data_8BBM
# 
_entry.id   8BBM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   8BBM         pdb_00008bbm 10.2210/pdb8bbm/pdb 
WWPDB D_1292125982 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2022-11-09 
2 'Structure model' 1 1 2023-07-05 
3 'Structure model' 1 2 2024-02-07 
4 'Structure model' 1 3 2024-11-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Refinement description' 
4 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                      
2 2 'Structure model' citation_author               
3 3 'Structure model' chem_comp_atom                
4 3 'Structure model' chem_comp_bond                
5 3 'Structure model' pdbx_initial_refinement_model 
6 4 'Structure model' pdbx_entry_details            
7 4 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                            
2  2 'Structure model' '_citation.journal_abbrev'                     
3  2 'Structure model' '_citation.journal_id_CSD'                     
4  2 'Structure model' '_citation.journal_id_ISSN'                    
5  2 'Structure model' '_citation.journal_volume'                     
6  2 'Structure model' '_citation.pdbx_database_id_DOI'               
7  2 'Structure model' '_citation.pdbx_database_id_PubMed'            
8  2 'Structure model' '_citation.title'                              
9  2 'Structure model' '_citation.year'                               
10 2 'Structure model' '_citation_author.identifier_ORCID'            
11 2 'Structure model' '_citation_author.name'                        
12 4 'Structure model' '_pdbx_entry_details.has_protein_modification' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        8BBM 
_pdbx_database_status.recvd_initial_deposition_date   2022-10-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_pdbx_contact_author.id                 2 
_pdbx_contact_author.email              a.perrakis@nki.nl 
_pdbx_contact_author.name_first         Anastassis 
_pdbx_contact_author.name_last          Perrakis 
_pdbx_contact_author.name_mi            ? 
_pdbx_contact_author.role               'principal investigator/group leader' 
_pdbx_contact_author.identifier_ORCID   0000-0002-1151-6227 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'de Vries, I.'  1 0000-0002-8313-7779 
'Joosten, R.P.' 2 0000-0002-2323-2686 
'Perrakis, A.'  3 0000-0002-1151-6227 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Life Sci Alliance' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2575-1077 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Distant sequence regions of JBP1 contribute to J-DNA binding.' 
_citation.year                      2023 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.26508/lsa.202302150 
_citation.pdbx_database_id_PubMed   37328191 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'de Vries, I.'    1 0000-0002-8313-7779 
primary 'Ammerlaan, D.'   2 ?                   
primary 'Heidebrecht, T.' 3 0000-0001-9616-3944 
primary 'Celie, P.H.'     4 0000-0002-6557-078X 
primary 'Geerke, D.P.'    5 0000-0002-5262-6166 
primary 'Joosten, R.P.'   6 0000-0002-2323-2686 
primary 'Perrakis, A.'    7 0000-0002-1151-6227 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Thymine dioxygenase JBP1' 20537.340 1   1.14.11.6 ? ? ? 
2 water   nat water                      18.015    114 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'J-binding protein 1,Thymidine hydroxylase JBP1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;TNL(MSE)VSTAVEKKKYLDSEFLLHCISAQLLD(MSE)WKQARARWLELVGKEWAH(MSE)LALNPERKDFLWKNQSE
(MSE)NSAFFDLCEVGKQV(MSE)LGLLGKEVALPKEEQAFWI(MSE)YAVHLSAACAEELH(MSE)PEVA(MSE)SLRK
LNVKLKDFNFGGTRYFKD(MSE)PPEEKKRR(MSE)ERKQRIEEARRHG(MSE)P
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TNLMVSTAVEKKKYLDSEFLLHCISAQLLDMWKQARARWLELVGKEWAHMLALNPERKDFLWKNQSEMNSAFFDLCEVGK
QVMLGLLGKEVALPKEEQAFWIMYAVHLSAACAEELHMPEVAMSLRKLNVKLKDFNFGGTRYFKDMPPEEKKRRMERKQR
IEEARRHGMP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   ASN n 
1 3   LEU n 
1 4   MSE n 
1 5   VAL n 
1 6   SER n 
1 7   THR n 
1 8   ALA n 
1 9   VAL n 
1 10  GLU n 
1 11  LYS n 
1 12  LYS n 
1 13  LYS n 
1 14  TYR n 
1 15  LEU n 
1 16  ASP n 
1 17  SER n 
1 18  GLU n 
1 19  PHE n 
1 20  LEU n 
1 21  LEU n 
1 22  HIS n 
1 23  CYS n 
1 24  ILE n 
1 25  SER n 
1 26  ALA n 
1 27  GLN n 
1 28  LEU n 
1 29  LEU n 
1 30  ASP n 
1 31  MSE n 
1 32  TRP n 
1 33  LYS n 
1 34  GLN n 
1 35  ALA n 
1 36  ARG n 
1 37  ALA n 
1 38  ARG n 
1 39  TRP n 
1 40  LEU n 
1 41  GLU n 
1 42  LEU n 
1 43  VAL n 
1 44  GLY n 
1 45  LYS n 
1 46  GLU n 
1 47  TRP n 
1 48  ALA n 
1 49  HIS n 
1 50  MSE n 
1 51  LEU n 
1 52  ALA n 
1 53  LEU n 
1 54  ASN n 
1 55  PRO n 
1 56  GLU n 
1 57  ARG n 
1 58  LYS n 
1 59  ASP n 
1 60  PHE n 
1 61  LEU n 
1 62  TRP n 
1 63  LYS n 
1 64  ASN n 
1 65  GLN n 
1 66  SER n 
1 67  GLU n 
1 68  MSE n 
1 69  ASN n 
1 70  SER n 
1 71  ALA n 
1 72  PHE n 
1 73  PHE n 
1 74  ASP n 
1 75  LEU n 
1 76  CYS n 
1 77  GLU n 
1 78  VAL n 
1 79  GLY n 
1 80  LYS n 
1 81  GLN n 
1 82  VAL n 
1 83  MSE n 
1 84  LEU n 
1 85  GLY n 
1 86  LEU n 
1 87  LEU n 
1 88  GLY n 
1 89  LYS n 
1 90  GLU n 
1 91  VAL n 
1 92  ALA n 
1 93  LEU n 
1 94  PRO n 
1 95  LYS n 
1 96  GLU n 
1 97  GLU n 
1 98  GLN n 
1 99  ALA n 
1 100 PHE n 
1 101 TRP n 
1 102 ILE n 
1 103 MSE n 
1 104 TYR n 
1 105 ALA n 
1 106 VAL n 
1 107 HIS n 
1 108 LEU n 
1 109 SER n 
1 110 ALA n 
1 111 ALA n 
1 112 CYS n 
1 113 ALA n 
1 114 GLU n 
1 115 GLU n 
1 116 LEU n 
1 117 HIS n 
1 118 MSE n 
1 119 PRO n 
1 120 GLU n 
1 121 VAL n 
1 122 ALA n 
1 123 MSE n 
1 124 SER n 
1 125 LEU n 
1 126 ARG n 
1 127 LYS n 
1 128 LEU n 
1 129 ASN n 
1 130 VAL n 
1 131 LYS n 
1 132 LEU n 
1 133 LYS n 
1 134 ASP n 
1 135 PHE n 
1 136 ASN n 
1 137 PHE n 
1 138 GLY n 
1 139 GLY n 
1 140 THR n 
1 141 ARG n 
1 142 TYR n 
1 143 PHE n 
1 144 LYS n 
1 145 ASP n 
1 146 MSE n 
1 147 PRO n 
1 148 PRO n 
1 149 GLU n 
1 150 GLU n 
1 151 LYS n 
1 152 LYS n 
1 153 ARG n 
1 154 ARG n 
1 155 MSE n 
1 156 GLU n 
1 157 ARG n 
1 158 LYS n 
1 159 GLN n 
1 160 ARG n 
1 161 ILE n 
1 162 GLU n 
1 163 GLU n 
1 164 ALA n 
1 165 ARG n 
1 166 ARG n 
1 167 HIS n 
1 168 GLY n 
1 169 MSE n 
1 170 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   170 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 JBP1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Leishmania tarentolae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5689 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   392 392 THR THR A . n 
A 1 2   ASN 2   393 393 ASN ASN A . n 
A 1 3   LEU 3   394 394 LEU LEU A . n 
A 1 4   MSE 4   395 395 MSE MSE A . n 
A 1 5   VAL 5   396 396 VAL VAL A . n 
A 1 6   SER 6   397 397 SER SER A . n 
A 1 7   THR 7   398 398 THR THR A . n 
A 1 8   ALA 8   399 399 ALA ALA A . n 
A 1 9   VAL 9   400 400 VAL VAL A . n 
A 1 10  GLU 10  401 401 GLU GLU A . n 
A 1 11  LYS 11  402 402 LYS LYS A . n 
A 1 12  LYS 12  403 403 LYS LYS A . n 
A 1 13  LYS 13  404 404 LYS LYS A . n 
A 1 14  TYR 14  405 405 TYR TYR A . n 
A 1 15  LEU 15  406 406 LEU LEU A . n 
A 1 16  ASP 16  407 407 ASP ASP A . n 
A 1 17  SER 17  408 408 SER SER A . n 
A 1 18  GLU 18  409 409 GLU GLU A . n 
A 1 19  PHE 19  410 410 PHE PHE A . n 
A 1 20  LEU 20  411 411 LEU LEU A . n 
A 1 21  LEU 21  412 412 LEU LEU A . n 
A 1 22  HIS 22  413 413 HIS HIS A . n 
A 1 23  CYS 23  414 414 CYS CYS A . n 
A 1 24  ILE 24  415 415 ILE ILE A . n 
A 1 25  SER 25  416 416 SER SER A . n 
A 1 26  ALA 26  417 417 ALA ALA A . n 
A 1 27  GLN 27  418 418 GLN GLN A . n 
A 1 28  LEU 28  419 419 LEU LEU A . n 
A 1 29  LEU 29  420 420 LEU LEU A . n 
A 1 30  ASP 30  421 421 ASP ASP A . n 
A 1 31  MSE 31  422 422 MSE MSE A . n 
A 1 32  TRP 32  423 423 TRP TRP A . n 
A 1 33  LYS 33  424 424 LYS LYS A . n 
A 1 34  GLN 34  425 425 GLN GLN A . n 
A 1 35  ALA 35  426 426 ALA ALA A . n 
A 1 36  ARG 36  427 427 ARG ARG A . n 
A 1 37  ALA 37  428 428 ALA ALA A . n 
A 1 38  ARG 38  429 429 ARG ARG A . n 
A 1 39  TRP 39  430 430 TRP TRP A . n 
A 1 40  LEU 40  431 431 LEU LEU A . n 
A 1 41  GLU 41  432 432 GLU GLU A . n 
A 1 42  LEU 42  433 433 LEU LEU A . n 
A 1 43  VAL 43  434 434 VAL VAL A . n 
A 1 44  GLY 44  435 435 GLY GLY A . n 
A 1 45  LYS 45  436 436 LYS LYS A . n 
A 1 46  GLU 46  437 437 GLU GLU A . n 
A 1 47  TRP 47  438 438 TRP TRP A . n 
A 1 48  ALA 48  439 439 ALA ALA A . n 
A 1 49  HIS 49  440 440 HIS HIS A . n 
A 1 50  MSE 50  441 441 MSE MSE A . n 
A 1 51  LEU 51  442 442 LEU LEU A . n 
A 1 52  ALA 52  443 443 ALA ALA A . n 
A 1 53  LEU 53  444 444 LEU LEU A . n 
A 1 54  ASN 54  445 445 ASN ASN A . n 
A 1 55  PRO 55  446 446 PRO PRO A . n 
A 1 56  GLU 56  447 447 GLU GLU A . n 
A 1 57  ARG 57  448 448 ARG ARG A . n 
A 1 58  LYS 58  449 449 LYS LYS A . n 
A 1 59  ASP 59  450 450 ASP ASP A . n 
A 1 60  PHE 60  451 451 PHE PHE A . n 
A 1 61  LEU 61  452 452 LEU LEU A . n 
A 1 62  TRP 62  453 453 TRP TRP A . n 
A 1 63  LYS 63  454 454 LYS LYS A . n 
A 1 64  ASN 64  455 455 ASN ASN A . n 
A 1 65  GLN 65  456 456 GLN GLN A . n 
A 1 66  SER 66  457 457 SER SER A . n 
A 1 67  GLU 67  458 458 GLU GLU A . n 
A 1 68  MSE 68  459 459 MSE MSE A . n 
A 1 69  ASN 69  460 460 ASN ASN A . n 
A 1 70  SER 70  461 461 SER SER A . n 
A 1 71  ALA 71  462 462 ALA ALA A . n 
A 1 72  PHE 72  463 463 PHE PHE A . n 
A 1 73  PHE 73  464 464 PHE PHE A . n 
A 1 74  ASP 74  465 465 ASP ASP A . n 
A 1 75  LEU 75  466 466 LEU LEU A . n 
A 1 76  CYS 76  467 467 CYS CYS A . n 
A 1 77  GLU 77  468 468 GLU GLU A . n 
A 1 78  VAL 78  469 469 VAL VAL A . n 
A 1 79  GLY 79  470 470 GLY GLY A . n 
A 1 80  LYS 80  471 471 LYS LYS A . n 
A 1 81  GLN 81  472 472 GLN GLN A . n 
A 1 82  VAL 82  473 473 VAL VAL A . n 
A 1 83  MSE 83  474 474 MSE MSE A . n 
A 1 84  LEU 84  475 475 LEU LEU A . n 
A 1 85  GLY 85  476 476 GLY GLY A . n 
A 1 86  LEU 86  477 477 LEU LEU A . n 
A 1 87  LEU 87  478 478 LEU LEU A . n 
A 1 88  GLY 88  479 479 GLY GLY A . n 
A 1 89  LYS 89  480 480 LYS LYS A . n 
A 1 90  GLU 90  481 481 GLU GLU A . n 
A 1 91  VAL 91  482 482 VAL VAL A . n 
A 1 92  ALA 92  483 483 ALA ALA A . n 
A 1 93  LEU 93  484 484 LEU LEU A . n 
A 1 94  PRO 94  485 485 PRO PRO A . n 
A 1 95  LYS 95  486 486 LYS LYS A . n 
A 1 96  GLU 96  487 487 GLU GLU A . n 
A 1 97  GLU 97  488 488 GLU GLU A . n 
A 1 98  GLN 98  489 489 GLN GLN A . n 
A 1 99  ALA 99  490 490 ALA ALA A . n 
A 1 100 PHE 100 491 491 PHE PHE A . n 
A 1 101 TRP 101 492 492 TRP TRP A . n 
A 1 102 ILE 102 493 493 ILE ILE A . n 
A 1 103 MSE 103 494 494 MSE MSE A . n 
A 1 104 TYR 104 495 495 TYR TYR A . n 
A 1 105 ALA 105 496 496 ALA ALA A . n 
A 1 106 VAL 106 497 497 VAL VAL A . n 
A 1 107 HIS 107 498 498 HIS HIS A . n 
A 1 108 LEU 108 499 499 LEU LEU A . n 
A 1 109 SER 109 500 500 SER SER A . n 
A 1 110 ALA 110 501 501 ALA ALA A . n 
A 1 111 ALA 111 502 502 ALA ALA A . n 
A 1 112 CYS 112 503 503 CYS CYS A . n 
A 1 113 ALA 113 504 504 ALA ALA A . n 
A 1 114 GLU 114 505 505 GLU GLU A . n 
A 1 115 GLU 115 506 506 GLU GLU A . n 
A 1 116 LEU 116 507 507 LEU LEU A . n 
A 1 117 HIS 117 508 508 HIS HIS A . n 
A 1 118 MSE 118 509 509 MSE MSE A . n 
A 1 119 PRO 119 510 510 PRO PRO A . n 
A 1 120 GLU 120 511 511 GLU GLU A . n 
A 1 121 VAL 121 512 512 VAL VAL A . n 
A 1 122 ALA 122 513 513 ALA ALA A . n 
A 1 123 MSE 123 514 514 MSE MSE A . n 
A 1 124 SER 124 515 515 SER SER A . n 
A 1 125 LEU 125 516 516 LEU LEU A . n 
A 1 126 ARG 126 517 517 ARG ARG A . n 
A 1 127 LYS 127 518 518 LYS LYS A . n 
A 1 128 LEU 128 519 519 LEU LEU A . n 
A 1 129 ASN 129 520 520 ASN ASN A . n 
A 1 130 VAL 130 521 521 VAL VAL A . n 
A 1 131 LYS 131 522 522 LYS LYS A . n 
A 1 132 LEU 132 523 523 LEU LEU A . n 
A 1 133 LYS 133 524 524 LYS LYS A . n 
A 1 134 ASP 134 525 525 ASP ASP A . n 
A 1 135 PHE 135 526 526 PHE PHE A . n 
A 1 136 ASN 136 527 527 ASN ASN A . n 
A 1 137 PHE 137 528 528 PHE PHE A . n 
A 1 138 GLY 138 529 529 GLY GLY A . n 
A 1 139 GLY 139 530 530 GLY GLY A . n 
A 1 140 THR 140 531 531 THR THR A . n 
A 1 141 ARG 141 532 532 ARG ARG A . n 
A 1 142 TYR 142 533 533 TYR TYR A . n 
A 1 143 PHE 143 534 534 PHE PHE A . n 
A 1 144 LYS 144 535 535 LYS LYS A . n 
A 1 145 ASP 145 536 536 ASP ASP A . n 
A 1 146 MSE 146 537 537 MSE MSE A . n 
A 1 147 PRO 147 538 538 PRO PRO A . n 
A 1 148 PRO 148 539 539 PRO PRO A . n 
A 1 149 GLU 149 540 540 GLU GLU A . n 
A 1 150 GLU 150 541 541 GLU GLU A . n 
A 1 151 LYS 151 542 542 LYS LYS A . n 
A 1 152 LYS 152 543 543 LYS LYS A . n 
A 1 153 ARG 153 544 544 ARG ARG A . n 
A 1 154 ARG 154 545 545 ARG ARG A . n 
A 1 155 MSE 155 546 546 MSE MSE A . n 
A 1 156 GLU 156 547 547 GLU GLU A . n 
A 1 157 ARG 157 548 548 ARG ARG A . n 
A 1 158 LYS 158 549 549 LYS LYS A . n 
A 1 159 GLN 159 550 550 GLN GLN A . n 
A 1 160 ARG 160 551 551 ARG ARG A . n 
A 1 161 ILE 161 552 552 ILE ILE A . n 
A 1 162 GLU 162 553 553 GLU GLU A . n 
A 1 163 GLU 163 554 554 GLU GLU A . n 
A 1 164 ALA 164 555 555 ALA ALA A . n 
A 1 165 ARG 165 556 556 ARG ARG A . n 
A 1 166 ARG 166 557 557 ARG ARG A . n 
A 1 167 HIS 167 558 558 HIS HIS A . n 
A 1 168 GLY 168 559 559 GLY GLY A . n 
A 1 169 MSE 169 560 560 MSE MSE A . n 
A 1 170 PRO 170 561 561 PRO PRO A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   601 134 HOH HOH A . 
B 2 HOH 2   602 94  HOH HOH A . 
B 2 HOH 3   603 35  HOH HOH A . 
B 2 HOH 4   604 27  HOH HOH A . 
B 2 HOH 5   605 55  HOH HOH A . 
B 2 HOH 6   606 117 HOH HOH A . 
B 2 HOH 7   607 110 HOH HOH A . 
B 2 HOH 8   608 8   HOH HOH A . 
B 2 HOH 9   609 59  HOH HOH A . 
B 2 HOH 10  610 124 HOH HOH A . 
B 2 HOH 11  611 77  HOH HOH A . 
B 2 HOH 12  612 122 HOH HOH A . 
B 2 HOH 13  613 61  HOH HOH A . 
B 2 HOH 14  614 45  HOH HOH A . 
B 2 HOH 15  615 81  HOH HOH A . 
B 2 HOH 16  616 104 HOH HOH A . 
B 2 HOH 17  617 138 HOH HOH A . 
B 2 HOH 18  618 136 HOH HOH A . 
B 2 HOH 19  619 19  HOH HOH A . 
B 2 HOH 20  620 40  HOH HOH A . 
B 2 HOH 21  621 137 HOH HOH A . 
B 2 HOH 22  622 44  HOH HOH A . 
B 2 HOH 23  623 131 HOH HOH A . 
B 2 HOH 24  624 111 HOH HOH A . 
B 2 HOH 25  625 112 HOH HOH A . 
B 2 HOH 26  626 13  HOH HOH A . 
B 2 HOH 27  627 23  HOH HOH A . 
B 2 HOH 28  628 12  HOH HOH A . 
B 2 HOH 29  629 32  HOH HOH A . 
B 2 HOH 30  630 106 HOH HOH A . 
B 2 HOH 31  631 92  HOH HOH A . 
B 2 HOH 32  632 116 HOH HOH A . 
B 2 HOH 33  633 75  HOH HOH A . 
B 2 HOH 34  634 2   HOH HOH A . 
B 2 HOH 35  635 82  HOH HOH A . 
B 2 HOH 36  636 46  HOH HOH A . 
B 2 HOH 37  637 4   HOH HOH A . 
B 2 HOH 38  638 5   HOH HOH A . 
B 2 HOH 39  639 125 HOH HOH A . 
B 2 HOH 40  640 16  HOH HOH A . 
B 2 HOH 41  641 11  HOH HOH A . 
B 2 HOH 42  642 114 HOH HOH A . 
B 2 HOH 43  643 15  HOH HOH A . 
B 2 HOH 44  644 29  HOH HOH A . 
B 2 HOH 45  645 140 HOH HOH A . 
B 2 HOH 46  646 22  HOH HOH A . 
B 2 HOH 47  647 93  HOH HOH A . 
B 2 HOH 48  648 21  HOH HOH A . 
B 2 HOH 49  649 135 HOH HOH A . 
B 2 HOH 50  650 14  HOH HOH A . 
B 2 HOH 51  651 36  HOH HOH A . 
B 2 HOH 52  652 47  HOH HOH A . 
B 2 HOH 53  653 87  HOH HOH A . 
B 2 HOH 54  654 72  HOH HOH A . 
B 2 HOH 55  655 130 HOH HOH A . 
B 2 HOH 56  656 70  HOH HOH A . 
B 2 HOH 57  657 64  HOH HOH A . 
B 2 HOH 58  658 42  HOH HOH A . 
B 2 HOH 59  659 57  HOH HOH A . 
B 2 HOH 60  660 103 HOH HOH A . 
B 2 HOH 61  661 26  HOH HOH A . 
B 2 HOH 62  662 74  HOH HOH A . 
B 2 HOH 63  663 67  HOH HOH A . 
B 2 HOH 64  664 133 HOH HOH A . 
B 2 HOH 65  665 109 HOH HOH A . 
B 2 HOH 66  666 128 HOH HOH A . 
B 2 HOH 67  667 80  HOH HOH A . 
B 2 HOH 68  668 97  HOH HOH A . 
B 2 HOH 69  669 101 HOH HOH A . 
B 2 HOH 70  670 71  HOH HOH A . 
B 2 HOH 71  671 120 HOH HOH A . 
B 2 HOH 72  672 127 HOH HOH A . 
B 2 HOH 73  673 68  HOH HOH A . 
B 2 HOH 74  674 105 HOH HOH A . 
B 2 HOH 75  675 121 HOH HOH A . 
B 2 HOH 76  676 34  HOH HOH A . 
B 2 HOH 77  677 62  HOH HOH A . 
B 2 HOH 78  678 63  HOH HOH A . 
B 2 HOH 79  679 30  HOH HOH A . 
B 2 HOH 80  680 119 HOH HOH A . 
B 2 HOH 81  681 60  HOH HOH A . 
B 2 HOH 82  682 25  HOH HOH A . 
B 2 HOH 83  683 139 HOH HOH A . 
B 2 HOH 84  684 129 HOH HOH A . 
B 2 HOH 85  685 9   HOH HOH A . 
B 2 HOH 86  686 96  HOH HOH A . 
B 2 HOH 87  687 84  HOH HOH A . 
B 2 HOH 88  688 102 HOH HOH A . 
B 2 HOH 89  689 88  HOH HOH A . 
B 2 HOH 90  690 79  HOH HOH A . 
B 2 HOH 91  691 141 HOH HOH A . 
B 2 HOH 92  692 90  HOH HOH A . 
B 2 HOH 93  693 48  HOH HOH A . 
B 2 HOH 94  694 33  HOH HOH A . 
B 2 HOH 95  695 65  HOH HOH A . 
B 2 HOH 96  696 24  HOH HOH A . 
B 2 HOH 97  697 49  HOH HOH A . 
B 2 HOH 98  698 95  HOH HOH A . 
B 2 HOH 99  699 113 HOH HOH A . 
B 2 HOH 100 700 98  HOH HOH A . 
B 2 HOH 101 701 41  HOH HOH A . 
B 2 HOH 102 702 89  HOH HOH A . 
B 2 HOH 103 703 85  HOH HOH A . 
B 2 HOH 104 704 69  HOH HOH A . 
B 2 HOH 105 705 118 HOH HOH A . 
B 2 HOH 106 706 123 HOH HOH A . 
B 2 HOH 107 707 142 HOH HOH A . 
B 2 HOH 108 708 86  HOH HOH A . 
B 2 HOH 109 709 58  HOH HOH A . 
B 2 HOH 110 710 99  HOH HOH A . 
B 2 HOH 111 711 143 HOH HOH A . 
B 2 HOH 112 712 73  HOH HOH A . 
B 2 HOH 113 713 100 HOH HOH A . 
B 2 HOH 114 714 132 HOH HOH A . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC   ? ? ? 5.8.0258 1 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless  ? ? ? .        2 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PDB-REDO ? ? ? .        3 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS      ? ? ? .        4 
? phasing          ? ? ? ? ? ? ? ? ? ? ? MOLREP   ? ? ? .        5 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     8BBM 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     68.286 
_cell.length_a_esd                 ? 
_cell.length_b                     68.286 
_cell.length_b_esd                 ? 
_cell.length_c                     185.842 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
_cell.pdbx_esd_method              ? 
# 
_symmetry.entry_id                         8BBM 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   8BBM 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                       ? 
_exptl_crystal.density_diffrn               ? 
_exptl_crystal.density_Matthews             3.05 
_exptl_crystal.density_method               ? 
_exptl_crystal.density_percent_sol          59.61 
_exptl_crystal.description                  ? 
_exptl_crystal.F_000                        ? 
_exptl_crystal.id                           1 
_exptl_crystal.preparation                  ? 
_exptl_crystal.size_max                     ? 
_exptl_crystal.size_mid                     ? 
_exptl_crystal.size_min                     ? 
_exptl_crystal.size_rad                     ? 
_exptl_crystal.colour_lustre                ? 
_exptl_crystal.colour_modifier              ? 
_exptl_crystal.colour_primary               ? 
_exptl_crystal.density_meas                 ? 
_exptl_crystal.density_meas_esd             ? 
_exptl_crystal.density_meas_gt              ? 
_exptl_crystal.density_meas_lt              ? 
_exptl_crystal.density_meas_temp            ? 
_exptl_crystal.density_meas_temp_esd        ? 
_exptl_crystal.density_meas_temp_gt         ? 
_exptl_crystal.density_meas_temp_lt         ? 
_exptl_crystal.pdbx_crystal_image_url       ? 
_exptl_crystal.pdbx_crystal_image_format    ? 
_exptl_crystal.pdbx_mosaicity               ? 
_exptl_crystal.pdbx_mosaicity_esd           ? 
_exptl_crystal.pdbx_mosaic_method           ? 
_exptl_crystal.pdbx_mosaic_block_size       ? 
_exptl_crystal.pdbx_mosaic_block_size_esd   ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15-17% Peg 6000, 0.1M Sodium iodide or 15-17% Peg, 0.2M potassium nitrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 9M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-10-23 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS-II BEAMLINE 17-ID-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   17-ID-1 
_diffrn_source.pdbx_synchrotron_site       NSLS-II 
# 
_reflns.B_iso_Wilson_estimate                          32.3 
_reflns.entry_id                                       8BBM 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              1.95 
_reflns.d_resolution_low                               29.6 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     19605 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           100 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                38.4 
_reflns.pdbx_Rmerge_I_obs                              ? 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          17.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                0.157 
_reflns.pdbx_Rpim_I_all                                ? 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   ? 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
_reflns.pdbx_CC_split_method                           ? 
# 
_reflns_shell.d_res_high                                    1.95 
_reflns_shell.d_res_low                                     2.00 
_reflns_shell.meanI_over_sigI_all                           ? 
_reflns_shell.meanI_over_sigI_obs                           ? 
_reflns_shell.number_measured_all                           ? 
_reflns_shell.number_measured_obs                           ? 
_reflns_shell.number_possible                               ? 
_reflns_shell.number_unique_all                             ? 
_reflns_shell.number_unique_obs                             53016 
_reflns_shell.percent_possible_all                          ? 
_reflns_shell.percent_possible_obs                          ? 
_reflns_shell.Rmerge_F_all                                  ? 
_reflns_shell.Rmerge_F_obs                                  ? 
_reflns_shell.Rmerge_I_all                                  ? 
_reflns_shell.Rmerge_I_obs                                  ? 
_reflns_shell.meanI_over_sigI_gt                            ? 
_reflns_shell.meanI_over_uI_all                             ? 
_reflns_shell.meanI_over_uI_gt                              ? 
_reflns_shell.number_measured_gt                            ? 
_reflns_shell.number_unique_gt                              ? 
_reflns_shell.percent_possible_gt                           ? 
_reflns_shell.Rmerge_F_gt                                   ? 
_reflns_shell.Rmerge_I_gt                                   ? 
_reflns_shell.pdbx_redundancy                               ? 
_reflns_shell.pdbx_Rsym_value                               ? 
_reflns_shell.pdbx_chi_squared                              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all                     ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs                     ? 
_reflns_shell.pdbx_Rrim_I_all                               5.033 
_reflns_shell.pdbx_Rpim_I_all                               ? 
_reflns_shell.pdbx_rejects                                  ? 
_reflns_shell.pdbx_ordinal                                  1 
_reflns_shell.pdbx_diffrn_id                                1 
_reflns_shell.pdbx_CC_half                                  ? 
_reflns_shell.pdbx_CC_star                                  ? 
_reflns_shell.pdbx_R_split                                  ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal             ? 
_reflns_shell.pdbx_percent_possible_spherical               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous   ? 
_reflns_shell.pdbx_percent_possible_spherical_anomalous     ? 
_reflns_shell.pdbx_redundancy_anomalous                     ? 
_reflns_shell.pdbx_CC_half_anomalous                        ? 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous             ? 
_reflns_shell.pdbx_percent_possible_anomalous               ? 
# 
_refine.aniso_B[1][1]                            0.77 
_refine.aniso_B[1][2]                            0.39 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            0.77 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -2.51 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               54.275 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.934 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS
U VALUES : WITH TLS ADDED
;
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 8BBM 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.95 
_refine.ls_d_res_low                             29.59 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     18522 
_refine.ls_number_reflns_R_free                  1017 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.93 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.20453 
_refine.ls_R_factor_R_free                       0.25194 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.20204 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2XSE 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.143 
_refine.pdbx_overall_ESU_R_Free                  0.145 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             0.70 
_refine.pdbx_solvent_shrinkage_radii             0.70 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             8.198 
_refine.overall_SU_ML                            0.113 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        29.59 
_refine_hist.number_atoms_solvent             114 
_refine_hist.number_atoms_total               1514 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        1400 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.013  0.018  1476 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  1408 ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.621  1.883  1985 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 1.142  2.816  3275 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 5.090  5.000  179  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 33.110 23.857 70   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 13.895 15.000 257  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 11.894 15.000 11   ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.097  0.200  204  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.020  1630 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  309  ? r_gen_planes_other     ? ? 
'X-RAY DIFFRACTION' ? 2.130  3.765  704  ? r_mcbond_it            ? ? 
'X-RAY DIFFRACTION' ? 2.119  3.762  703  ? r_mcbond_other         ? ? 
'X-RAY DIFFRACTION' ? 3.227  5.620  887  ? r_mcangle_it           ? ? 
'X-RAY DIFFRACTION' ? 3.227  5.624  888  ? r_mcangle_other        ? ? 
'X-RAY DIFFRACTION' ? 2.762  4.102  772  ? r_scbond_it            ? ? 
'X-RAY DIFFRACTION' ? 2.759  4.103  772  ? r_scbond_other         ? ? 
'X-RAY DIFFRACTION' ? 4.379  6.008  1098 ? r_scangle_other        ? ? 
'X-RAY DIFFRACTION' ? 7.393  70.964 6168 ? r_long_range_B_refined ? ? 
'X-RAY DIFFRACTION' ? 7.345  70.659 6091 ? r_long_range_B_other   ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.950 
_refine_ls_shell.d_res_low                        2.001 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             72 
_refine_ls_shell.number_reflns_R_work             1317 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.415 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.340 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     8BBM 
_struct.title                        'DNA binding domain of J-DNA Binding Protein 1 (JBP1)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        8BBM 
_struct_keywords.text            'J-DNA binding protein, JBP1, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    JBP1_LEITA 
_struct_ref.pdbx_db_accession          Q9U6M1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TNLMVSTAVEKKKYLDSEFLLHCISAQLLDMWKQARARWLELVGKEWAHMLALNPERKDFLWKNQSEMNSAFFDLCEVGK
QVMLGLLGKEVALPKEEQAFWIMYAVHLSAACAEELHMPEVAMSLRKLNVKLKDFNFGGTRYFKDMPPEEKKRRMERKQR
IEEARRHGMP
;
_struct_ref.pdbx_align_begin           392 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              8BBM 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 170 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9U6M1 
_struct_ref_seq.db_align_beg                  392 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  561 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       392 
_struct_ref_seq.pdbx_auth_seq_align_end       561 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0     ? 
1 MORE         0     ? 
1 'SSA (A^2)'  10060 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 THR A 1   ? LYS A 11  ? THR A 392 LYS A 402 1 ? 11 
HELX_P HELX_P2 AA2 LYS A 12  ? LEU A 15  ? LYS A 403 LEU A 406 5 ? 4  
HELX_P HELX_P3 AA3 ASP A 16  ? LEU A 21  ? ASP A 407 LEU A 412 1 ? 6  
HELX_P HELX_P4 AA4 SER A 25  ? ASN A 54  ? SER A 416 ASN A 445 1 ? 30 
HELX_P HELX_P5 AA5 SER A 66  ? GLY A 88  ? SER A 457 GLY A 479 1 ? 23 
HELX_P HELX_P6 AA6 LEU A 93  ? GLU A 115 ? LEU A 484 GLU A 506 1 ? 23 
HELX_P HELX_P7 AA7 SER A 124 ? PHE A 137 ? SER A 515 PHE A 528 1 ? 14 
HELX_P HELX_P8 AA8 GLY A 138 ? PHE A 143 ? GLY A 529 PHE A 534 1 ? 6  
HELX_P HELX_P9 AA9 PRO A 147 ? ARG A 166 ? PRO A 538 ARG A 557 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A LEU 3   C ? ? ? 1_555 A MSE 4   N ? ? A LEU 394 A MSE 395 1_555 ? ? ? ? ? ? ? 1.342 ? ? 
covale2  covale both ? A MSE 4   C ? ? ? 1_555 A VAL 5   N ? ? A MSE 395 A VAL 396 1_555 ? ? ? ? ? ? ? 1.344 ? ? 
covale3  covale both ? A ASP 30  C ? ? ? 1_555 A MSE 31  N ? ? A ASP 421 A MSE 422 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale4  covale both ? A MSE 31  C ? ? ? 1_555 A TRP 32  N ? ? A MSE 422 A TRP 423 1_555 ? ? ? ? ? ? ? 1.335 ? ? 
covale5  covale both ? A HIS 49  C ? ? ? 1_555 A MSE 50  N ? ? A HIS 440 A MSE 441 1_555 ? ? ? ? ? ? ? 1.338 ? ? 
covale6  covale both ? A MSE 50  C ? ? ? 1_555 A LEU 51  N ? ? A MSE 441 A LEU 442 1_555 ? ? ? ? ? ? ? 1.335 ? ? 
covale7  covale both ? A GLU 67  C ? ? ? 1_555 A MSE 68  N ? ? A GLU 458 A MSE 459 1_555 ? ? ? ? ? ? ? 1.336 ? ? 
covale8  covale both ? A MSE 68  C ? ? ? 1_555 A ASN 69  N ? ? A MSE 459 A ASN 460 1_555 ? ? ? ? ? ? ? 1.336 ? ? 
covale9  covale both ? A VAL 82  C ? ? ? 1_555 A MSE 83  N ? ? A VAL 473 A MSE 474 1_555 ? ? ? ? ? ? ? 1.343 ? ? 
covale10 covale both ? A MSE 83  C ? ? ? 1_555 A LEU 84  N ? ? A MSE 474 A LEU 475 1_555 ? ? ? ? ? ? ? 1.338 ? ? 
covale11 covale both ? A ILE 102 C ? ? ? 1_555 A MSE 103 N A ? A ILE 493 A MSE 494 1_555 ? ? ? ? ? ? ? 1.344 ? ? 
covale12 covale both ? A ILE 102 C ? ? ? 1_555 A MSE 103 N B ? A ILE 493 A MSE 494 1_555 ? ? ? ? ? ? ? 1.340 ? ? 
covale13 covale both ? A MSE 103 C A ? ? 1_555 A TYR 104 N ? ? A MSE 494 A TYR 495 1_555 ? ? ? ? ? ? ? 1.336 ? ? 
covale14 covale both ? A MSE 103 C B ? ? 1_555 A TYR 104 N ? ? A MSE 494 A TYR 495 1_555 ? ? ? ? ? ? ? 1.336 ? ? 
covale15 covale both ? A HIS 117 C ? ? ? 1_555 A MSE 118 N ? ? A HIS 508 A MSE 509 1_555 ? ? ? ? ? ? ? 1.334 ? ? 
covale16 covale both ? A MSE 118 C ? ? ? 1_555 A PRO 119 N ? ? A MSE 509 A PRO 510 1_555 ? ? ? ? ? ? ? 1.344 ? ? 
covale17 covale both ? A ALA 122 C ? ? ? 1_555 A MSE 123 N ? ? A ALA 513 A MSE 514 1_555 ? ? ? ? ? ? ? 1.345 ? ? 
covale18 covale both ? A MSE 123 C ? ? ? 1_555 A SER 124 N ? ? A MSE 514 A SER 515 1_555 ? ? ? ? ? ? ? 1.343 ? ? 
covale19 covale both ? A ASP 145 C ? ? ? 1_555 A MSE 146 N ? ? A ASP 536 A MSE 537 1_555 ? ? ? ? ? ? ? 1.341 ? ? 
covale20 covale both ? A MSE 146 C ? ? ? 1_555 A PRO 147 N ? ? A MSE 537 A PRO 538 1_555 ? ? ? ? ? ? ? 1.357 ? ? 
covale21 covale both ? A ARG 154 C ? ? ? 1_555 A MSE 155 N A ? A ARG 545 A MSE 546 1_555 ? ? ? ? ? ? ? 1.341 ? ? 
covale22 covale both ? A ARG 154 C ? ? ? 1_555 A MSE 155 N B ? A ARG 545 A MSE 546 1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale23 covale both ? A MSE 155 C A ? ? 1_555 A GLU 156 N ? ? A MSE 546 A GLU 547 1_555 ? ? ? ? ? ? ? 1.336 ? ? 
covale24 covale both ? A MSE 155 C B ? ? 1_555 A GLU 156 N ? ? A MSE 546 A GLU 547 1_555 ? ? ? ? ? ? ? 1.340 ? ? 
covale25 covale both ? A GLY 168 C ? ? ? 1_555 A MSE 169 N ? ? A GLY 559 A MSE 560 1_555 ? ? ? ? ? ? ? 1.340 ? ? 
covale26 covale both ? A MSE 169 C ? ? ? 1_555 A PRO 170 N ? ? A MSE 560 A PRO 561 1_555 ? ? ? ? ? ? ? 1.354 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1  MSE A 4   ? . . . . MSE A 395 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
2  MSE A 31  ? . . . . MSE A 422 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
3  MSE A 50  ? . . . . MSE A 441 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
4  MSE A 68  ? . . . . MSE A 459 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
5  MSE A 83  ? . . . . MSE A 474 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
6  MSE A 103 A . . . . MSE A 494 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
7  MSE A 103 B . . . . MSE A 494 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
8  MSE A 118 ? . . . . MSE A 509 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
9  MSE A 123 ? . . . . MSE A 514 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
10 MSE A 146 ? . . . . MSE A 537 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
11 MSE A 155 A . . . . MSE A 546 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
12 MSE A 155 B . . . . MSE A 546 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
13 MSE A 169 ? . . . . MSE A 560 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
# 
_pdbx_entry_details.entry_id                   8BBM 
_pdbx_entry_details.has_ligand_of_interest     N 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 663 ? ? O A HOH 673 ? ? 2.13 
2 1 O A HOH 630 ? ? O A HOH 670 ? ? 2.16 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             MSE 
_pdbx_validate_rmsd_angle.auth_seq_id_1              395 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             SE 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             MSE 
_pdbx_validate_rmsd_angle.auth_seq_id_2              395 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CE 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             MSE 
_pdbx_validate_rmsd_angle.auth_seq_id_3              395 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                115.91 
_pdbx_validate_rmsd_angle.angle_target_value         98.90 
_pdbx_validate_rmsd_angle.angle_deviation            17.01 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.20 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 413 ? ? 71.91   -1.65 
2 1 MSE A 514 ? ? -108.25 78.86 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A MSE 4   A MSE 395 ? MET 'modified residue' 
2  A MSE 31  A MSE 422 ? MET 'modified residue' 
3  A MSE 50  A MSE 441 ? MET 'modified residue' 
4  A MSE 68  A MSE 459 ? MET 'modified residue' 
5  A MSE 83  A MSE 474 ? MET 'modified residue' 
6  A MSE 103 A MSE 494 ? MET 'modified residue' 
7  A MSE 118 A MSE 509 ? MET 'modified residue' 
8  A MSE 123 A MSE 514 ? MET 'modified residue' 
9  A MSE 146 A MSE 537 ? MET 'modified residue' 
10 A MSE 155 A MSE 546 ? MET 'modified residue' 
11 A MSE 169 A MSE 560 ? MET 'modified residue' 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         2.7230 
_pdbx_refine_tls.origin_y         21.3697 
_pdbx_refine_tls.origin_z         -1.5216 
_pdbx_refine_tls.T[1][1]          0.1172 
_pdbx_refine_tls.T[1][1]_esd      ? 
_pdbx_refine_tls.T[1][2]          -0.0284 
_pdbx_refine_tls.T[1][2]_esd      ? 
_pdbx_refine_tls.T[1][3]          0.0447 
_pdbx_refine_tls.T[1][3]_esd      ? 
_pdbx_refine_tls.T[2][2]          0.0505 
_pdbx_refine_tls.T[2][2]_esd      ? 
_pdbx_refine_tls.T[2][3]          -0.0179 
_pdbx_refine_tls.T[2][3]_esd      ? 
_pdbx_refine_tls.T[3][3]          0.0234 
_pdbx_refine_tls.T[3][3]_esd      ? 
_pdbx_refine_tls.L[1][1]          2.3929 
_pdbx_refine_tls.L[1][1]_esd      ? 
_pdbx_refine_tls.L[1][2]          -0.1206 
_pdbx_refine_tls.L[1][2]_esd      ? 
_pdbx_refine_tls.L[1][3]          -1.5178 
_pdbx_refine_tls.L[1][3]_esd      ? 
_pdbx_refine_tls.L[2][2]          1.1570 
_pdbx_refine_tls.L[2][2]_esd      ? 
_pdbx_refine_tls.L[2][3]          0.9657 
_pdbx_refine_tls.L[2][3]_esd      ? 
_pdbx_refine_tls.L[3][3]          4.1488 
_pdbx_refine_tls.L[3][3]_esd      ? 
_pdbx_refine_tls.S[1][1]          0.1769 
_pdbx_refine_tls.S[1][1]_esd      ? 
_pdbx_refine_tls.S[1][2]          -0.0494 
_pdbx_refine_tls.S[1][2]_esd      ? 
_pdbx_refine_tls.S[1][3]          0.0653 
_pdbx_refine_tls.S[1][3]_esd      ? 
_pdbx_refine_tls.S[2][1]          -0.1117 
_pdbx_refine_tls.S[2][1]_esd      ? 
_pdbx_refine_tls.S[2][2]          0.0033 
_pdbx_refine_tls.S[2][2]_esd      ? 
_pdbx_refine_tls.S[2][3]          0.0223 
_pdbx_refine_tls.S[2][3]_esd      ? 
_pdbx_refine_tls.S[3][1]          -0.3954 
_pdbx_refine_tls.S[3][1]_esd      ? 
_pdbx_refine_tls.S[3][2]          0.2956 
_pdbx_refine_tls.S[3][2]_esd      ? 
_pdbx_refine_tls.S[3][3]          -0.1801 
_pdbx_refine_tls.S[3][3]_esd      ? 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     392 
_pdbx_refine_tls_group.beg_PDB_ins_code    ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     561 
_pdbx_refine_tls_group.end_PDB_ins_code    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
GLN N    N  N N 88  
GLN CA   C  N S 89  
GLN C    C  N N 90  
GLN O    O  N N 91  
GLN CB   C  N N 92  
GLN CG   C  N N 93  
GLN CD   C  N N 94  
GLN OE1  O  N N 95  
GLN NE2  N  N N 96  
GLN OXT  O  N N 97  
GLN H    H  N N 98  
GLN H2   H  N N 99  
GLN HA   H  N N 100 
GLN HB2  H  N N 101 
GLN HB3  H  N N 102 
GLN HG2  H  N N 103 
GLN HG3  H  N N 104 
GLN HE21 H  N N 105 
GLN HE22 H  N N 106 
GLN HXT  H  N N 107 
GLU N    N  N N 108 
GLU CA   C  N S 109 
GLU C    C  N N 110 
GLU O    O  N N 111 
GLU CB   C  N N 112 
GLU CG   C  N N 113 
GLU CD   C  N N 114 
GLU OE1  O  N N 115 
GLU OE2  O  N N 116 
GLU OXT  O  N N 117 
GLU H    H  N N 118 
GLU H2   H  N N 119 
GLU HA   H  N N 120 
GLU HB2  H  N N 121 
GLU HB3  H  N N 122 
GLU HG2  H  N N 123 
GLU HG3  H  N N 124 
GLU HE2  H  N N 125 
GLU HXT  H  N N 126 
GLY N    N  N N 127 
GLY CA   C  N N 128 
GLY C    C  N N 129 
GLY O    O  N N 130 
GLY OXT  O  N N 131 
GLY H    H  N N 132 
GLY H2   H  N N 133 
GLY HA2  H  N N 134 
GLY HA3  H  N N 135 
GLY HXT  H  N N 136 
HIS N    N  N N 137 
HIS CA   C  N S 138 
HIS C    C  N N 139 
HIS O    O  N N 140 
HIS CB   C  N N 141 
HIS CG   C  Y N 142 
HIS ND1  N  Y N 143 
HIS CD2  C  Y N 144 
HIS CE1  C  Y N 145 
HIS NE2  N  Y N 146 
HIS OXT  O  N N 147 
HIS H    H  N N 148 
HIS H2   H  N N 149 
HIS HA   H  N N 150 
HIS HB2  H  N N 151 
HIS HB3  H  N N 152 
HIS HD1  H  N N 153 
HIS HD2  H  N N 154 
HIS HE1  H  N N 155 
HIS HE2  H  N N 156 
HIS HXT  H  N N 157 
HOH O    O  N N 158 
HOH H1   H  N N 159 
HOH H2   H  N N 160 
ILE N    N  N N 161 
ILE CA   C  N S 162 
ILE C    C  N N 163 
ILE O    O  N N 164 
ILE CB   C  N S 165 
ILE CG1  C  N N 166 
ILE CG2  C  N N 167 
ILE CD1  C  N N 168 
ILE OXT  O  N N 169 
ILE H    H  N N 170 
ILE H2   H  N N 171 
ILE HA   H  N N 172 
ILE HB   H  N N 173 
ILE HG12 H  N N 174 
ILE HG13 H  N N 175 
ILE HG21 H  N N 176 
ILE HG22 H  N N 177 
ILE HG23 H  N N 178 
ILE HD11 H  N N 179 
ILE HD12 H  N N 180 
ILE HD13 H  N N 181 
ILE HXT  H  N N 182 
LEU N    N  N N 183 
LEU CA   C  N S 184 
LEU C    C  N N 185 
LEU O    O  N N 186 
LEU CB   C  N N 187 
LEU CG   C  N N 188 
LEU CD1  C  N N 189 
LEU CD2  C  N N 190 
LEU OXT  O  N N 191 
LEU H    H  N N 192 
LEU H2   H  N N 193 
LEU HA   H  N N 194 
LEU HB2  H  N N 195 
LEU HB3  H  N N 196 
LEU HG   H  N N 197 
LEU HD11 H  N N 198 
LEU HD12 H  N N 199 
LEU HD13 H  N N 200 
LEU HD21 H  N N 201 
LEU HD22 H  N N 202 
LEU HD23 H  N N 203 
LEU HXT  H  N N 204 
LYS N    N  N N 205 
LYS CA   C  N S 206 
LYS C    C  N N 207 
LYS O    O  N N 208 
LYS CB   C  N N 209 
LYS CG   C  N N 210 
LYS CD   C  N N 211 
LYS CE   C  N N 212 
LYS NZ   N  N N 213 
LYS OXT  O  N N 214 
LYS H    H  N N 215 
LYS H2   H  N N 216 
LYS HA   H  N N 217 
LYS HB2  H  N N 218 
LYS HB3  H  N N 219 
LYS HG2  H  N N 220 
LYS HG3  H  N N 221 
LYS HD2  H  N N 222 
LYS HD3  H  N N 223 
LYS HE2  H  N N 224 
LYS HE3  H  N N 225 
LYS HZ1  H  N N 226 
LYS HZ2  H  N N 227 
LYS HZ3  H  N N 228 
LYS HXT  H  N N 229 
MSE N    N  N N 230 
MSE CA   C  N S 231 
MSE C    C  N N 232 
MSE O    O  N N 233 
MSE OXT  O  N N 234 
MSE CB   C  N N 235 
MSE CG   C  N N 236 
MSE SE   SE N N 237 
MSE CE   C  N N 238 
MSE H    H  N N 239 
MSE H2   H  N N 240 
MSE HA   H  N N 241 
MSE HXT  H  N N 242 
MSE HB2  H  N N 243 
MSE HB3  H  N N 244 
MSE HG2  H  N N 245 
MSE HG3  H  N N 246 
MSE HE1  H  N N 247 
MSE HE2  H  N N 248 
MSE HE3  H  N N 249 
PHE N    N  N N 250 
PHE CA   C  N S 251 
PHE C    C  N N 252 
PHE O    O  N N 253 
PHE CB   C  N N 254 
PHE CG   C  Y N 255 
PHE CD1  C  Y N 256 
PHE CD2  C  Y N 257 
PHE CE1  C  Y N 258 
PHE CE2  C  Y N 259 
PHE CZ   C  Y N 260 
PHE OXT  O  N N 261 
PHE H    H  N N 262 
PHE H2   H  N N 263 
PHE HA   H  N N 264 
PHE HB2  H  N N 265 
PHE HB3  H  N N 266 
PHE HD1  H  N N 267 
PHE HD2  H  N N 268 
PHE HE1  H  N N 269 
PHE HE2  H  N N 270 
PHE HZ   H  N N 271 
PHE HXT  H  N N 272 
PRO N    N  N N 273 
PRO CA   C  N S 274 
PRO C    C  N N 275 
PRO O    O  N N 276 
PRO CB   C  N N 277 
PRO CG   C  N N 278 
PRO CD   C  N N 279 
PRO OXT  O  N N 280 
PRO H    H  N N 281 
PRO HA   H  N N 282 
PRO HB2  H  N N 283 
PRO HB3  H  N N 284 
PRO HG2  H  N N 285 
PRO HG3  H  N N 286 
PRO HD2  H  N N 287 
PRO HD3  H  N N 288 
PRO HXT  H  N N 289 
SER N    N  N N 290 
SER CA   C  N S 291 
SER C    C  N N 292 
SER O    O  N N 293 
SER CB   C  N N 294 
SER OG   O  N N 295 
SER OXT  O  N N 296 
SER H    H  N N 297 
SER H2   H  N N 298 
SER HA   H  N N 299 
SER HB2  H  N N 300 
SER HB3  H  N N 301 
SER HG   H  N N 302 
SER HXT  H  N N 303 
THR N    N  N N 304 
THR CA   C  N S 305 
THR C    C  N N 306 
THR O    O  N N 307 
THR CB   C  N R 308 
THR OG1  O  N N 309 
THR CG2  C  N N 310 
THR OXT  O  N N 311 
THR H    H  N N 312 
THR H2   H  N N 313 
THR HA   H  N N 314 
THR HB   H  N N 315 
THR HG1  H  N N 316 
THR HG21 H  N N 317 
THR HG22 H  N N 318 
THR HG23 H  N N 319 
THR HXT  H  N N 320 
TRP N    N  N N 321 
TRP CA   C  N S 322 
TRP C    C  N N 323 
TRP O    O  N N 324 
TRP CB   C  N N 325 
TRP CG   C  Y N 326 
TRP CD1  C  Y N 327 
TRP CD2  C  Y N 328 
TRP NE1  N  Y N 329 
TRP CE2  C  Y N 330 
TRP CE3  C  Y N 331 
TRP CZ2  C  Y N 332 
TRP CZ3  C  Y N 333 
TRP CH2  C  Y N 334 
TRP OXT  O  N N 335 
TRP H    H  N N 336 
TRP H2   H  N N 337 
TRP HA   H  N N 338 
TRP HB2  H  N N 339 
TRP HB3  H  N N 340 
TRP HD1  H  N N 341 
TRP HE1  H  N N 342 
TRP HE3  H  N N 343 
TRP HZ2  H  N N 344 
TRP HZ3  H  N N 345 
TRP HH2  H  N N 346 
TRP HXT  H  N N 347 
TYR N    N  N N 348 
TYR CA   C  N S 349 
TYR C    C  N N 350 
TYR O    O  N N 351 
TYR CB   C  N N 352 
TYR CG   C  Y N 353 
TYR CD1  C  Y N 354 
TYR CD2  C  Y N 355 
TYR CE1  C  Y N 356 
TYR CE2  C  Y N 357 
TYR CZ   C  Y N 358 
TYR OH   O  N N 359 
TYR OXT  O  N N 360 
TYR H    H  N N 361 
TYR H2   H  N N 362 
TYR HA   H  N N 363 
TYR HB2  H  N N 364 
TYR HB3  H  N N 365 
TYR HD1  H  N N 366 
TYR HD2  H  N N 367 
TYR HE1  H  N N 368 
TYR HE2  H  N N 369 
TYR HH   H  N N 370 
TYR HXT  H  N N 371 
VAL N    N  N N 372 
VAL CA   C  N S 373 
VAL C    C  N N 374 
VAL O    O  N N 375 
VAL CB   C  N N 376 
VAL CG1  C  N N 377 
VAL CG2  C  N N 378 
VAL OXT  O  N N 379 
VAL H    H  N N 380 
VAL H2   H  N N 381 
VAL HA   H  N N 382 
VAL HB   H  N N 383 
VAL HG11 H  N N 384 
VAL HG12 H  N N 385 
VAL HG13 H  N N 386 
VAL HG21 H  N N 387 
VAL HG22 H  N N 388 
VAL HG23 H  N N 389 
VAL HXT  H  N N 390 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
HOH O   H1   sing N N 150 
HOH O   H2   sing N N 151 
ILE N   CA   sing N N 152 
ILE N   H    sing N N 153 
ILE N   H2   sing N N 154 
ILE CA  C    sing N N 155 
ILE CA  CB   sing N N 156 
ILE CA  HA   sing N N 157 
ILE C   O    doub N N 158 
ILE C   OXT  sing N N 159 
ILE CB  CG1  sing N N 160 
ILE CB  CG2  sing N N 161 
ILE CB  HB   sing N N 162 
ILE CG1 CD1  sing N N 163 
ILE CG1 HG12 sing N N 164 
ILE CG1 HG13 sing N N 165 
ILE CG2 HG21 sing N N 166 
ILE CG2 HG22 sing N N 167 
ILE CG2 HG23 sing N N 168 
ILE CD1 HD11 sing N N 169 
ILE CD1 HD12 sing N N 170 
ILE CD1 HD13 sing N N 171 
ILE OXT HXT  sing N N 172 
LEU N   CA   sing N N 173 
LEU N   H    sing N N 174 
LEU N   H2   sing N N 175 
LEU CA  C    sing N N 176 
LEU CA  CB   sing N N 177 
LEU CA  HA   sing N N 178 
LEU C   O    doub N N 179 
LEU C   OXT  sing N N 180 
LEU CB  CG   sing N N 181 
LEU CB  HB2  sing N N 182 
LEU CB  HB3  sing N N 183 
LEU CG  CD1  sing N N 184 
LEU CG  CD2  sing N N 185 
LEU CG  HG   sing N N 186 
LEU CD1 HD11 sing N N 187 
LEU CD1 HD12 sing N N 188 
LEU CD1 HD13 sing N N 189 
LEU CD2 HD21 sing N N 190 
LEU CD2 HD22 sing N N 191 
LEU CD2 HD23 sing N N 192 
LEU OXT HXT  sing N N 193 
LYS N   CA   sing N N 194 
LYS N   H    sing N N 195 
LYS N   H2   sing N N 196 
LYS CA  C    sing N N 197 
LYS CA  CB   sing N N 198 
LYS CA  HA   sing N N 199 
LYS C   O    doub N N 200 
LYS C   OXT  sing N N 201 
LYS CB  CG   sing N N 202 
LYS CB  HB2  sing N N 203 
LYS CB  HB3  sing N N 204 
LYS CG  CD   sing N N 205 
LYS CG  HG2  sing N N 206 
LYS CG  HG3  sing N N 207 
LYS CD  CE   sing N N 208 
LYS CD  HD2  sing N N 209 
LYS CD  HD3  sing N N 210 
LYS CE  NZ   sing N N 211 
LYS CE  HE2  sing N N 212 
LYS CE  HE3  sing N N 213 
LYS NZ  HZ1  sing N N 214 
LYS NZ  HZ2  sing N N 215 
LYS NZ  HZ3  sing N N 216 
LYS OXT HXT  sing N N 217 
MSE N   CA   sing N N 218 
MSE N   H    sing N N 219 
MSE N   H2   sing N N 220 
MSE CA  C    sing N N 221 
MSE CA  CB   sing N N 222 
MSE CA  HA   sing N N 223 
MSE C   O    doub N N 224 
MSE C   OXT  sing N N 225 
MSE OXT HXT  sing N N 226 
MSE CB  CG   sing N N 227 
MSE CB  HB2  sing N N 228 
MSE CB  HB3  sing N N 229 
MSE CG  SE   sing N N 230 
MSE CG  HG2  sing N N 231 
MSE CG  HG3  sing N N 232 
MSE SE  CE   sing N N 233 
MSE CE  HE1  sing N N 234 
MSE CE  HE2  sing N N 235 
MSE CE  HE3  sing N N 236 
PHE N   CA   sing N N 237 
PHE N   H    sing N N 238 
PHE N   H2   sing N N 239 
PHE CA  C    sing N N 240 
PHE CA  CB   sing N N 241 
PHE CA  HA   sing N N 242 
PHE C   O    doub N N 243 
PHE C   OXT  sing N N 244 
PHE CB  CG   sing N N 245 
PHE CB  HB2  sing N N 246 
PHE CB  HB3  sing N N 247 
PHE CG  CD1  doub Y N 248 
PHE CG  CD2  sing Y N 249 
PHE CD1 CE1  sing Y N 250 
PHE CD1 HD1  sing N N 251 
PHE CD2 CE2  doub Y N 252 
PHE CD2 HD2  sing N N 253 
PHE CE1 CZ   doub Y N 254 
PHE CE1 HE1  sing N N 255 
PHE CE2 CZ   sing Y N 256 
PHE CE2 HE2  sing N N 257 
PHE CZ  HZ   sing N N 258 
PHE OXT HXT  sing N N 259 
PRO N   CA   sing N N 260 
PRO N   CD   sing N N 261 
PRO N   H    sing N N 262 
PRO CA  C    sing N N 263 
PRO CA  CB   sing N N 264 
PRO CA  HA   sing N N 265 
PRO C   O    doub N N 266 
PRO C   OXT  sing N N 267 
PRO CB  CG   sing N N 268 
PRO CB  HB2  sing N N 269 
PRO CB  HB3  sing N N 270 
PRO CG  CD   sing N N 271 
PRO CG  HG2  sing N N 272 
PRO CG  HG3  sing N N 273 
PRO CD  HD2  sing N N 274 
PRO CD  HD3  sing N N 275 
PRO OXT HXT  sing N N 276 
SER N   CA   sing N N 277 
SER N   H    sing N N 278 
SER N   H2   sing N N 279 
SER CA  C    sing N N 280 
SER CA  CB   sing N N 281 
SER CA  HA   sing N N 282 
SER C   O    doub N N 283 
SER C   OXT  sing N N 284 
SER CB  OG   sing N N 285 
SER CB  HB2  sing N N 286 
SER CB  HB3  sing N N 287 
SER OG  HG   sing N N 288 
SER OXT HXT  sing N N 289 
THR N   CA   sing N N 290 
THR N   H    sing N N 291 
THR N   H2   sing N N 292 
THR CA  C    sing N N 293 
THR CA  CB   sing N N 294 
THR CA  HA   sing N N 295 
THR C   O    doub N N 296 
THR C   OXT  sing N N 297 
THR CB  OG1  sing N N 298 
THR CB  CG2  sing N N 299 
THR CB  HB   sing N N 300 
THR OG1 HG1  sing N N 301 
THR CG2 HG21 sing N N 302 
THR CG2 HG22 sing N N 303 
THR CG2 HG23 sing N N 304 
THR OXT HXT  sing N N 305 
TRP N   CA   sing N N 306 
TRP N   H    sing N N 307 
TRP N   H2   sing N N 308 
TRP CA  C    sing N N 309 
TRP CA  CB   sing N N 310 
TRP CA  HA   sing N N 311 
TRP C   O    doub N N 312 
TRP C   OXT  sing N N 313 
TRP CB  CG   sing N N 314 
TRP CB  HB2  sing N N 315 
TRP CB  HB3  sing N N 316 
TRP CG  CD1  doub Y N 317 
TRP CG  CD2  sing Y N 318 
TRP CD1 NE1  sing Y N 319 
TRP CD1 HD1  sing N N 320 
TRP CD2 CE2  doub Y N 321 
TRP CD2 CE3  sing Y N 322 
TRP NE1 CE2  sing Y N 323 
TRP NE1 HE1  sing N N 324 
TRP CE2 CZ2  sing Y N 325 
TRP CE3 CZ3  doub Y N 326 
TRP CE3 HE3  sing N N 327 
TRP CZ2 CH2  doub Y N 328 
TRP CZ2 HZ2  sing N N 329 
TRP CZ3 CH2  sing Y N 330 
TRP CZ3 HZ3  sing N N 331 
TRP CH2 HH2  sing N N 332 
TRP OXT HXT  sing N N 333 
TYR N   CA   sing N N 334 
TYR N   H    sing N N 335 
TYR N   H2   sing N N 336 
TYR CA  C    sing N N 337 
TYR CA  CB   sing N N 338 
TYR CA  HA   sing N N 339 
TYR C   O    doub N N 340 
TYR C   OXT  sing N N 341 
TYR CB  CG   sing N N 342 
TYR CB  HB2  sing N N 343 
TYR CB  HB3  sing N N 344 
TYR CG  CD1  doub Y N 345 
TYR CG  CD2  sing Y N 346 
TYR CD1 CE1  sing Y N 347 
TYR CD1 HD1  sing N N 348 
TYR CD2 CE2  doub Y N 349 
TYR CD2 HD2  sing N N 350 
TYR CE1 CZ   doub Y N 351 
TYR CE1 HE1  sing N N 352 
TYR CE2 CZ   sing Y N 353 
TYR CE2 HE2  sing N N 354 
TYR CZ  OH   sing N N 355 
TYR OH  HH   sing N N 356 
TYR OXT HXT  sing N N 357 
VAL N   CA   sing N N 358 
VAL N   H    sing N N 359 
VAL N   H2   sing N N 360 
VAL CA  C    sing N N 361 
VAL CA  CB   sing N N 362 
VAL CA  HA   sing N N 363 
VAL C   O    doub N N 364 
VAL C   OXT  sing N N 365 
VAL CB  CG1  sing N N 366 
VAL CB  CG2  sing N N 367 
VAL CB  HB   sing N N 368 
VAL CG1 HG11 sing N N 369 
VAL CG1 HG12 sing N N 370 
VAL CG1 HG13 sing N N 371 
VAL CG2 HG21 sing N N 372 
VAL CG2 HG22 sing N N 373 
VAL CG2 HG23 sing N N 374 
VAL OXT HXT  sing N N 375 
# 
_pdbx_audit_support.funding_organization   'Netherlands Organisation for Scientific Research (NWO)' 
_pdbx_audit_support.country                Netherlands 
_pdbx_audit_support.grant_number           714.014.002 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   2XSE 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    8BBM 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.014644 
_atom_sites.fract_transf_matrix[1][2]   0.008455 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016910 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005381 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_