '_atom_site.Cartn_x' 3 2 'Structure model' '_atom_site.Cartn_y' 4 2 'Structure model' '_atom_site.Cartn_z' 5 2 'Structure model' '_atom_site.auth_comp_id' 6 2 'Structure model' '_atom_site.label_comp_id' 7 2 'Structure model' '_citation.country' 8 2 'Structure model' '_citation.journal_abbrev' 9 2 'Structure model' '_citation.journal_id_ASTM' 10 2 'Structure model' '_citation.journal_id_CSD' 11 2 'Structure model' '_citation.journal_id_ISSN' 12 2 'Structure model' '_citation.pdbx_database_id_DOI' 13 2 'Structure model' '_citation.pdbx_database_id_PubMed' 14 2 'Structure model' '_citation.title' 15 2 'Structure model' '_citation.year' 16 2 'Structure model' '_entity.formula_weight' 17 2 'Structure model' '_entity.pdbx_description' 18 2 'Structure model' '_entity.pdbx_ec' 19 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 20 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 21 2 'Structure model' '_entity_poly_seq.mon_id' 22 2 'Structure model' '_entity_src_gen.pdbx_gene_src_gene' 23 2 'Structure model' '_pdbx_nonpoly_scheme.auth_seq_num' 24 2 'Structure model' '_pdbx_poly_seq_scheme.mon_id' 25 2 'Structure model' '_pdbx_poly_seq_scheme.pdb_mon_id' 26 2 'Structure model' '_struct_conf.beg_auth_comp_id' 27 2 'Structure model' '_struct_conf.beg_label_comp_id' 28 2 'Structure model' '_struct_ref.db_code' 29 2 'Structure model' '_struct_ref.pdbx_db_accession' 30 2 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 31 2 'Structure model' '_struct_ref_seq.db_align_end' 32 2 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_end' 33 2 'Structure model' '_struct_ref_seq.pdbx_db_accession' 34 2 'Structure model' '_struct_ref_seq.seq_align_end' 35 3 'Structure model' '_citation.journal_volume' 36 3 'Structure model' '_citation.page_first' 37 3 'Structure model' '_citation.page_last' 38 3 'Structure model' '_citation_author.identifier_ORCID' 39 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 40 5 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8B78 _pdbx_database_status.recvd_initial_deposition_date 2022-09-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email Chris.Phillips@astrazeneca.com _pdbx_contact_author.name_first C _pdbx_contact_author.name_last Phillips _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6569-9025 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Phillips, C.' 1 0000-0001-6569-9025 'Breed, J.' 2 0000-0002-3379-0948 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 66 _citation.language ? _citation.page_first 9147 _citation.page_last 9160 _citation.title 'Discovery of AZD4747, a Potent and Selective Inhibitor of Mutant GTPase KRAS G12C with Demonstrable CNS Penetration.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.3c00746 _citation.pdbx_database_id_PubMed 37395055 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kettle, J.G.' 1 ? primary 'Bagal, S.K.' 2 ? primary 'Barratt, D.' 3 ? primary 'Bodnarchuk, M.S.' 4 ? primary 'Boyd, S.' 5 ? primary 'Braybrooke, E.' 6 ? primary 'Breed, J.' 7 ? primary 'Cassar, D.J.' 8 ? primary 'Cosulich, S.' 9 ? primary 'Davies, M.' 10 ? primary 'Davies, N.L.' 11 ? primary 'Deng, C.' 12 ? primary 'Eatherton, A.' 13 ? primary 'Evans, L.' 14 ? primary 'Feron, L.J.' 15 ? primary 'Fillery, S.' 16 ? primary 'Gleave, E.S.' 17 ? primary 'Goldberg, F.W.' 18 ? primary 'Cortes Gonzalez, M.A.' 19 ? primary 'Guerot, C.' 20 ? primary 'Haider, A.' 21 ? primary 'Harlfinger, S.' 22 ? primary 'Howells, R.' 23 ? primary 'Jackson, A.' 24 ? primary 'Johnstrom, P.' 25 ? primary 'Kemmitt, P.D.' 26 ? primary 'Koers, A.' 27 ? primary 'Kondrashov, M.' 28 ? primary 'Lamont, G.M.' 29 ? primary 'Lamont, S.' 30 ? primary 'Lewis, H.J.' 31 ? primary 'Liu, L.' 32 ? primary 'Mylrea, M.' 33 ? primary 'Nash, S.' 34 ? primary 'Niedbala, M.J.' 35 ? primary 'Peter, A.' 36 ? primary 'Phillips, C.' 37 ? primary 'Pike, K.' 38 ? primary 'Raubo, P.' 39 ? primary 'Robb, G.R.' 40 ? primary 'Ross, S.' 41 ? primary 'Sanders, M.G.' 42 ? primary 'Schou, M.' 43 ? primary 'Simpson, I.' 44 ? primary 'Steward, O.' 45 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GTPase KRas' 19194.633 1 3.6.5.2 ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE" 443.201 1 ? ? ? ? 4 non-polymer syn ;1-[(4~{a}~{R})-8-(2-chloranyl-6-oxidanyl-phenyl)-7-fluoranyl-9-prop-1-ynyl-1,2,4,4~{a},5,11-hexahydropyrazino[2,1-c][1,4]benzoxazepin-3-yl]propan-1-one ; 442.910 1 ? ? ? ? 5 water nat water 18.015 124 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'K-Ras 2,Ki-Ras,c-K-ras,c-Ki-ras' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFL LVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVDDAFYTL VREIRKHK ; _entity_poly.pdbx_seq_one_letter_code_can ;GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFL LVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVDDAFYTL VREIRKHK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 "GUANOSINE-5'-DIPHOSPHATE" GDP 4 ;1-[(4~{a}~{R})-8-(2-chloranyl-6-oxidanyl-phenyl)-7-fluoranyl-9-prop-1-ynyl-1,2,4,4~{a},5,11-hexahydropyrazino[2,1-c][1,4]benzoxazepin-3-yl]propan-1-one ; PUO 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 THR n 1 4 GLU n 1 5 TYR n 1 6 LYS n 1 7 LEU n 1 8 VAL n 1 9 VAL n 1 10 VAL n 1 11 GLY n 1 12 ALA n 1 13 CYS n 1 14 GLY n 1 15 VAL n 1 16 GLY n 1 17 LYS n 1 18 SER n 1 19 ALA n 1 20 LEU n 1 21 THR n 1 22 ILE n 1 23 GLN n 1 24 LEU n 1 25 ILE n 1 26 GLN n 1 27 ASN n 1 28 HIS n 1 29 PHE n 1 30 VAL n 1 31 ASP n 1 32 GLU n 1 33 TYR n 1 34 ASP n 1 35 PRO n 1 36 THR n 1 37 ILE n 1 38 GLU n 1 39 ASP n 1 40 SER n 1 41 TYR n 1 42 ARG n 1 43 LYS n 1 44 GLN n 1 45 VAL n 1 46 VAL n 1 47 ILE n 1 48 ASP n 1 49 GLY n 1 50 GLU n 1 51 THR n 1 52 SER n 1 53 LEU n 1 54 LEU n 1 55 ASP n 1 56 ILE n 1 57 LEU n 1 58 ASP n 1 59 THR n 1 60 ALA n 1 61 GLY n 1 62 GLN n 1 63 GLU n 1 64 GLU n 1 65 TYR n 1 66 SER n 1 67 ALA n 1 68 MET n 1 69 ARG n 1 70 ASP n 1 71 GLN n 1 72 TYR n 1 73 MET n 1 74 ARG n 1 75 THR n 1 76 GLY n 1 77 GLU n 1 78 GLY n 1 79 PHE n 1 80 LEU n 1 81 LEU n 1 82 VAL n 1 83 PHE n 1 84 ALA n 1 85 ILE n 1 86 ASN n 1 87 ASN n 1 88 THR n 1 89 LYS n 1 90 SER n 1 91 PHE n 1 92 GLU n 1 93 ASP n 1 94 ILE n 1 95 HIS n 1 96 HIS n 1 97 TYR n 1 98 ARG n 1 99 GLU n 1 100 GLN n 1 101 ILE n 1 102 LYS n 1 103 ARG n 1 104 VAL n 1 105 LYS n 1 106 ASP n 1 107 SER n 1 108 GLU n 1 109 ASP n 1 110 VAL n 1 111 PRO n 1 112 MET n 1 113 VAL n 1 114 LEU n 1 115 VAL n 1 116 GLY n 1 117 ASN n 1 118 LYS n 1 119 SER n 1 120 ASP n 1 121 LEU n 1 122 PRO n 1 123 SER n 1 124 ARG n 1 125 THR n 1 126 VAL n 1 127 ASP n 1 128 THR n 1 129 LYS n 1 130 GLN n 1 131 ALA n 1 132 GLN n 1 133 ASP n 1 134 LEU n 1 135 ALA n 1 136 ARG n 1 137 SER n 1 138 TYR n 1 139 GLY n 1 140 ILE n 1 141 PRO n 1 142 PHE n 1 143 ILE n 1 144 GLU n 1 145 THR n 1 146 SER n 1 147 ALA n 1 148 LYS n 1 149 THR n 1 150 ARG n 1 151 GLN n 1 152 ARG n 1 153 VAL n 1 154 ASP n 1 155 ASP n 1 156 ALA n 1 157 PHE n 1 158 TYR n 1 159 THR n 1 160 LEU n 1 161 VAL n 1 162 ARG n 1 163 GLU n 1 164 ILE n 1 165 ARG n 1 166 LYS n 1 167 HIS n 1 168 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 168 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KRAS, KRAS2, RASK2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GDP 'RNA linking' n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PUO non-polymer . ;1-[(4~{a}~{R})-8-(2-chloranyl-6-oxidanyl-phenyl)-7-fluoranyl-9-prop-1-ynyl-1,2,4,4~{a},5,11-hexahydropyrazino[2,1-c][1,4]benzoxazepin-3-yl]propan-1-one ; ? 'C24 H24 Cl F N2 O3' 442.910 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 0 GLY GLY A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 THR 3 2 2 THR THR A . n A 1 4 GLU 4 3 3 GLU GLU A . n A 1 5 TYR 5 4 4 TYR TYR A . n A 1 6 LYS 6 5 5 LYS LYS A . n A 1 7 LEU 7 6 6 LEU LEU A . n A 1 8 VAL 8 7 7 VAL VAL A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 VAL 10 9 9 VAL VAL A . n A 1 11 GLY 11 10 10 GLY GLY A . n A 1 12 ALA 12 11 11 ALA ALA A . n A 1 13 CYS 13 12 12 CYS CYS A . n A 1 14 GLY 14 13 13 GLY GLY A . n A 1 15 VAL 15 14 14 VAL VAL A . n A 1 16 GLY 16 15 15 GLY GLY A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 SER 18 17 17 SER SER A . n A 1 19 ALA 19 18 18 ALA ALA A . n A 1 20 LEU 20 19 19 LEU LEU A . n A 1 21 THR 21 20 20 THR THR A . n A 1 22 ILE 22 21 21 ILE ILE A . n A 1 23 GLN 23 22 22 GLN GLN A . n A 1 24 LEU 24 23 23 LEU LEU A . n A 1 25 ILE 25 24 24 ILE ILE A . n A 1 26 GLN 26 25 25 GLN GLN A . n A 1 27 ASN 27 26 26 ASN ASN A . n A 1 28 HIS 28 27 27 HIS HIS A . n A 1 29 PHE 29 28 28 PHE PHE A . n A 1 30 VAL 30 29 29 VAL VAL A . n A 1 31 ASP 31 30 30 ASP ASP A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 TYR 33 32 32 TYR TYR A . n A 1 34 ASP 34 33 33 ASP ASP A . n A 1 35 PRO 35 34 34 PRO PRO A . n A 1 36 THR 36 35 35 THR THR A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 GLU 38 37 37 GLU GLU A . n A 1 39 ASP 39 38 38 ASP ASP A . n A 1 40 SER 40 39 39 SER SER A . n A 1 41 TYR 41 40 40 TYR TYR A . n A 1 42 ARG 42 41 41 ARG ARG A . n A 1 43 LYS 43 42 42 LYS LYS A . n A 1 44 GLN 44 43 43 GLN GLN A . n A 1 45 VAL 45 44 44 VAL VAL A . n A 1 46 VAL 46 45 45 VAL VAL A . n A 1 47 ILE 47 46 46 ILE ILE A . n A 1 48 ASP 48 47 47 ASP ASP A . n A 1 49 GLY 49 48 48 GLY GLY A . n A 1 50 GLU 50 49 49 GLU GLU A . n A 1 51 THR 51 50 50 THR THR A . n A 1 52 SER 52 51 51 SER SER A . n A 1 53 LEU 53 52 52 LEU LEU A . n A 1 54 LEU 54 53 53 LEU LEU A . n A 1 55 ASP 55 54 54 ASP ASP A . n A 1 56 ILE 56 55 55 ILE ILE A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 ASP 58 57 57 ASP ASP A . n A 1 59 THR 59 58 58 THR THR A . n A 1 60 ALA 60 59 59 ALA ALA A . n A 1 61 GLY 61 60 60 GLY GLY A . n A 1 62 GLN 62 61 61 GLN GLN A . n A 1 63 GLU 63 62 62 GLU GLU A . n A 1 64 GLU 64 63 63 GLU GLU A . n A 1 65 TYR 65 64 64 TYR TYR A . n A 1 66 SER 66 65 65 SER SER A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 MET 68 67 67 MET MET A . n A 1 69 ARG 69 68 68 ARG ARG A . n A 1 70 ASP 70 69 69 ASP ASP A . n A 1 71 GLN 71 70 70 GLN GLN A . n A 1 72 TYR 72 71 71 TYR TYR A . n A 1 73 MET 73 72 72 MET MET A . n A 1 74 ARG 74 73 73 ARG ARG A . n A 1 75 THR 75 74 74 THR THR A . n A 1 76 GLY 76 75 75 GLY GLY A . n A 1 77 GLU 77 76 76 GLU GLU A . n A 1 78 GLY 78 77 77 GLY GLY A . n A 1 79 PHE 79 78 78 PHE PHE A . n A 1 80 LEU 80 79 79 LEU LEU A . n A 1 81 LEU 81 80 80 LEU LEU A . n A 1 82 VAL 82 81 81 VAL VAL A . n A 1 83 PHE 83 82 82 PHE PHE A . n A 1 84 ALA 84 83 83 ALA ALA A . n A 1 85 ILE 85 84 84 ILE ILE A . n A 1 86 ASN 86 85 85 ASN ASN A . n A 1 87 ASN 87 86 86 ASN ASN A . n A 1 88 THR 88 87 87 THR THR A . n A 1 89 LYS 89 88 88 LYS LYS A . n A 1 90 SER 90 89 89 SER SER A . n A 1 91 PHE 91 90 90 PHE PHE A . n A 1 92 GLU 92 91 91 GLU GLU A . n A 1 93 ASP 93 92 92 ASP ASP A . n A 1 94 ILE 94 93 93 ILE ILE A . n A 1 95 HIS 95 94 94 HIS HIS A . n A 1 96 HIS 96 95 95 HIS HIS A . n A 1 97 TYR 97 96 96 TYR TYR A . n A 1 98 ARG 98 97 97 ARG ARG A . n A 1 99 GLU 99 98 98 GLU GLU A . n A 1 100 GLN 100 99 99 GLN GLN A . n A 1 101 ILE 101 100 100 ILE ILE A . n A 1 102 LYS 102 101 101 LYS LYS A . n A 1 103 ARG 103 102 102 ARG ARG A . n A 1 104 VAL 104 103 103 VAL VAL A . n A 1 105 LYS 105 104 104 LYS LYS A . n A 1 106 ASP 106 105 105 ASP ASP A . n A 1 107 SER 107 106 106 SER SER A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 ASP 109 108 108 ASP ASP A . n A 1 110 VAL 110 109 109 VAL VAL A . n A 1 111 PRO 111 110 110 PRO PRO A . n A 1 112 MET 112 111 111 MET MET A . n A 1 113 VAL 113 112 112 VAL VAL A . n A 1 114 LEU 114 113 113 LEU LEU A . n A 1 115 VAL 115 114 114 VAL VAL A . n A 1 116 GLY 116 115 115 GLY GLY A . n A 1 117 ASN 117 116 116 ASN ASN A . n A 1 118 LYS 118 117 117 LYS LYS A . n A 1 119 SER 119 118 118 SER SER A . n A 1 120 ASP 120 119 119 ASP ASP A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 PRO 122 121 121 PRO PRO A . n A 1 123 SER 123 122 122 SER SER A . n A 1 124 ARG 124 123 123 ARG ARG A . n A 1 125 THR 125 124 124 THR THR A . n A 1 126 VAL 126 125 125 VAL VAL A . n A 1 127 ASP 127 126 126 ASP ASP A . n A 1 128 THR 128 127 127 THR THR A . n A 1 129 LYS 129 128 128 LYS LYS A . n A 1 130 GLN 130 129 129 GLN GLN A . n A 1 131 ALA 131 130 130 ALA ALA A . n A 1 132 GLN 132 131 131 GLN GLN A . n A 1 133 ASP 133 132 132 ASP ASP A . n A 1 134 LEU 134 133 133 LEU LEU A . n A 1 135 ALA 135 134 134 ALA ALA A . n A 1 136 ARG 136 135 135 ARG ARG A . n A 1 137 SER 137 136 136 SER SER A . n A 1 138 TYR 138 137 137 TYR TYR A . n A 1 139 GLY 139 138 138 GLY GLY A . n A 1 140 ILE 140 139 139 ILE ILE A . n A 1 141 PRO 141 140 140 PRO PRO A . n A 1 142 PHE 142 141 141 PHE PHE A . n A 1 143 ILE 143 142 142 ILE ILE A . n A 1 144 GLU 144 143 143 GLU GLU A . n A 1 145 THR 145 144 144 THR THR A . n A 1 146 SER 146 145 145 SER SER A . n A 1 147 ALA 147 146 146 ALA ALA A . n A 1 148 LYS 148 147 147 LYS LYS A . n A 1 149 THR 149 148 148 THR THR A . n A 1 150 ARG 150 149 149 ARG ARG A . n A 1 151 GLN 151 150 150 GLN GLN A . n A 1 152 ARG 152 151 151 ARG GLY A . n A 1 153 VAL 153 152 152 VAL VAL A . n A 1 154 ASP 154 153 153 ASP ASP A . n A 1 155 ASP 155 154 154 ASP ASP A . n A 1 156 ALA 156 155 155 ALA ALA A . n A 1 157 PHE 157 156 156 PHE PHE A . n A 1 158 TYR 158 157 157 TYR TYR A . n A 1 159 THR 159 158 158 THR THR A . n A 1 160 LEU 160 159 159 LEU LEU A . n A 1 161 VAL 161 160 160 VAL VAL A . n A 1 162 ARG 162 161 161 ARG ARG A . n A 1 163 GLU 163 162 162 GLU GLU A . n A 1 164 ILE 164 163 163 ILE ILE A . n A 1 165 ARG 165 164 164 ARG ARG A . n A 1 166 LYS 166 165 165 LYS LYS A . n A 1 167 HIS 167 166 166 HIS HIS A . n A 1 168 LYS 168 167 167 LYS LYS A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id PUO _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id PUO _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 201 201 MG MG A . C 3 GDP 1 202 206 GDP GDP A . D 4 PUO 1 203 301 PUO INH A . E 5 HOH 1 301 100 HOH HOH A . E 5 HOH 2 302 88 HOH HOH A . E 5 HOH 3 303 66 HOH HOH A . E 5 HOH 4 304 45 HOH HOH A . E 5 HOH 5 305 120 HOH HOH A . E 5 HOH 6 306 86 HOH HOH A . E 5 HOH 7 307 58 HOH HOH A . E 5 HOH 8 308 96 HOH HOH A . E 5 HOH 9 309 87 HOH HOH A . E 5 HOH 10 310 50 HOH HOH A . E 5 HOH 11 311 29 HOH HOH A . E 5 HOH 12 312 6 HOH HOH A . E 5 HOH 13 313 91 HOH HOH A . E 5 HOH 14 314 64 HOH HOH A . E 5 HOH 15 315 106 HOH HOH A . E 5 HOH 16 316 48 HOH HOH A . E 5 HOH 17 317 27 HOH HOH A . E 5 HOH 18 318 61 HOH HOH A . E 5 HOH 19 319 35 HOH HOH A . E 5 HOH 20 320 84 HOH HOH A . E 5 HOH 21 321 111 HOH HOH A . E 5 HOH 22 322 55 HOH HOH A . E 5 HOH 23 323 33 HOH HOH A . E 5 HOH 24 324 119 HOH HOH A . E 5 HOH 25 325 7 HOH HOH A . E 5 HOH 26 326 26 HOH HOH A . E 5 HOH 27 327 56 HOH HOH A . E 5 HOH 28 328 54 HOH HOH A . E 5 HOH 29 329 46 HOH HOH A . E 5 HOH 30 330 116 HOH HOH A . E 5 HOH 31 331 83 HOH HOH A . E 5 HOH 32 332 1 HOH HOH A . E 5 HOH 33 333 102 HOH HOH A . E 5 HOH 34 334 19 HOH HOH A . E 5 HOH 35 335 90 HOH HOH A . E 5 HOH 36 336 16 HOH HOH A . E 5 HOH 37 337 5 HOH HOH A . E 5 HOH 38 338 25 HOH HOH A . E 5 HOH 39 339 98 HOH HOH A . E 5 HOH 40 340 17 HOH HOH A . E 5 HOH 41 341 31 HOH HOH A . E 5 HOH 42 342 59 HOH HOH A . E 5 HOH 43 343 21 HOH HOH A . E 5 HOH 44 344 70 HOH HOH A . E 5 HOH 45 345 113 HOH HOH A . E 5 HOH 46 346 12 HOH HOH A . E 5 HOH 47 347 49 HOH HOH A . E 5 HOH 48 348 109 HOH HOH A . E 5 HOH 49 349 63 HOH HOH A . E 5 HOH 50 350 20 HOH HOH A . E 5 HOH 51 351 82 HOH HOH A . E 5 HOH 52 352 18 HOH HOH A . E 5 HOH 53 353 14 HOH HOH A . E 5 HOH 54 354 3 HOH HOH A . E 5 HOH 55 355 2 HOH HOH A . E 5 HOH 56 356 107 HOH HOH A . E 5 HOH 57 357 44 HOH HOH A . E 5 HOH 58 358 92 HOH HOH A . E 5 HOH 59 359 52 HOH HOH A . E 5 HOH 60 360 34 HOH HOH A . E 5 HOH 61 361 23 HOH HOH A . E 5 HOH 62 362 42 HOH HOH A . E 5 HOH 63 363 36 HOH HOH A . E 5 HOH 64 364 10 HOH HOH A . E 5 HOH 65 365 76 HOH HOH A . E 5 HOH 66 366 94 HOH HOH A . E 5 HOH 67 367 22 HOH HOH A . E 5 HOH 68 368 117 HOH HOH A . E 5 HOH 69 369 99 HOH HOH A . E 5 HOH 70 370 93 HOH HOH A . E 5 HOH 71 371 4 HOH HOH A . E 5 HOH 72 372 24 HOH HOH A . E 5 HOH 73 373 39 HOH HOH A . E 5 HOH 74 374 8 HOH HOH A . E 5 HOH 75 375 73 HOH HOH A . E 5 HOH 76 376 115 HOH HOH A . E 5 HOH 77 377 97 HOH HOH A . E 5 HOH 78 378 77 HOH HOH A . E 5 HOH 79 379 108 HOH HOH A . E 5 HOH 80 380 51 HOH HOH A . E 5 HOH 81 381 62 HOH HOH A . E 5 HOH 82 382 9 HOH HOH A . E 5 HOH 83 383 71 HOH HOH A . E 5 HOH 84 384 114 HOH HOH A . E 5 HOH 85 385 43 HOH HOH A . E 5 HOH 86 386 101 HOH HOH A . E 5 HOH 87 387 105 HOH HOH A . E 5 HOH 88 388 80 HOH HOH A . E 5 HOH 89 389 104 HOH HOH A . E 5 HOH 90 390 53 HOH HOH A . E 5 HOH 91 391 38 HOH HOH A . E 5 HOH 92 392 72 HOH HOH A . E 5 HOH 93 393 30 HOH HOH A . E 5 HOH 94 394 37 HOH HOH A . E 5 HOH 95 395 11 HOH HOH A . E 5 HOH 96 396 28 HOH HOH A . E 5 HOH 97 397 32 HOH HOH A . E 5 HOH 98 398 15 HOH HOH A . E 5 HOH 99 399 13 HOH HOH A . E 5 HOH 100 400 81 HOH HOH A . E 5 HOH 101 401 112 HOH HOH A . E 5 HOH 102 402 78 HOH HOH A . E 5 HOH 103 403 89 HOH HOH A . E 5 HOH 104 404 118 HOH HOH A . E 5 HOH 105 405 47 HOH HOH A . E 5 HOH 106 406 65 HOH HOH A . E 5 HOH 107 407 85 HOH HOH A . E 5 HOH 108 408 60 HOH HOH A . E 5 HOH 109 409 110 HOH HOH A . E 5 HOH 110 410 41 HOH HOH A . E 5 HOH 111 411 67 HOH HOH A . E 5 HOH 112 412 74 HOH HOH A . E 5 HOH 113 413 121 HOH HOH A . E 5 HOH 114 414 95 HOH HOH A . E 5 HOH 115 415 79 HOH HOH A . E 5 HOH 116 416 123 HOH HOH A . E 5 HOH 117 417 68 HOH HOH A . E 5 HOH 118 418 122 HOH HOH A . E 5 HOH 119 419 69 HOH HOH A . E 5 HOH 120 420 75 HOH HOH A . E 5 HOH 121 421 103 HOH HOH A . E 5 HOH 122 422 40 HOH HOH A . E 5 HOH 123 423 124 HOH HOH A . E 5 HOH 124 424 57 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 151 ? CB ? A ARG 152 CB 2 1 Y 1 A ARG 151 ? CG ? A ARG 152 CG 3 1 Y 1 A ARG 151 ? CD ? A ARG 152 CD 4 1 Y 1 A ARG 151 ? NE ? A ARG 152 NE 5 1 Y 1 A ARG 151 ? CZ ? A ARG 152 CZ 6 1 Y 1 A ARG 151 ? NH1 ? A ARG 152 NH1 7 1 Y 1 A ARG 151 ? NH2 ? A ARG 152 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8B78 _cell.details ? _cell.formula_units_Z ? _cell.length_a 94.360 _cell.length_a_esd ? _cell.length_b 94.360 _cell.length_b_esd ? _cell.length_c 122.470 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8B78 _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8B78 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.75 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;PEG 3350 LITHIUM SULFATE ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100.000 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-07-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97948 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97948 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8B78 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.11 _reflns.d_resolution_low 67.98 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 66898 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 85.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.2 _reflns.pdbx_Rmerge_I_obs 0.08 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.09 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 1.11 _reflns_shell.d_res_low 1.17 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 700 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.372 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.0000 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -0.0000 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] 0.0000 _refine.B_iso_max 75.440 _refine.B_iso_mean 20.8350 _refine.B_iso_min 10.290 _refine.correlation_coeff_Fo_to_Fc 0.9510 _refine.correlation_coeff_Fo_to_Fc_free 0.9370 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8B78 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.1100 _refine.ls_d_res_low 67.9800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 66898 _refine.ls_number_reflns_R_free 3482 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 85.0300 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2243 _refine.ls_R_factor_R_free 0.2357 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2236 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1o83 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.0420 _refine.pdbx_overall_ESU_R_Free 0.0420 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 0.4430 _refine.overall_SU_ML 0.0220 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.1100 _refine_hist.d_res_low 67.9800 _refine_hist.number_atoms_solvent 124 _refine_hist.number_atoms_total 1524 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 168 _refine_hist.pdbx_B_iso_mean_ligand 19.15 _refine_hist.pdbx_B_iso_mean_solvent 30.01 _refine_hist.pdbx_number_atoms_protein 1340 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 60 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.11 _refine_ls_shell.d_res_low 1.1380 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 51 _refine_ls_shell.number_reflns_R_work 1074 _refine_ls_shell.percent_reflns_obs 18.4600 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2870 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3120 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 8B78 _struct.title 'KRasG12C ligand complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8B78 _struct_keywords.text 'INHIBITOR COMPLEX, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RASK_HUMAN _struct_ref.pdbx_db_accession P01116 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLC VFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLV REIR ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8B78 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 165 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01116 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 164 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 164 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8B78 GLY A 1 ? UNP P01116 ? ? 'expression tag' 0 1 1 8B78 CYS A 13 ? UNP P01116 GLY 12 'engineered mutation' 12 2 1 8B78 SER A 52 ? UNP P01116 CYS 51 'engineered mutation' 51 3 1 8B78 LEU A 81 ? UNP P01116 CYS 80 'engineered mutation' 80 4 1 8B78 SER A 119 ? UNP P01116 CYS 118 'engineered mutation' 118 5 1 8B78 ASP A 154 ? UNP P01116 GLU 153 conflict 153 6 1 8B78 LYS A 166 ? UNP P01116 ? ? 'expression tag' 165 7 1 8B78 HIS A 167 ? UNP P01116 ? ? 'expression tag' 166 8 1 8B78 LYS A 168 ? UNP P01116 ? ? 'expression tag' 167 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 16 ? ASN A 27 ? GLY A 15 ASN A 26 1 ? 12 HELX_P HELX_P2 AA2 SER A 66 ? GLY A 76 ? SER A 65 GLY A 75 1 ? 11 HELX_P HELX_P3 AA3 ASN A 87 ? ASP A 106 ? ASN A 86 ASP A 105 1 ? 20 HELX_P HELX_P4 AA4 ASP A 127 ? GLY A 139 ? ASP A 126 GLY A 138 1 ? 13 HELX_P HELX_P5 AA5 ARG A 152 ? LYS A 168 ? ARG A 151 LYS A 167 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 13 SG ? ? ? 1_555 D PUO . C ? ? A CYS 12 A PUO 203 1_555 ? ? ? ? ? ? ? 1.810 ? ? metalc1 metalc ? ? A SER 18 OG ? ? ? 1_555 B MG . MG ? ? A SER 17 A MG 201 1_555 ? ? ? ? ? ? ? 2.113 ? ? metalc2 metalc ? ? B MG . MG ? ? ? 1_555 C GDP . O3B ? ? A MG 201 A GDP 202 1_555 ? ? ? ? ? ? ? 2.056 ? ? metalc3 metalc ? ? B MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 201 A HOH 317 1_555 ? ? ? ? ? ? ? 2.050 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 201 A HOH 326 1_555 ? ? ? ? ? ? ? 2.082 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 201 A HOH 343 1_555 ? ? ? ? ? ? ? 2.124 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 201 A HOH 367 1_555 ? ? ? ? ? ? ? 2.102 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OG ? A SER 18 ? A SER 17 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O3B ? C GDP . ? A GDP 202 ? 1_555 91.4 ? 2 OG ? A SER 18 ? A SER 17 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? E HOH . ? A HOH 317 ? 1_555 83.8 ? 3 O3B ? C GDP . ? A GDP 202 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? E HOH . ? A HOH 317 ? 1_555 93.7 ? 4 OG ? A SER 18 ? A SER 17 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? E HOH . ? A HOH 326 ? 1_555 92.9 ? 5 O3B ? C GDP . ? A GDP 202 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? E HOH . ? A HOH 326 ? 1_555 87.6 ? 6 O ? E HOH . ? A HOH 317 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? E HOH . ? A HOH 326 ? 1_555 176.5 ? 7 OG ? A SER 18 ? A SER 17 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? E HOH . ? A HOH 343 ? 1_555 175.0 ? 8 O3B ? C GDP . ? A GDP 202 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? E HOH . ? A HOH 343 ? 1_555 90.6 ? 9 O ? E HOH . ? A HOH 317 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? E HOH . ? A HOH 343 ? 1_555 91.4 ? 10 O ? E HOH . ? A HOH 326 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? E HOH . ? A HOH 343 ? 1_555 91.8 ? 11 OG ? A SER 18 ? A SER 17 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? E HOH . ? A HOH 367 ? 1_555 88.7 ? 12 O3B ? C GDP . ? A GDP 202 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? E HOH . ? A HOH 367 ? 1_555 174.8 ? 13 O ? E HOH . ? A HOH 317 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? E HOH . ? A HOH 367 ? 1_555 91.5 ? 14 O ? E HOH . ? A HOH 326 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? E HOH . ? A HOH 367 ? 1_555 87.2 ? 15 O ? E HOH . ? A HOH 343 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? E HOH . ? A HOH 367 ? 1_555 89.8 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id PUO _pdbx_modification_feature.label_asym_id D _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 13 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id PUO _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 203 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 12 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id PUO _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 39 ? ILE A 47 ? ASP A 38 ILE A 46 AA1 2 GLU A 50 ? ASP A 58 ? GLU A 49 ASP A 57 AA1 3 THR A 3 ? VAL A 10 ? THR A 2 VAL A 9 AA1 4 GLY A 78 ? ALA A 84 ? GLY A 77 ALA A 83 AA1 5 MET A 112 ? ASN A 117 ? MET A 111 ASN A 116 AA1 6 PHE A 142 ? GLU A 144 ? PHE A 141 GLU A 143 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 43 ? N LYS A 42 O LEU A 54 ? O LEU A 53 AA1 2 3 O LEU A 57 ? O LEU A 56 N VAL A 9 ? N VAL A 8 AA1 3 4 N VAL A 10 ? N VAL A 9 O LEU A 80 ? O LEU A 79 AA1 4 5 N PHE A 83 ? N PHE A 82 O ASN A 117 ? O ASN A 116 AA1 5 6 N LEU A 114 ? N LEU A 113 O ILE A 143 ? O ILE A 142 # _pdbx_entry_details.entry_id 8B78 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 C A LYS 167 ? ? O A HOH 305 ? ? 1.52 2 1 N A TYR 64 ? ? O A HOH 301 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 309 ? ? 1_555 O A HOH 309 ? ? 6_555 1.06 2 1 O A HOH 349 ? ? 1_555 O A HOH 349 ? ? 4_555 1.90 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A MET 1 ? ? SD A MET 1 ? ? 1.637 1.807 -0.170 0.026 N 2 1 CB A SER 17 ? ? OG A SER 17 ? ? 1.336 1.418 -0.082 0.013 N 3 1 CZ A TYR 96 ? ? CE2 A TYR 96 ? ? 1.301 1.381 -0.080 0.013 N 4 1 CA A ARG 123 ? ? CB A ARG 123 ? ? 1.402 1.535 -0.133 0.022 N 5 1 CB A ASP 126 ? ? CG A ASP 126 ? ? 1.322 1.513 -0.191 0.021 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 30 ? ? CG A ASP 30 ? ? OD1 A ASP 30 ? ? 124.47 118.30 6.17 0.90 N 2 1 CB A ASP 33 ? ? CG A ASP 33 ? ? OD1 A ASP 33 ? ? 129.91 118.30 11.61 0.90 N 3 1 OE1 A GLU 37 ? ? CD A GLU 37 ? ? OE2 A GLU 37 ? ? 115.98 123.30 -7.32 1.20 N 4 1 CD A LYS 42 ? ? CE A LYS 42 ? ? NZ A LYS 42 ? ? 130.95 111.70 19.25 2.30 N 5 1 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH2 A ARG 97 ? ? 124.32 120.30 4.02 0.50 N 6 1 CB A ASP 126 ? ? CG A ASP 126 ? ? OD1 A ASP 126 ? ? 126.02 118.30 7.72 0.90 N 7 1 CB A ASP 126 ? ? CG A ASP 126 ? ? OD2 A ASP 126 ? ? 111.57 118.30 -6.73 0.90 N 8 1 NE A ARG 135 ? ? CZ A ARG 135 ? ? NH1 A ARG 135 ? ? 115.98 120.30 -4.32 0.50 N 9 1 NE A ARG 135 ? ? CZ A ARG 135 ? ? NH2 A ARG 135 ? ? 126.27 120.30 5.97 0.50 N 10 1 NE A ARG 161 ? ? CZ A ARG 161 ? ? NH2 A ARG 161 ? ? 115.96 120.30 -4.34 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 33 ? ? -39.63 115.37 2 1 GLU A 62 ? ? -90.16 32.10 3 1 GLU A 63 ? ? 15.45 -108.94 4 1 LYS A 117 ? ? 77.83 34.17 5 1 SER A 122 ? ? -85.98 41.08 6 1 ARG A 149 ? ? 77.88 -0.72 7 1 ARG A 151 ? ? 78.85 -5.20 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 306 ? E HOH . 2 1 A HOH 421 ? E HOH . 3 1 A HOH 422 ? E HOH . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GDP PB P N N 88 GDP O1B O N N 89 GDP O2B O N N 90 GDP O3B O N N 91 GDP O3A O N N 92 GDP PA P N N 93 GDP O1A O N N 94 GDP O2A O N N 95 GDP "O5'" O N N 96 GDP "C5'" C N N 97 GDP "C4'" C N R 98 GDP "O4'" O N N 99 GDP "C3'" C N S 100 GDP "O3'" O N N 101 GDP "C2'" C N R 102 GDP "O2'" O N N 103 GDP "C1'" C N R 104 GDP N9 N Y N 105 GDP C8 C Y N 106 GDP N7 N Y N 107 GDP C5 C Y N 108 GDP C6 C N N 109 GDP O6 O N N 110 GDP N1 N N N 111 GDP C2 C N N 112 GDP N2 N N N 113 GDP N3 N N N 114 GDP C4 C Y N 115 GDP HOB2 H N N 116 GDP HOB3 H N N 117 GDP HOA2 H N N 118 GDP "H5'" H N N 119 GDP "H5''" H N N 120 GDP "H4'" H N N 121 GDP "H3'" H N N 122 GDP "HO3'" H N N 123 GDP "H2'" H N N 124 GDP "HO2'" H N N 125 GDP "H1'" H N N 126 GDP H8 H N N 127 GDP HN1 H N N 128 GDP HN21 H N N 129 GDP HN22 H N N 130 GLN N N N N 131 GLN CA C N S 132 GLN C C N N 133 GLN O O N N 134 GLN CB C N N 135 GLN CG C N N 136 GLN CD C N N 137 GLN OE1 O N N 138 GLN NE2 N N N 139 GLN OXT O N N 140 GLN H H N N 141 GLN H2 H N N 142 GLN HA H N N 143 GLN HB2 H N N 144 GLN HB3 H N N 145 GLN HG2 H N N 146 GLN HG3 H N N 147 GLN HE21 H N N 148 GLN HE22 H N N 149 GLN HXT H N N 150 GLU N N N N 151 GLU CA C N S 152 GLU C C N N 153 GLU O O N N 154 GLU CB C N N 155 GLU CG C N N 156 GLU CD C N N 157 GLU OE1 O N N 158 GLU OE2 O N N 159 GLU OXT O N N 160 GLU H H N N 161 GLU H2 H N N 162 GLU HA H N N 163 GLU HB2 H N N 164 GLU HB3 H N N 165 GLU HG2 H N N 166 GLU HG3 H N N 167 GLU HE2 H N N 168 GLU HXT H N N 169 GLY N N N N 170 GLY CA C N N 171 GLY C C N N 172 GLY O O N N 173 GLY OXT O N N 174 GLY H H N N 175 GLY H2 H N N 176 GLY HA2 H N N 177 GLY HA3 H N N 178 GLY HXT H N N 179 HIS N N N N 180 HIS CA C N S 181 HIS C C N N 182 HIS O O N N 183 HIS CB C N N 184 HIS CG C Y N 185 HIS ND1 N Y N 186 HIS CD2 C Y N 187 HIS CE1 C Y N 188 HIS NE2 N Y N 189 HIS OXT O N N 190 HIS H H N N 191 HIS H2 H N N 192 HIS HA H N N 193 HIS HB2 H N N 194 HIS HB3 H N N 195 HIS HD1 H N N 196 HIS HD2 H N N 197 HIS HE1 H N N 198 HIS HE2 H N N 199 HIS HXT H N N 200 HOH O O N N 201 HOH H1 H N N 202 HOH H2 H N N 203 ILE N N N N 204 ILE CA C N S 205 ILE C C N N 206 ILE O O N N 207 ILE CB C N S 208 ILE CG1 C N N 209 ILE CG2 C N N 210 ILE CD1 C N N 211 ILE OXT O N N 212 ILE H H N N 213 ILE H2 H N N 214 ILE HA H N N 215 ILE HB H N N 216 ILE HG12 H N N 217 ILE HG13 H N N 218 ILE HG21 H N N 219 ILE HG22 H N N 220 ILE HG23 H N N 221 ILE HD11 H N N 222 ILE HD12 H N N 223 ILE HD13 H N N 224 ILE HXT H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 MET N N N N 273 MET CA C N S 274 MET C C N N 275 MET O O N N 276 MET CB C N N 277 MET CG C N N 278 MET SD S N N 279 MET CE C N N 280 MET OXT O N N 281 MET H H N N 282 MET H2 H N N 283 MET HA H N N 284 MET HB2 H N N 285 MET HB3 H N N 286 MET HG2 H N N 287 MET HG3 H N N 288 MET HE1 H N N 289 MET HE2 H N N 290 MET HE3 H N N 291 MET HXT H N N 292 MG MG MG N N 293 PHE N N N N 294 PHE CA C N S 295 PHE C C N N 296 PHE O O N N 297 PHE CB C N N 298 PHE CG C Y N 299 PHE CD1 C Y N 300 PHE CD2 C Y N 301 PHE CE1 C Y N 302 PHE CE2 C Y N 303 PHE CZ C Y N 304 PHE OXT O N N 305 PHE H H N N 306 PHE H2 H N N 307 PHE HA H N N 308 PHE HB2 H N N 309 PHE HB3 H N N 310 PHE HD1 H N N 311 PHE HD2 H N N 312 PHE HE1 H N N 313 PHE HE2 H N N 314 PHE HZ H N N 315 PHE HXT H N N 316 PRO N N N N 317 PRO CA C N S 318 PRO C C N N 319 PRO O O N N 320 PRO CB C N N 321 PRO CG C N N 322 PRO CD C N N 323 PRO OXT O N N 324 PRO H H N N 325 PRO HA H N N 326 PRO HB2 H N N 327 PRO HB3 H N N 328 PRO HG2 H N N 329 PRO HG3 H N N 330 PRO HD2 H N N 331 PRO HD3 H N N 332 PRO HXT H N N 333 PUO C1 C N N 334 PUO C2 C N N 335 PUO C3 C N N 336 PUO C7 C Y N 337 PUO C8 C Y N 338 PUO C9 C Y N 339 PUO C10 C Y N 340 PUO C11 C Y N 341 PUO C12 C N N 342 PUO C13 C N R 343 PUO C14 C N N 344 PUO C15 C Y N 345 PUO C16 C Y N 346 PUO C19 C Y N 347 PUO C20 C Y N 348 PUO C21 C N N 349 PUO C22 C N N 350 PUO CL CL N N 351 PUO C18 C Y N 352 PUO C17 C Y N 353 PUO O2 O N N 354 PUO C23 C N N 355 PUO F F N N 356 PUO C6 C Y N 357 PUO C5 C N N 358 PUO O1 O N N 359 PUO N1 N N N 360 PUO C4 C N N 361 PUO N N N N 362 PUO O O N N 363 PUO C C N N 364 PUO H1 H N N 365 PUO H2 H N N 366 PUO H3 H N N 367 PUO H4 H N N 368 PUO H5 H N N 369 PUO H6 H N N 370 PUO H7 H N N 371 PUO H8 H N N 372 PUO H9 H N N 373 PUO H10 H N N 374 PUO H11 H N N 375 PUO H12 H N N 376 PUO H13 H N N 377 PUO H14 H N N 378 PUO H15 H N N 379 PUO H16 H N N 380 PUO H17 H N N 381 PUO H18 H N N 382 PUO H19 H N N 383 PUO H21 H N N 384 PUO H22 H N N 385 PUO H23 H N N 386 PUO H24 H N N 387 PUO H25 H N N 388 SER N N N N 389 SER CA C N S 390 SER C C N N 391 SER O O N N 392 SER CB C N N 393 SER OG O N N 394 SER OXT O N N 395 SER H H N N 396 SER H2 H N N 397 SER HA H N N 398 SER HB2 H N N 399 SER HB3 H N N 400 SER HG H N N 401 SER HXT H N N 402 THR N N N N 403 THR CA C N S 404 THR C C N N 405 THR O O N N 406 THR CB C N R 407 THR OG1 O N N 408 THR CG2 C N N 409 THR OXT O N N 410 THR H H N N 411 THR H2 H N N 412 THR HA H N N 413 THR HB H N N 414 THR HG1 H N N 415 THR HG21 H N N 416 THR HG22 H N N 417 THR HG23 H N N 418 THR HXT H N N 419 TYR N N N N 420 TYR CA C N S 421 TYR C C N N 422 TYR O O N N 423 TYR CB C N N 424 TYR CG C Y N 425 TYR CD1 C Y N 426 TYR CD2 C Y N 427 TYR CE1 C Y N 428 TYR CE2 C Y N 429 TYR CZ C Y N 430 TYR OH O N N 431 TYR OXT O N N 432 TYR H H N N 433 TYR H2 H N N 434 TYR HA H N N 435 TYR HB2 H N N 436 TYR HB3 H N N 437 TYR HD1 H N N 438 TYR HD2 H N N 439 TYR HE1 H N N 440 TYR HE2 H N N 441 TYR HH H N N 442 TYR HXT H N N 443 VAL N N N N 444 VAL CA C N S 445 VAL C C N N 446 VAL O O N N 447 VAL CB C N N 448 VAL CG1 C N N 449 VAL CG2 C N N 450 VAL OXT O N N 451 VAL H H N N 452 VAL H2 H N N 453 VAL HA H N N 454 VAL HB H N N 455 VAL HG11 H N N 456 VAL HG12 H N N 457 VAL HG13 H N N 458 VAL HG21 H N N 459 VAL HG22 H N N 460 VAL HG23 H N N 461 VAL HXT H N N 462 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GDP PB O1B doub N N 83 GDP PB O2B sing N N 84 GDP PB O3B sing N N 85 GDP PB O3A sing N N 86 GDP O2B HOB2 sing N N 87 GDP O3B HOB3 sing N N 88 GDP O3A PA sing N N 89 GDP PA O1A doub N N 90 GDP PA O2A sing N N 91 GDP PA "O5'" sing N N 92 GDP O2A HOA2 sing N N 93 GDP "O5'" "C5'" sing N N 94 GDP "C5'" "C4'" sing N N 95 GDP "C5'" "H5'" sing N N 96 GDP "C5'" "H5''" sing N N 97 GDP "C4'" "O4'" sing N N 98 GDP "C4'" "C3'" sing N N 99 GDP "C4'" "H4'" sing N N 100 GDP "O4'" "C1'" sing N N 101 GDP "C3'" "O3'" sing N N 102 GDP "C3'" "C2'" sing N N 103 GDP "C3'" "H3'" sing N N 104 GDP "O3'" "HO3'" sing N N 105 GDP "C2'" "O2'" sing N N 106 GDP "C2'" "C1'" sing N N 107 GDP "C2'" "H2'" sing N N 108 GDP "O2'" "HO2'" sing N N 109 GDP "C1'" N9 sing N N 110 GDP "C1'" "H1'" sing N N 111 GDP N9 C8 sing Y N 112 GDP N9 C4 sing Y N 113 GDP C8 N7 doub Y N 114 GDP C8 H8 sing N N 115 GDP N7 C5 sing Y N 116 GDP C5 C6 sing N N 117 GDP C5 C4 doub Y N 118 GDP C6 O6 doub N N 119 GDP C6 N1 sing N N 120 GDP N1 C2 sing N N 121 GDP N1 HN1 sing N N 122 GDP C2 N2 sing N N 123 GDP C2 N3 doub N N 124 GDP N2 HN21 sing N N 125 GDP N2 HN22 sing N N 126 GDP N3 C4 sing N N 127 GLN N CA sing N N 128 GLN N H sing N N 129 GLN N H2 sing N N 130 GLN CA C sing N N 131 GLN CA CB sing N N 132 GLN CA HA sing N N 133 GLN C O doub N N 134 GLN C OXT sing N N 135 GLN CB CG sing N N 136 GLN CB HB2 sing N N 137 GLN CB HB3 sing N N 138 GLN CG CD sing N N 139 GLN CG HG2 sing N N 140 GLN CG HG3 sing N N 141 GLN CD OE1 doub N N 142 GLN CD NE2 sing N N 143 GLN NE2 HE21 sing N N 144 GLN NE2 HE22 sing N N 145 GLN OXT HXT sing N N 146 GLU N CA sing N N 147 GLU N H sing N N 148 GLU N H2 sing N N 149 GLU CA C sing N N 150 GLU CA CB sing N N 151 GLU CA HA sing N N 152 GLU C O doub N N 153 GLU C OXT sing N N 154 GLU CB CG sing N N 155 GLU CB HB2 sing N N 156 GLU CB HB3 sing N N 157 GLU CG CD sing N N 158 GLU CG HG2 sing N N 159 GLU CG HG3 sing N N 160 GLU CD OE1 doub N N 161 GLU CD OE2 sing N N 162 GLU OE2 HE2 sing N N 163 GLU OXT HXT sing N N 164 GLY N CA sing N N 165 GLY N H sing N N 166 GLY N H2 sing N N 167 GLY CA C sing N N 168 GLY CA HA2 sing N N 169 GLY CA HA3 sing N N 170 GLY C O doub N N 171 GLY C OXT sing N N 172 GLY OXT HXT sing N N 173 HIS N CA sing N N 174 HIS N H sing N N 175 HIS N H2 sing N N 176 HIS CA C sing N N 177 HIS CA CB sing N N 178 HIS CA HA sing N N 179 HIS C O doub N N 180 HIS C OXT sing N N 181 HIS CB CG sing N N 182 HIS CB HB2 sing N N 183 HIS CB HB3 sing N N 184 HIS CG ND1 sing Y N 185 HIS CG CD2 doub Y N 186 HIS ND1 CE1 doub Y N 187 HIS ND1 HD1 sing N N 188 HIS CD2 NE2 sing Y N 189 HIS CD2 HD2 sing N N 190 HIS CE1 NE2 sing Y N 191 HIS CE1 HE1 sing N N 192 HIS NE2 HE2 sing N N 193 HIS OXT HXT sing N N 194 HOH O H1 sing N N 195 HOH O H2 sing N N 196 ILE N CA sing N N 197 ILE N H sing N N 198 ILE N H2 sing N N 199 ILE CA C sing N N 200 ILE CA CB sing N N 201 ILE CA HA sing N N 202 ILE C O doub N N 203 ILE C OXT sing N N 204 ILE CB CG1 sing N N 205 ILE CB CG2 sing N N 206 ILE CB HB sing N N 207 ILE CG1 CD1 sing N N 208 ILE CG1 HG12 sing N N 209 ILE CG1 HG13 sing N N 210 ILE CG2 HG21 sing N N 211 ILE CG2 HG22 sing N N 212 ILE CG2 HG23 sing N N 213 ILE CD1 HD11 sing N N 214 ILE CD1 HD12 sing N N 215 ILE CD1 HD13 sing N N 216 ILE OXT HXT sing N N 217 LEU N CA sing N N 218 LEU N H sing N N 219 LEU N H2 sing N N 220 LEU CA C sing N N 221 LEU CA CB sing N N 222 LEU CA HA sing N N 223 LEU C O doub N N 224 LEU C OXT sing N N 225 LEU CB CG sing N N 226 LEU CB HB2 sing N N 227 LEU CB HB3 sing N N 228 LEU CG CD1 sing N N 229 LEU CG CD2 sing N N 230 LEU CG HG sing N N 231 LEU CD1 HD11 sing N N 232 LEU CD1 HD12 sing N N 233 LEU CD1 HD13 sing N N 234 LEU CD2 HD21 sing N N 235 LEU CD2 HD22 sing N N 236 LEU CD2 HD23 sing N N 237 LEU OXT HXT sing N N 238 LYS N CA sing N N 239 LYS N H sing N N 240 LYS N H2 sing N N 241 LYS CA C sing N N 242 LYS CA CB sing N N 243 LYS CA HA sing N N 244 LYS C O doub N N 245 LYS C OXT sing N N 246 LYS CB CG sing N N 247 LYS CB HB2 sing N N 248 LYS CB HB3 sing N N 249 LYS CG CD sing N N 250 LYS CG HG2 sing N N 251 LYS CG HG3 sing N N 252 LYS CD CE sing N N 253 LYS CD HD2 sing N N 254 LYS CD HD3 sing N N 255 LYS CE NZ sing N N 256 LYS CE HE2 sing N N 257 LYS CE HE3 sing N N 258 LYS NZ HZ1 sing N N 259 LYS NZ HZ2 sing N N 260 LYS NZ HZ3 sing N N 261 LYS OXT HXT sing N N 262 MET N CA sing N N 263 MET N H sing N N 264 MET N H2 sing N N 265 MET CA C sing N N 266 MET CA CB sing N N 267 MET CA HA sing N N 268 MET C O doub N N 269 MET C OXT sing N N 270 MET CB CG sing N N 271 MET CB HB2 sing N N 272 MET CB HB3 sing N N 273 MET CG SD sing N N 274 MET CG HG2 sing N N 275 MET CG HG3 sing N N 276 MET SD CE sing N N 277 MET CE HE1 sing N N 278 MET CE HE2 sing N N 279 MET CE HE3 sing N N 280 MET OXT HXT sing N N 281 PHE N CA sing N N 282 PHE N H sing N N 283 PHE N H2 sing N N 284 PHE CA C sing N N 285 PHE CA CB sing N N 286 PHE CA HA sing N N 287 PHE C O doub N N 288 PHE C OXT sing N N 289 PHE CB CG sing N N 290 PHE CB HB2 sing N N 291 PHE CB HB3 sing N N 292 PHE CG CD1 doub Y N 293 PHE CG CD2 sing Y N 294 PHE CD1 CE1 sing Y N 295 PHE CD1 HD1 sing N N 296 PHE CD2 CE2 doub Y N 297 PHE CD2 HD2 sing N N 298 PHE CE1 CZ doub Y N 299 PHE CE1 HE1 sing N N 300 PHE CE2 CZ sing Y N 301 PHE CE2 HE2 sing N N 302 PHE CZ HZ sing N N 303 PHE OXT HXT sing N N 304 PRO N CA sing N N 305 PRO N CD sing N N 306 PRO N H sing N N 307 PRO CA C sing N N 308 PRO CA CB sing N N 309 PRO CA HA sing N N 310 PRO C O doub N N 311 PRO C OXT sing N N 312 PRO CB CG sing N N 313 PRO CB HB2 sing N N 314 PRO CB HB3 sing N N 315 PRO CG CD sing N N 316 PRO CG HG2 sing N N 317 PRO CG HG3 sing N N 318 PRO CD HD2 sing N N 319 PRO CD HD3 sing N N 320 PRO OXT HXT sing N N 321 PUO CL C20 sing N N 322 PUO O1 C11 sing N N 323 PUO O1 C12 sing N N 324 PUO C20 C19 doub Y N 325 PUO C20 C15 sing Y N 326 PUO F C10 sing N N 327 PUO C19 C18 sing Y N 328 PUO C11 C10 doub Y N 329 PUO C11 C6 sing Y N 330 PUO C10 C9 sing Y N 331 PUO C12 C13 sing N N 332 PUO C6 C5 sing N N 333 PUO C6 C7 doub Y N 334 PUO C9 C15 sing N N 335 PUO C9 C8 doub Y N 336 PUO C5 N1 sing N N 337 PUO C15 C16 doub Y N 338 PUO C13 N1 sing N N 339 PUO C13 C14 sing N N 340 PUO C18 C17 doub Y N 341 PUO C8 C7 sing Y N 342 PUO C8 C21 sing N N 343 PUO O C2 doub N N 344 PUO C21 C22 trip N N 345 PUO N1 C4 sing N N 346 PUO C14 N sing N N 347 PUO C22 C23 sing N N 348 PUO C4 C3 sing N N 349 PUO C16 C17 sing Y N 350 PUO C16 O2 sing N N 351 PUO C2 N sing N N 352 PUO C2 C1 sing N N 353 PUO N C3 sing N N 354 PUO C C1 sing N N 355 PUO C1 H1 sing N N 356 PUO C1 H2 sing N N 357 PUO C3 H3 sing N N 358 PUO C3 H4 sing N N 359 PUO C7 H5 sing N N 360 PUO C12 H6 sing N N 361 PUO C12 H7 sing N N 362 PUO C13 H8 sing N N 363 PUO C14 H9 sing N N 364 PUO C14 H10 sing N N 365 PUO C19 H11 sing N N 366 PUO C18 H12 sing N N 367 PUO C17 H13 sing N N 368 PUO O2 H14 sing N N 369 PUO C23 H15 sing N N 370 PUO C23 H16 sing N N 371 PUO C23 H17 sing N N 372 PUO C5 H18 sing N N 373 PUO C5 H19 sing N N 374 PUO C4 H21 sing N N 375 PUO C4 H22 sing N N 376 PUO C H23 sing N N 377 PUO C H24 sing N N 378 PUO C H25 sing N N 379 SER N CA sing N N 380 SER N H sing N N 381 SER N H2 sing N N 382 SER CA C sing N N 383 SER CA CB sing N N 384 SER CA HA sing N N 385 SER C O doub N N 386 SER C OXT sing N N 387 SER CB OG sing N N 388 SER CB HB2 sing N N 389 SER CB HB3 sing N N 390 SER OG HG sing N N 391 SER OXT HXT sing N N 392 THR N CA sing N N 393 THR N H sing N N 394 THR N H2 sing N N 395 THR CA C sing N N 396 THR CA CB sing N N 397 THR CA HA sing N N 398 THR C O doub N N 399 THR C OXT sing N N 400 THR CB OG1 sing N N 401 THR CB CG2 sing N N 402 THR CB HB sing N N 403 THR OG1 HG1 sing N N 404 THR CG2 HG21 sing N N 405 THR CG2 HG22 sing N N 406 THR CG2 HG23 sing N N 407 THR OXT HXT sing N N 408 TYR N CA sing N N 409 TYR N H sing N N 410 TYR N H2 sing N N 411 TYR CA C sing N N 412 TYR CA CB sing N N 413 TYR CA HA sing N N 414 TYR C O doub N N 415 TYR C OXT sing N N 416 TYR CB CG sing N N 417 TYR CB HB2 sing N N 418 TYR CB HB3 sing N N 419 TYR CG CD1 doub Y N 420 TYR CG CD2 sing Y N 421 TYR CD1 CE1 sing Y N 422 TYR CD1 HD1 sing N N 423 TYR CD2 CE2 doub Y N 424 TYR CD2 HD2 sing N N 425 TYR CE1 CZ doub Y N 426 TYR CE1 HE1 sing N N 427 TYR CE2 CZ sing Y N 428 TYR CE2 HE2 sing N N 429 TYR CZ OH sing N N 430 TYR OH HH sing N N 431 TYR OXT HXT sing N N 432 VAL N CA sing N N 433 VAL N H sing N N 434 VAL N H2 sing N N 435 VAL CA C sing N N 436 VAL CA CB sing N N 437 VAL CA HA sing N N 438 VAL C O doub N N 439 VAL C OXT sing N N 440 VAL CB CG1 sing N N 441 VAL CB CG2 sing N N 442 VAL CB HB sing N N 443 VAL CG1 HG11 sing N N 444 VAL CG1 HG12 sing N N 445 VAL CG1 HG13 sing N N 446 VAL CG2 HG21 sing N N 447 VAL CG2 HG22 sing N N 448 VAL CG2 HG23 sing N N 449 VAL OXT HXT sing N N 450 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1O83 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8B78 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010598 _atom_sites.fract_transf_matrix[1][2] 0.006119 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012237 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008165 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL F MG N O P S # loop_