data_8BBM # _entry.id 8BBM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8BBM pdb_00008bbm 10.2210/pdb8bbm/pdb WWPDB D_1292125982 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-09 2 'Structure model' 1 1 2023-07-05 3 'Structure model' 1 2 2024-02-07 4 'Structure model' 1 3 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 2 'Structure model' '_citation_author.name' 12 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8BBM _pdbx_database_status.recvd_initial_deposition_date 2022-10-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email a.perrakis@nki.nl _pdbx_contact_author.name_first Anastassis _pdbx_contact_author.name_last Perrakis _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1151-6227 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'de Vries, I.' 1 0000-0002-8313-7779 'Joosten, R.P.' 2 0000-0002-2323-2686 'Perrakis, A.' 3 0000-0002-1151-6227 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Life Sci Alliance' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2575-1077 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Distant sequence regions of JBP1 contribute to J-DNA binding.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.26508/lsa.202302150 _citation.pdbx_database_id_PubMed 37328191 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'de Vries, I.' 1 0000-0002-8313-7779 primary 'Ammerlaan, D.' 2 ? primary 'Heidebrecht, T.' 3 0000-0001-9616-3944 primary 'Celie, P.H.' 4 0000-0002-6557-078X primary 'Geerke, D.P.' 5 0000-0002-5262-6166 primary 'Joosten, R.P.' 6 0000-0002-2323-2686 primary 'Perrakis, A.' 7 0000-0002-1151-6227 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thymine dioxygenase JBP1' 20537.340 1 1.14.11.6 ? ? ? 2 water nat water 18.015 114 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'J-binding protein 1,Thymidine hydroxylase JBP1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;TNL(MSE)VSTAVEKKKYLDSEFLLHCISAQLLD(MSE)WKQARARWLELVGKEWAH(MSE)LALNPERKDFLWKNQSE (MSE)NSAFFDLCEVGKQV(MSE)LGLLGKEVALPKEEQAFWI(MSE)YAVHLSAACAEELH(MSE)PEVA(MSE)SLRK LNVKLKDFNFGGTRYFKD(MSE)PPEEKKRR(MSE)ERKQRIEEARRHG(MSE)P ; _entity_poly.pdbx_seq_one_letter_code_can ;TNLMVSTAVEKKKYLDSEFLLHCISAQLLDMWKQARARWLELVGKEWAHMLALNPERKDFLWKNQSEMNSAFFDLCEVGK QVMLGLLGKEVALPKEEQAFWIMYAVHLSAACAEELHMPEVAMSLRKLNVKLKDFNFGGTRYFKDMPPEEKKRRMERKQR IEEARRHGMP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 ASN n 1 3 LEU n 1 4 MSE n 1 5 VAL n 1 6 SER n 1 7 THR n 1 8 ALA n 1 9 VAL n 1 10 GLU n 1 11 LYS n 1 12 LYS n 1 13 LYS n 1 14 TYR n 1 15 LEU n 1 16 ASP n 1 17 SER n 1 18 GLU n 1 19 PHE n 1 20 LEU n 1 21 LEU n 1 22 HIS n 1 23 CYS n 1 24 ILE n 1 25 SER n 1 26 ALA n 1 27 GLN n 1 28 LEU n 1 29 LEU n 1 30 ASP n 1 31 MSE n 1 32 TRP n 1 33 LYS n 1 34 GLN n 1 35 ALA n 1 36 ARG n 1 37 ALA n 1 38 ARG n 1 39 TRP n 1 40 LEU n 1 41 GLU n 1 42 LEU n 1 43 VAL n 1 44 GLY n 1 45 LYS n 1 46 GLU n 1 47 TRP n 1 48 ALA n 1 49 HIS n 1 50 MSE n 1 51 LEU n 1 52 ALA n 1 53 LEU n 1 54 ASN n 1 55 PRO n 1 56 GLU n 1 57 ARG n 1 58 LYS n 1 59 ASP n 1 60 PHE n 1 61 LEU n 1 62 TRP n 1 63 LYS n 1 64 ASN n 1 65 GLN n 1 66 SER n 1 67 GLU n 1 68 MSE n 1 69 ASN n 1 70 SER n 1 71 ALA n 1 72 PHE n 1 73 PHE n 1 74 ASP n 1 75 LEU n 1 76 CYS n 1 77 GLU n 1 78 VAL n 1 79 GLY n 1 80 LYS n 1 81 GLN n 1 82 VAL n 1 83 MSE n 1 84 LEU n 1 85 GLY n 1 86 LEU n 1 87 LEU n 1 88 GLY n 1 89 LYS n 1 90 GLU n 1 91 VAL n 1 92 ALA n 1 93 LEU n 1 94 PRO n 1 95 LYS n 1 96 GLU n 1 97 GLU n 1 98 GLN n 1 99 ALA n 1 100 PHE n 1 101 TRP n 1 102 ILE n 1 103 MSE n 1 104 TYR n 1 105 ALA n 1 106 VAL n 1 107 HIS n 1 108 LEU n 1 109 SER n 1 110 ALA n 1 111 ALA n 1 112 CYS n 1 113 ALA n 1 114 GLU n 1 115 GLU n 1 116 LEU n 1 117 HIS n 1 118 MSE n 1 119 PRO n 1 120 GLU n 1 121 VAL n 1 122 ALA n 1 123 MSE n 1 124 SER n 1 125 LEU n 1 126 ARG n 1 127 LYS n 1 128 LEU n 1 129 ASN n 1 130 VAL n 1 131 LYS n 1 132 LEU n 1 133 LYS n 1 134 ASP n 1 135 PHE n 1 136 ASN n 1 137 PHE n 1 138 GLY n 1 139 GLY n 1 140 THR n 1 141 ARG n 1 142 TYR n 1 143 PHE n 1 144 LYS n 1 145 ASP n 1 146 MSE n 1 147 PRO n 1 148 PRO n 1 149 GLU n 1 150 GLU n 1 151 LYS n 1 152 LYS n 1 153 ARG n 1 154 ARG n 1 155 MSE n 1 156 GLU n 1 157 ARG n 1 158 LYS n 1 159 GLN n 1 160 ARG n 1 161 ILE n 1 162 GLU n 1 163 GLU n 1 164 ALA n 1 165 ARG n 1 166 ARG n 1 167 HIS n 1 168 GLY n 1 169 MSE n 1 170 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 170 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene JBP1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Leishmania tarentolae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5689 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 392 392 THR THR A . n A 1 2 ASN 2 393 393 ASN ASN A . n A 1 3 LEU 3 394 394 LEU LEU A . n A 1 4 MSE 4 395 395 MSE MSE A . n A 1 5 VAL 5 396 396 VAL VAL A . n A 1 6 SER 6 397 397 SER SER A . n A 1 7 THR 7 398 398 THR THR A . n A 1 8 ALA 8 399 399 ALA ALA A . n A 1 9 VAL 9 400 400 VAL VAL A . n A 1 10 GLU 10 401 401 GLU GLU A . n A 1 11 LYS 11 402 402 LYS LYS A . n A 1 12 LYS 12 403 403 LYS LYS A . n A 1 13 LYS 13 404 404 LYS LYS A . n A 1 14 TYR 14 405 405 TYR TYR A . n A 1 15 LEU 15 406 406 LEU LEU A . n A 1 16 ASP 16 407 407 ASP ASP A . n A 1 17 SER 17 408 408 SER SER A . n A 1 18 GLU 18 409 409 GLU GLU A . n A 1 19 PHE 19 410 410 PHE PHE A . n A 1 20 LEU 20 411 411 LEU LEU A . n A 1 21 LEU 21 412 412 LEU LEU A . n A 1 22 HIS 22 413 413 HIS HIS A . n A 1 23 CYS 23 414 414 CYS CYS A . n A 1 24 ILE 24 415 415 ILE ILE A . n A 1 25 SER 25 416 416 SER SER A . n A 1 26 ALA 26 417 417 ALA ALA A . n A 1 27 GLN 27 418 418 GLN GLN A . n A 1 28 LEU 28 419 419 LEU LEU A . n A 1 29 LEU 29 420 420 LEU LEU A . n A 1 30 ASP 30 421 421 ASP ASP A . n A 1 31 MSE 31 422 422 MSE MSE A . n A 1 32 TRP 32 423 423 TRP TRP A . n A 1 33 LYS 33 424 424 LYS LYS A . n A 1 34 GLN 34 425 425 GLN GLN A . n A 1 35 ALA 35 426 426 ALA ALA A . n A 1 36 ARG 36 427 427 ARG ARG A . n A 1 37 ALA 37 428 428 ALA ALA A . n A 1 38 ARG 38 429 429 ARG ARG A . n A 1 39 TRP 39 430 430 TRP TRP A . n A 1 40 LEU 40 431 431 LEU LEU A . n A 1 41 GLU 41 432 432 GLU GLU A . n A 1 42 LEU 42 433 433 LEU LEU A . n A 1 43 VAL 43 434 434 VAL VAL A . n A 1 44 GLY 44 435 435 GLY GLY A . n A 1 45 LYS 45 436 436 LYS LYS A . n A 1 46 GLU 46 437 437 GLU GLU A . n A 1 47 TRP 47 438 438 TRP TRP A . n A 1 48 ALA 48 439 439 ALA ALA A . n A 1 49 HIS 49 440 440 HIS HIS A . n A 1 50 MSE 50 441 441 MSE MSE A . n A 1 51 LEU 51 442 442 LEU LEU A . n A 1 52 ALA 52 443 443 ALA ALA A . n A 1 53 LEU 53 444 444 LEU LEU A . n A 1 54 ASN 54 445 445 ASN ASN A . n A 1 55 PRO 55 446 446 PRO PRO A . n A 1 56 GLU 56 447 447 GLU GLU A . n A 1 57 ARG 57 448 448 ARG ARG A . n A 1 58 LYS 58 449 449 LYS LYS A . n A 1 59 ASP 59 450 450 ASP ASP A . n A 1 60 PHE 60 451 451 PHE PHE A . n A 1 61 LEU 61 452 452 LEU LEU A . n A 1 62 TRP 62 453 453 TRP TRP A . n A 1 63 LYS 63 454 454 LYS LYS A . n A 1 64 ASN 64 455 455 ASN ASN A . n A 1 65 GLN 65 456 456 GLN GLN A . n A 1 66 SER 66 457 457 SER SER A . n A 1 67 GLU 67 458 458 GLU GLU A . n A 1 68 MSE 68 459 459 MSE MSE A . n A 1 69 ASN 69 460 460 ASN ASN A . n A 1 70 SER 70 461 461 SER SER A . n A 1 71 ALA 71 462 462 ALA ALA A . n A 1 72 PHE 72 463 463 PHE PHE A . n A 1 73 PHE 73 464 464 PHE PHE A . n A 1 74 ASP 74 465 465 ASP ASP A . n A 1 75 LEU 75 466 466 LEU LEU A . n A 1 76 CYS 76 467 467 CYS CYS A . n A 1 77 GLU 77 468 468 GLU GLU A . n A 1 78 VAL 78 469 469 VAL VAL A . n A 1 79 GLY 79 470 470 GLY GLY A . n A 1 80 LYS 80 471 471 LYS LYS A . n A 1 81 GLN 81 472 472 GLN GLN A . n A 1 82 VAL 82 473 473 VAL VAL A . n A 1 83 MSE 83 474 474 MSE MSE A . n A 1 84 LEU 84 475 475 LEU LEU A . n A 1 85 GLY 85 476 476 GLY GLY A . n A 1 86 LEU 86 477 477 LEU LEU A . n A 1 87 LEU 87 478 478 LEU LEU A . n A 1 88 GLY 88 479 479 GLY GLY A . n A 1 89 LYS 89 480 480 LYS LYS A . n A 1 90 GLU 90 481 481 GLU GLU A . n A 1 91 VAL 91 482 482 VAL VAL A . n A 1 92 ALA 92 483 483 ALA ALA A . n A 1 93 LEU 93 484 484 LEU LEU A . n A 1 94 PRO 94 485 485 PRO PRO A . n A 1 95 LYS 95 486 486 LYS LYS A . n A 1 96 GLU 96 487 487 GLU GLU A . n A 1 97 GLU 97 488 488 GLU GLU A . n A 1 98 GLN 98 489 489 GLN GLN A . n A 1 99 ALA 99 490 490 ALA ALA A . n A 1 100 PHE 100 491 491 PHE PHE A . n A 1 101 TRP 101 492 492 TRP TRP A . n A 1 102 ILE 102 493 493 ILE ILE A . n A 1 103 MSE 103 494 494 MSE MSE A . n A 1 104 TYR 104 495 495 TYR TYR A . n A 1 105 ALA 105 496 496 ALA ALA A . n A 1 106 VAL 106 497 497 VAL VAL A . n A 1 107 HIS 107 498 498 HIS HIS A . n A 1 108 LEU 108 499 499 LEU LEU A . n A 1 109 SER 109 500 500 SER SER A . n A 1 110 ALA 110 501 501 ALA ALA A . n A 1 111 ALA 111 502 502 ALA ALA A . n A 1 112 CYS 112 503 503 CYS CYS A . n A 1 113 ALA 113 504 504 ALA ALA A . n A 1 114 GLU 114 505 505 GLU GLU A . n A 1 115 GLU 115 506 506 GLU GLU A . n A 1 116 LEU 116 507 507 LEU LEU A . n A 1 117 HIS 117 508 508 HIS HIS A . n A 1 118 MSE 118 509 509 MSE MSE A . n A 1 119 PRO 119 510 510 PRO PRO A . n A 1 120 GLU 120 511 511 GLU GLU A . n A 1 121 VAL 121 512 512 VAL VAL A . n A 1 122 ALA 122 513 513 ALA ALA A . n A 1 123 MSE 123 514 514 MSE MSE A . n A 1 124 SER 124 515 515 SER SER A . n A 1 125 LEU 125 516 516 LEU LEU A . n A 1 126 ARG 126 517 517 ARG ARG A . n A 1 127 LYS 127 518 518 LYS LYS A . n A 1 128 LEU 128 519 519 LEU LEU A . n A 1 129 ASN 129 520 520 ASN ASN A . n A 1 130 VAL 130 521 521 VAL VAL A . n A 1 131 LYS 131 522 522 LYS LYS A . n A 1 132 LEU 132 523 523 LEU LEU A . n A 1 133 LYS 133 524 524 LYS LYS A . n A 1 134 ASP 134 525 525 ASP ASP A . n A 1 135 PHE 135 526 526 PHE PHE A . n A 1 136 ASN 136 527 527 ASN ASN A . n A 1 137 PHE 137 528 528 PHE PHE A . n A 1 138 GLY 138 529 529 GLY GLY A . n A 1 139 GLY 139 530 530 GLY GLY A . n A 1 140 THR 140 531 531 THR THR A . n A 1 141 ARG 141 532 532 ARG ARG A . n A 1 142 TYR 142 533 533 TYR TYR A . n A 1 143 PHE 143 534 534 PHE PHE A . n A 1 144 LYS 144 535 535 LYS LYS A . n A 1 145 ASP 145 536 536 ASP ASP A . n A 1 146 MSE 146 537 537 MSE MSE A . n A 1 147 PRO 147 538 538 PRO PRO A . n A 1 148 PRO 148 539 539 PRO PRO A . n A 1 149 GLU 149 540 540 GLU GLU A . n A 1 150 GLU 150 541 541 GLU GLU A . n A 1 151 LYS 151 542 542 LYS LYS A . n A 1 152 LYS 152 543 543 LYS LYS A . n A 1 153 ARG 153 544 544 ARG ARG A . n A 1 154 ARG 154 545 545 ARG ARG A . n A 1 155 MSE 155 546 546 MSE MSE A . n A 1 156 GLU 156 547 547 GLU GLU A . n A 1 157 ARG 157 548 548 ARG ARG A . n A 1 158 LYS 158 549 549 LYS LYS A . n A 1 159 GLN 159 550 550 GLN GLN A . n A 1 160 ARG 160 551 551 ARG ARG A . n A 1 161 ILE 161 552 552 ILE ILE A . n A 1 162 GLU 162 553 553 GLU GLU A . n A 1 163 GLU 163 554 554 GLU GLU A . n A 1 164 ALA 164 555 555 ALA ALA A . n A 1 165 ARG 165 556 556 ARG ARG A . n A 1 166 ARG 166 557 557 ARG ARG A . n A 1 167 HIS 167 558 558 HIS HIS A . n A 1 168 GLY 168 559 559 GLY GLY A . n A 1 169 MSE 169 560 560 MSE MSE A . n A 1 170 PRO 170 561 561 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 601 134 HOH HOH A . B 2 HOH 2 602 94 HOH HOH A . B 2 HOH 3 603 35 HOH HOH A . B 2 HOH 4 604 27 HOH HOH A . B 2 HOH 5 605 55 HOH HOH A . B 2 HOH 6 606 117 HOH HOH A . B 2 HOH 7 607 110 HOH HOH A . B 2 HOH 8 608 8 HOH HOH A . B 2 HOH 9 609 59 HOH HOH A . B 2 HOH 10 610 124 HOH HOH A . B 2 HOH 11 611 77 HOH HOH A . B 2 HOH 12 612 122 HOH HOH A . B 2 HOH 13 613 61 HOH HOH A . B 2 HOH 14 614 45 HOH HOH A . B 2 HOH 15 615 81 HOH HOH A . B 2 HOH 16 616 104 HOH HOH A . B 2 HOH 17 617 138 HOH HOH A . B 2 HOH 18 618 136 HOH HOH A . B 2 HOH 19 619 19 HOH HOH A . B 2 HOH 20 620 40 HOH HOH A . B 2 HOH 21 621 137 HOH HOH A . B 2 HOH 22 622 44 HOH HOH A . B 2 HOH 23 623 131 HOH HOH A . B 2 HOH 24 624 111 HOH HOH A . B 2 HOH 25 625 112 HOH HOH A . B 2 HOH 26 626 13 HOH HOH A . B 2 HOH 27 627 23 HOH HOH A . B 2 HOH 28 628 12 HOH HOH A . B 2 HOH 29 629 32 HOH HOH A . B 2 HOH 30 630 106 HOH HOH A . B 2 HOH 31 631 92 HOH HOH A . B 2 HOH 32 632 116 HOH HOH A . B 2 HOH 33 633 75 HOH HOH A . B 2 HOH 34 634 2 HOH HOH A . B 2 HOH 35 635 82 HOH HOH A . B 2 HOH 36 636 46 HOH HOH A . B 2 HOH 37 637 4 HOH HOH A . B 2 HOH 38 638 5 HOH HOH A . B 2 HOH 39 639 125 HOH HOH A . B 2 HOH 40 640 16 HOH HOH A . B 2 HOH 41 641 11 HOH HOH A . B 2 HOH 42 642 114 HOH HOH A . B 2 HOH 43 643 15 HOH HOH A . B 2 HOH 44 644 29 HOH HOH A . B 2 HOH 45 645 140 HOH HOH A . B 2 HOH 46 646 22 HOH HOH A . B 2 HOH 47 647 93 HOH HOH A . B 2 HOH 48 648 21 HOH HOH A . B 2 HOH 49 649 135 HOH HOH A . B 2 HOH 50 650 14 HOH HOH A . B 2 HOH 51 651 36 HOH HOH A . B 2 HOH 52 652 47 HOH HOH A . B 2 HOH 53 653 87 HOH HOH A . B 2 HOH 54 654 72 HOH HOH A . B 2 HOH 55 655 130 HOH HOH A . B 2 HOH 56 656 70 HOH HOH A . B 2 HOH 57 657 64 HOH HOH A . B 2 HOH 58 658 42 HOH HOH A . B 2 HOH 59 659 57 HOH HOH A . B 2 HOH 60 660 103 HOH HOH A . B 2 HOH 61 661 26 HOH HOH A . B 2 HOH 62 662 74 HOH HOH A . B 2 HOH 63 663 67 HOH HOH A . B 2 HOH 64 664 133 HOH HOH A . B 2 HOH 65 665 109 HOH HOH A . B 2 HOH 66 666 128 HOH HOH A . B 2 HOH 67 667 80 HOH HOH A . B 2 HOH 68 668 97 HOH HOH A . B 2 HOH 69 669 101 HOH HOH A . B 2 HOH 70 670 71 HOH HOH A . B 2 HOH 71 671 120 HOH HOH A . B 2 HOH 72 672 127 HOH HOH A . B 2 HOH 73 673 68 HOH HOH A . B 2 HOH 74 674 105 HOH HOH A . B 2 HOH 75 675 121 HOH HOH A . B 2 HOH 76 676 34 HOH HOH A . B 2 HOH 77 677 62 HOH HOH A . B 2 HOH 78 678 63 HOH HOH A . B 2 HOH 79 679 30 HOH HOH A . B 2 HOH 80 680 119 HOH HOH A . B 2 HOH 81 681 60 HOH HOH A . B 2 HOH 82 682 25 HOH HOH A . B 2 HOH 83 683 139 HOH HOH A . B 2 HOH 84 684 129 HOH HOH A . B 2 HOH 85 685 9 HOH HOH A . B 2 HOH 86 686 96 HOH HOH A . B 2 HOH 87 687 84 HOH HOH A . B 2 HOH 88 688 102 HOH HOH A . B 2 HOH 89 689 88 HOH HOH A . B 2 HOH 90 690 79 HOH HOH A . B 2 HOH 91 691 141 HOH HOH A . B 2 HOH 92 692 90 HOH HOH A . B 2 HOH 93 693 48 HOH HOH A . B 2 HOH 94 694 33 HOH HOH A . B 2 HOH 95 695 65 HOH HOH A . B 2 HOH 96 696 24 HOH HOH A . B 2 HOH 97 697 49 HOH HOH A . B 2 HOH 98 698 95 HOH HOH A . B 2 HOH 99 699 113 HOH HOH A . B 2 HOH 100 700 98 HOH HOH A . B 2 HOH 101 701 41 HOH HOH A . B 2 HOH 102 702 89 HOH HOH A . B 2 HOH 103 703 85 HOH HOH A . B 2 HOH 104 704 69 HOH HOH A . B 2 HOH 105 705 118 HOH HOH A . B 2 HOH 106 706 123 HOH HOH A . B 2 HOH 107 707 142 HOH HOH A . B 2 HOH 108 708 86 HOH HOH A . B 2 HOH 109 709 58 HOH HOH A . B 2 HOH 110 710 99 HOH HOH A . B 2 HOH 111 711 143 HOH HOH A . B 2 HOH 112 712 73 HOH HOH A . B 2 HOH 113 713 100 HOH HOH A . B 2 HOH 114 714 132 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PDB-REDO ? ? ? . 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 8BBM _cell.details ? _cell.formula_units_Z ? _cell.length_a 68.286 _cell.length_a_esd ? _cell.length_b 68.286 _cell.length_b_esd ? _cell.length_c 185.842 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8BBM _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8BBM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.05 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '15-17% Peg 6000, 0.1M Sodium iodide or 15-17% Peg, 0.2M potassium nitrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-10-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 32.3 _reflns.entry_id 8BBM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.95 _reflns.d_resolution_low 29.6 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19605 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 38.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.157 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 1.95 _reflns_shell.d_res_low 2.00 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 53016 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 5.033 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.77 _refine.aniso_B[1][2] 0.39 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.77 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -2.51 _refine.B_iso_max ? _refine.B_iso_mean 54.275 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.959 _refine.correlation_coeff_Fo_to_Fc_free 0.934 _refine.details ;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : WITH TLS ADDED ; _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8BBM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.95 _refine.ls_d_res_low 29.59 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18522 _refine.ls_number_reflns_R_free 1017 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.93 _refine.ls_percent_reflns_R_free 5.2 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20453 _refine.ls_R_factor_R_free 0.25194 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.20204 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2XSE _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.143 _refine.pdbx_overall_ESU_R_Free 0.145 _refine.pdbx_solvent_vdw_probe_radii 1.00 _refine.pdbx_solvent_ion_probe_radii 0.70 _refine.pdbx_solvent_shrinkage_radii 0.70 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 8.198 _refine.overall_SU_ML 0.113 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.95 _refine_hist.d_res_low 29.59 _refine_hist.number_atoms_solvent 114 _refine_hist.number_atoms_total 1514 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1400 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.018 1476 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1408 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.621 1.883 1985 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.142 2.816 3275 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.090 5.000 179 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.110 23.857 70 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.895 15.000 257 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 11.894 15.000 11 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.097 0.200 204 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1630 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 309 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 2.130 3.765 704 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.119 3.762 703 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.227 5.620 887 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.227 5.624 888 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.762 4.102 772 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.759 4.103 772 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 4.379 6.008 1098 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.393 70.964 6168 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 7.345 70.659 6091 ? r_long_range_B_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.950 _refine_ls_shell.d_res_low 2.001 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 72 _refine_ls_shell.number_reflns_R_work 1317 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.415 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.340 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 8BBM _struct.title 'DNA binding domain of J-DNA Binding Protein 1 (JBP1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8BBM _struct_keywords.text 'J-DNA binding protein, JBP1, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code JBP1_LEITA _struct_ref.pdbx_db_accession Q9U6M1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TNLMVSTAVEKKKYLDSEFLLHCISAQLLDMWKQARARWLELVGKEWAHMLALNPERKDFLWKNQSEMNSAFFDLCEVGK QVMLGLLGKEVALPKEEQAFWIMYAVHLSAACAEELHMPEVAMSLRKLNVKLKDFNFGGTRYFKDMPPEEKKRRMERKQR IEEARRHGMP ; _struct_ref.pdbx_align_begin 392 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8BBM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 170 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9U6M1 _struct_ref_seq.db_align_beg 392 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 561 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 392 _struct_ref_seq.pdbx_auth_seq_align_end 561 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 10060 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 1 ? LYS A 11 ? THR A 392 LYS A 402 1 ? 11 HELX_P HELX_P2 AA2 LYS A 12 ? LEU A 15 ? LYS A 403 LEU A 406 5 ? 4 HELX_P HELX_P3 AA3 ASP A 16 ? LEU A 21 ? ASP A 407 LEU A 412 1 ? 6 HELX_P HELX_P4 AA4 SER A 25 ? ASN A 54 ? SER A 416 ASN A 445 1 ? 30 HELX_P HELX_P5 AA5 SER A 66 ? GLY A 88 ? SER A 457 GLY A 479 1 ? 23 HELX_P HELX_P6 AA6 LEU A 93 ? GLU A 115 ? LEU A 484 GLU A 506 1 ? 23 HELX_P HELX_P7 AA7 SER A 124 ? PHE A 137 ? SER A 515 PHE A 528 1 ? 14 HELX_P HELX_P8 AA8 GLY A 138 ? PHE A 143 ? GLY A 529 PHE A 534 1 ? 6 HELX_P HELX_P9 AA9 PRO A 147 ? ARG A 166 ? PRO A 538 ARG A 557 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 3 C ? ? ? 1_555 A MSE 4 N ? ? A LEU 394 A MSE 395 1_555 ? ? ? ? ? ? ? 1.342 ? ? covale2 covale both ? A MSE 4 C ? ? ? 1_555 A VAL 5 N ? ? A MSE 395 A VAL 396 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale3 covale both ? A ASP 30 C ? ? ? 1_555 A MSE 31 N ? ? A ASP 421 A MSE 422 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale4 covale both ? A MSE 31 C ? ? ? 1_555 A TRP 32 N ? ? A MSE 422 A TRP 423 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale5 covale both ? A HIS 49 C ? ? ? 1_555 A MSE 50 N ? ? A HIS 440 A MSE 441 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale6 covale both ? A MSE 50 C ? ? ? 1_555 A LEU 51 N ? ? A MSE 441 A LEU 442 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale7 covale both ? A GLU 67 C ? ? ? 1_555 A MSE 68 N ? ? A GLU 458 A MSE 459 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale8 covale both ? A MSE 68 C ? ? ? 1_555 A ASN 69 N ? ? A MSE 459 A ASN 460 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale9 covale both ? A VAL 82 C ? ? ? 1_555 A MSE 83 N ? ? A VAL 473 A MSE 474 1_555 ? ? ? ? ? ? ? 1.343 ? ? covale10 covale both ? A MSE 83 C ? ? ? 1_555 A LEU 84 N ? ? A MSE 474 A LEU 475 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale11 covale both ? A ILE 102 C ? ? ? 1_555 A MSE 103 N A ? A ILE 493 A MSE 494 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale12 covale both ? A ILE 102 C ? ? ? 1_555 A MSE 103 N B ? A ILE 493 A MSE 494 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale13 covale both ? A MSE 103 C A ? ? 1_555 A TYR 104 N ? ? A MSE 494 A TYR 495 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale14 covale both ? A MSE 103 C B ? ? 1_555 A TYR 104 N ? ? A MSE 494 A TYR 495 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale15 covale both ? A HIS 117 C ? ? ? 1_555 A MSE 118 N ? ? A HIS 508 A MSE 509 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale16 covale both ? A MSE 118 C ? ? ? 1_555 A PRO 119 N ? ? A MSE 509 A PRO 510 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale17 covale both ? A ALA 122 C ? ? ? 1_555 A MSE 123 N ? ? A ALA 513 A MSE 514 1_555 ? ? ? ? ? ? ? 1.345 ? ? covale18 covale both ? A MSE 123 C ? ? ? 1_555 A SER 124 N ? ? A MSE 514 A SER 515 1_555 ? ? ? ? ? ? ? 1.343 ? ? covale19 covale both ? A ASP 145 C ? ? ? 1_555 A MSE 146 N ? ? A ASP 536 A MSE 537 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale20 covale both ? A MSE 146 C ? ? ? 1_555 A PRO 147 N ? ? A MSE 537 A PRO 538 1_555 ? ? ? ? ? ? ? 1.357 ? ? covale21 covale both ? A ARG 154 C ? ? ? 1_555 A MSE 155 N A ? A ARG 545 A MSE 546 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale22 covale both ? A ARG 154 C ? ? ? 1_555 A MSE 155 N B ? A ARG 545 A MSE 546 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale23 covale both ? A MSE 155 C A ? ? 1_555 A GLU 156 N ? ? A MSE 546 A GLU 547 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale24 covale both ? A MSE 155 C B ? ? 1_555 A GLU 156 N ? ? A MSE 546 A GLU 547 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale25 covale both ? A GLY 168 C ? ? ? 1_555 A MSE 169 N ? ? A GLY 559 A MSE 560 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale26 covale both ? A MSE 169 C ? ? ? 1_555 A PRO 170 N ? ? A MSE 560 A PRO 561 1_555 ? ? ? ? ? ? ? 1.354 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 4 ? . . . . MSE A 395 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 31 ? . . . . MSE A 422 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 50 ? . . . . MSE A 441 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 68 ? . . . . MSE A 459 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 83 ? . . . . MSE A 474 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE A 103 A . . . . MSE A 494 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 7 MSE A 103 B . . . . MSE A 494 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 8 MSE A 118 ? . . . . MSE A 509 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 9 MSE A 123 ? . . . . MSE A 514 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 10 MSE A 146 ? . . . . MSE A 537 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 11 MSE A 155 A . . . . MSE A 546 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 12 MSE A 155 B . . . . MSE A 546 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 13 MSE A 169 ? . . . . MSE A 560 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _pdbx_entry_details.entry_id 8BBM _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 663 ? ? O A HOH 673 ? ? 2.13 2 1 O A HOH 630 ? ? O A HOH 670 ? ? 2.16 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CG _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 MSE _pdbx_validate_rmsd_angle.auth_seq_id_1 395 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 SE _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 MSE _pdbx_validate_rmsd_angle.auth_seq_id_2 395 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CE _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 MSE _pdbx_validate_rmsd_angle.auth_seq_id_3 395 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 115.91 _pdbx_validate_rmsd_angle.angle_target_value 98.90 _pdbx_validate_rmsd_angle.angle_deviation 17.01 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.20 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 413 ? ? 71.91 -1.65 2 1 MSE A 514 ? ? -108.25 78.86 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 4 A MSE 395 ? MET 'modified residue' 2 A MSE 31 A MSE 422 ? MET 'modified residue' 3 A MSE 50 A MSE 441 ? MET 'modified residue' 4 A MSE 68 A MSE 459 ? MET 'modified residue' 5 A MSE 83 A MSE 474 ? MET 'modified residue' 6 A MSE 103 A MSE 494 ? MET 'modified residue' 7 A MSE 118 A MSE 509 ? MET 'modified residue' 8 A MSE 123 A MSE 514 ? MET 'modified residue' 9 A MSE 146 A MSE 537 ? MET 'modified residue' 10 A MSE 155 A MSE 546 ? MET 'modified residue' 11 A MSE 169 A MSE 560 ? MET 'modified residue' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 2.7230 _pdbx_refine_tls.origin_y 21.3697 _pdbx_refine_tls.origin_z -1.5216 _pdbx_refine_tls.T[1][1] 0.1172 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0284 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0447 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0505 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0179 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0234 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.3929 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.1206 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -1.5178 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.1570 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.9657 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 4.1488 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.1769 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0494 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0653 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.1117 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0033 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0223 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.3954 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.2956 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.1801 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 392 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 561 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MSE N N N N 230 MSE CA C N S 231 MSE C C N N 232 MSE O O N N 233 MSE OXT O N N 234 MSE CB C N N 235 MSE CG C N N 236 MSE SE SE N N 237 MSE CE C N N 238 MSE H H N N 239 MSE H2 H N N 240 MSE HA H N N 241 MSE HXT H N N 242 MSE HB2 H N N 243 MSE HB3 H N N 244 MSE HG2 H N N 245 MSE HG3 H N N 246 MSE HE1 H N N 247 MSE HE2 H N N 248 MSE HE3 H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Netherlands Organisation for Scientific Research (NWO)' _pdbx_audit_support.country Netherlands _pdbx_audit_support.grant_number 714.014.002 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2XSE _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8BBM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014644 _atom_sites.fract_transf_matrix[1][2] 0.008455 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016910 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005381 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S SE # loop_