data_8BCN # _entry.id 8BCN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.368 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8BCN pdb_00008bcn 10.2210/pdb8bcn/pdb WWPDB D_1292126098 ? ? # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2023-04-05 _pdbx_database_PDB_obs_spr.pdb_id 8OFL _pdbx_database_PDB_obs_spr.replace_pdb_id 8BCN _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8BCN _pdbx_database_status.recvd_initial_deposition_date 2022-10-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gabler, T.' 1 0000-0002-2141-2771 'Hofbauer, S.' 2 0000-0003-3375-7715 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Coproporphyrin III - LmCpfC soaked 4min with Fe2+' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gabler, T.' 1 0000-0002-2141-2771 primary 'Hofbauer, S.' 2 0000-0003-3375-7715 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 102.742 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8BCN _cell.details ? _cell.formula_units_Z ? _cell.length_a 37.439 _cell.length_a_esd ? _cell.length_b 67.638 _cell.length_b_esd ? _cell.length_c 63.178 _cell.length_c_esd ? _cell.volume 156045.646 _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8BCN _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall 'P 2yb' _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Coproporphyrin III ferrochelatase' 35632.074 1 4.99.1.9 ? ? ? 2 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 3 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 4 non-polymer syn '1,3,5,8-TETRAMETHYL-PORPHINE-2,4,6,7-TETRAPROPIONIC ACID FERROUS COMPLEX' 708.538 1 ? ? ? ? 5 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 6 water nat water 18.015 41 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTKKVGLLVMAYGTPYKDEDIERYYTDIRHGHKPSEEMIADLRGRYHAIGGLSPLAKITEAQAYGLEKALNDSQDEVEFK AYIGLKHIEPFIEDAVEAMHKDGIEEAISIVLAPHYSSFSVEAYNKRAKEAADKLGGPRINAINDWYKQPKFIQMWADRI NETAKQIPADELLDTVLIVSAHSLPEKIKQHNDPYPNQLQETADFIFEKVVVPHYALGWQSEGKTGEPWLGPDVQDLTRE LYGREKYKHFIYTPVGFVAEHLEVLYDNDYECKVVTDEVGAAYHRPPMPNSDPEFLEVLRTVVWEKYSNLE ; _entity_poly.pdbx_seq_one_letter_code_can ;MTKKVGLLVMAYGTPYKDEDIERYYTDIRHGHKPSEEMIADLRGRYHAIGGLSPLAKITEAQAYGLEKALNDSQDEVEFK AYIGLKHIEPFIEDAVEAMHKDGIEEAISIVLAPHYSSFSVEAYNKRAKEAADKLGGPRINAINDWYKQPKFIQMWADRI NETAKQIPADELLDTVLIVSAHSLPEKIKQHNDPYPNQLQETADFIFEKVVVPHYALGWQSEGKTGEPWLGPDVQDLTRE LYGREKYKHFIYTPVGFVAEHLEVLYDNDYECKVVTDEVGAAYHRPPMPNSDPEFLEVLRTVVWEKYSNLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 LYS n 1 4 LYS n 1 5 VAL n 1 6 GLY n 1 7 LEU n 1 8 LEU n 1 9 VAL n 1 10 MET n 1 11 ALA n 1 12 TYR n 1 13 GLY n 1 14 THR n 1 15 PRO n 1 16 TYR n 1 17 LYS n 1 18 ASP n 1 19 GLU n 1 20 ASP n 1 21 ILE n 1 22 GLU n 1 23 ARG n 1 24 TYR n 1 25 TYR n 1 26 THR n 1 27 ASP n 1 28 ILE n 1 29 ARG n 1 30 HIS n 1 31 GLY n 1 32 HIS n 1 33 LYS n 1 34 PRO n 1 35 SER n 1 36 GLU n 1 37 GLU n 1 38 MET n 1 39 ILE n 1 40 ALA n 1 41 ASP n 1 42 LEU n 1 43 ARG n 1 44 GLY n 1 45 ARG n 1 46 TYR n 1 47 HIS n 1 48 ALA n 1 49 ILE n 1 50 GLY n 1 51 GLY n 1 52 LEU n 1 53 SER n 1 54 PRO n 1 55 LEU n 1 56 ALA n 1 57 LYS n 1 58 ILE n 1 59 THR n 1 60 GLU n 1 61 ALA n 1 62 GLN n 1 63 ALA n 1 64 TYR n 1 65 GLY n 1 66 LEU n 1 67 GLU n 1 68 LYS n 1 69 ALA n 1 70 LEU n 1 71 ASN n 1 72 ASP n 1 73 SER n 1 74 GLN n 1 75 ASP n 1 76 GLU n 1 77 VAL n 1 78 GLU n 1 79 PHE n 1 80 LYS n 1 81 ALA n 1 82 TYR n 1 83 ILE n 1 84 GLY n 1 85 LEU n 1 86 LYS n 1 87 HIS n 1 88 ILE n 1 89 GLU n 1 90 PRO n 1 91 PHE n 1 92 ILE n 1 93 GLU n 1 94 ASP n 1 95 ALA n 1 96 VAL n 1 97 GLU n 1 98 ALA n 1 99 MET n 1 100 HIS n 1 101 LYS n 1 102 ASP n 1 103 GLY n 1 104 ILE n 1 105 GLU n 1 106 GLU n 1 107 ALA n 1 108 ILE n 1 109 SER n 1 110 ILE n 1 111 VAL n 1 112 LEU n 1 113 ALA n 1 114 PRO n 1 115 HIS n 1 116 TYR n 1 117 SER n 1 118 SER n 1 119 PHE n 1 120 SER n 1 121 VAL n 1 122 GLU n 1 123 ALA n 1 124 TYR n 1 125 ASN n 1 126 LYS n 1 127 ARG n 1 128 ALA n 1 129 LYS n 1 130 GLU n 1 131 ALA n 1 132 ALA n 1 133 ASP n 1 134 LYS n 1 135 LEU n 1 136 GLY n 1 137 GLY n 1 138 PRO n 1 139 ARG n 1 140 ILE n 1 141 ASN n 1 142 ALA n 1 143 ILE n 1 144 ASN n 1 145 ASP n 1 146 TRP n 1 147 TYR n 1 148 LYS n 1 149 GLN n 1 150 PRO n 1 151 LYS n 1 152 PHE n 1 153 ILE n 1 154 GLN n 1 155 MET n 1 156 TRP n 1 157 ALA n 1 158 ASP n 1 159 ARG n 1 160 ILE n 1 161 ASN n 1 162 GLU n 1 163 THR n 1 164 ALA n 1 165 LYS n 1 166 GLN n 1 167 ILE n 1 168 PRO n 1 169 ALA n 1 170 ASP n 1 171 GLU n 1 172 LEU n 1 173 LEU n 1 174 ASP n 1 175 THR n 1 176 VAL n 1 177 LEU n 1 178 ILE n 1 179 VAL n 1 180 SER n 1 181 ALA n 1 182 HIS n 1 183 SER n 1 184 LEU n 1 185 PRO n 1 186 GLU n 1 187 LYS n 1 188 ILE n 1 189 LYS n 1 190 GLN n 1 191 HIS n 1 192 ASN n 1 193 ASP n 1 194 PRO n 1 195 TYR n 1 196 PRO n 1 197 ASN n 1 198 GLN n 1 199 LEU n 1 200 GLN n 1 201 GLU n 1 202 THR n 1 203 ALA n 1 204 ASP n 1 205 PHE n 1 206 ILE n 1 207 PHE n 1 208 GLU n 1 209 LYS n 1 210 VAL n 1 211 VAL n 1 212 VAL n 1 213 PRO n 1 214 HIS n 1 215 TYR n 1 216 ALA n 1 217 LEU n 1 218 GLY n 1 219 TRP n 1 220 GLN n 1 221 SER n 1 222 GLU n 1 223 GLY n 1 224 LYS n 1 225 THR n 1 226 GLY n 1 227 GLU n 1 228 PRO n 1 229 TRP n 1 230 LEU n 1 231 GLY n 1 232 PRO n 1 233 ASP n 1 234 VAL n 1 235 GLN n 1 236 ASP n 1 237 LEU n 1 238 THR n 1 239 ARG n 1 240 GLU n 1 241 LEU n 1 242 TYR n 1 243 GLY n 1 244 ARG n 1 245 GLU n 1 246 LYS n 1 247 TYR n 1 248 LYS n 1 249 HIS n 1 250 PHE n 1 251 ILE n 1 252 TYR n 1 253 THR n 1 254 PRO n 1 255 VAL n 1 256 GLY n 1 257 PHE n 1 258 VAL n 1 259 ALA n 1 260 GLU n 1 261 HIS n 1 262 LEU n 1 263 GLU n 1 264 VAL n 1 265 LEU n 1 266 TYR n 1 267 ASP n 1 268 ASN n 1 269 ASP n 1 270 TYR n 1 271 GLU n 1 272 CYS n 1 273 LYS n 1 274 VAL n 1 275 VAL n 1 276 THR n 1 277 ASP n 1 278 GLU n 1 279 VAL n 1 280 GLY n 1 281 ALA n 1 282 ALA n 1 283 TYR n 1 284 HIS n 1 285 ARG n 1 286 PRO n 1 287 PRO n 1 288 MET n 1 289 PRO n 1 290 ASN n 1 291 SER n 1 292 ASP n 1 293 PRO n 1 294 GLU n 1 295 PHE n 1 296 LEU n 1 297 GLU n 1 298 VAL n 1 299 LEU n 1 300 ARG n 1 301 THR n 1 302 VAL n 1 303 VAL n 1 304 TRP n 1 305 GLU n 1 306 LYS n 1 307 TYR n 1 308 SER n 1 309 ASN n 1 310 LEU n 1 311 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 311 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'cpfC, hemH, lmo2211' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC BAA-679 / EGD-e' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Listeria monocytogenes' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1639 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CPFC_LISMO _struct_ref.pdbx_db_accession Q8Y565 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTKKVGLLVMAYGTPYKDEDIERYYTDIRHGHKPSEEMIADLRGRYHAIGGLSPLAKITEAQAYGLEKALNDSQDEVEFK AYIGLKHIEPFIEDAVEAMHKDGIEEAISIVLAPHYSSFSVEAYNKRAKEAADKLGGPRINAINDWYKQPKFIQMWADRI NETAKQIPADELLDTVLIVSAHSLPEKIKQHNDPYPNQLQETADFIFEKVVVPHYALGWQSEGKTGEPWLGPDVQDLTRE LYGREKYKHFIYTPVGFVAEHLEVLYDNDYECKVVTDEVGAAYHRPPMPNSDPEFLEVLRTVVWEKYSN ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8BCN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 309 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8Y565 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 309 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 309 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8BCN LEU A 310 ? UNP Q8Y565 ? ? 'expression tag' 310 1 1 8BCN GLU A 311 ? UNP Q8Y565 ? ? 'expression tag' 311 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FEC non-polymer . '1,3,5,8-TETRAMETHYL-PORPHINE-2,4,6,7-TETRAPROPIONIC ACID FERROUS COMPLEX' 'FE-COPROPORPHYRIN III' 'C36 H36 Fe N4 O8 2' 708.538 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8BCN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.06 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.3 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;17.455% PEG MME 2000 0.2 M Calciumacetate 0.1 M BIS-Tris pH 6.3 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-05-27 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9686 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID30B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9686 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID30B _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 37.43 _reflns.entry_id 8BCN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.901 _reflns.d_resolution_low 45.552 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23623 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.08 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.0 _reflns.pdbx_Rmerge_I_obs 0.04891 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.25 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.06917 _reflns.pdbx_Rpim_I_all 0.04891 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 1.901 _reflns_shell.d_res_low 1.969 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.59 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1871 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.173 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.421 _reflns_shell.pdbx_CC_star 0.77 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 50.40 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8BCN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.901 _refine.ls_d_res_low 45.55 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23569 _refine.ls_number_reflns_R_free 1130 _refine.ls_number_reflns_R_work 22439 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.08 _refine.ls_percent_reflns_R_free 4.79 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1998 _refine.ls_R_factor_R_free 0.2324 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1982 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 8AT8 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.5408 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2784 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.901 _refine_hist.d_res_low 45.55 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 2583 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2482 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 60 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0046 ? 2617 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7049 ? 3560 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0465 ? 366 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0055 ? 470 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 4.6883 ? 380 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.901 1.99 . . 105 2329 80.44 . . . 0.3747 . 0.3901 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.99 2.09 . . 139 2813 98.01 . . . 0.3656 . 0.3314 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.09 2.22 . . 124 2863 99.33 . . . 0.3016 . 0.2736 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.22 2.40 . . 141 2863 99.73 . . . 0.3092 . 0.2271 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.40 2.64 . . 169 2878 99.80 . . . 0.2376 . 0.2100 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.64 3.02 . . 136 2867 99.77 . . . 0.2570 . 0.1970 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.02 3.80 . . 160 2891 99.84 . . . 0.2262 . 0.1782 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.80 45.55 . . 156 2935 99.65 . . . 0.1903 . 0.1670 . . . . . . . . . . . # _struct.entry_id 8BCN _struct.title 'Coproporphyrin III - LmCpfC soaked 4min with Fe2+' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8BCN _struct_keywords.text 'ferrochelatase activity metal ion binding heme b biosynthesis, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 17 ? GLU A 19 ? LYS A 17 GLU A 19 5 ? 3 HELX_P HELX_P2 AA2 ASP A 20 ? ARG A 29 ? ASP A 20 ARG A 29 1 ? 10 HELX_P HELX_P3 AA3 SER A 35 ? ILE A 49 ? SER A 35 ILE A 49 1 ? 15 HELX_P HELX_P4 AA4 PRO A 54 ? GLN A 74 ? PRO A 54 GLN A 74 1 ? 21 HELX_P HELX_P5 AA5 PHE A 91 ? ASP A 102 ? PHE A 91 ASP A 102 1 ? 12 HELX_P HELX_P6 AA6 SER A 120 ? GLY A 136 ? SER A 120 GLY A 136 1 ? 17 HELX_P HELX_P7 AA7 GLN A 149 ? LYS A 165 ? GLN A 149 LYS A 165 1 ? 17 HELX_P HELX_P8 AA8 PRO A 168 ? LEU A 173 ? PRO A 168 LEU A 173 1 ? 6 HELX_P HELX_P9 AA9 PRO A 185 ? ASN A 192 ? PRO A 185 ASN A 192 5 ? 8 HELX_P HELX_P10 AB1 PRO A 194 ? GLU A 208 ? PRO A 194 GLU A 208 1 ? 15 HELX_P HELX_P11 AB2 ASP A 233 ? LYS A 246 ? ASP A 233 LYS A 246 1 ? 14 HELX_P HELX_P12 AB3 HIS A 261 ? TYR A 266 ? HIS A 261 TYR A 266 1 ? 6 HELX_P HELX_P13 AB4 TYR A 270 ? GLY A 280 ? TYR A 270 GLY A 280 1 ? 11 HELX_P HELX_P14 AB5 ASP A 292 ? ASN A 309 ? ASP A 292 ASN A 309 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id TYR _struct_conn.ptnr1_label_seq_id 12 _struct_conn.ptnr1_label_atom_id OH _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id D _struct_conn.ptnr2_label_comp_id FEC _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id FE _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id TYR _struct_conn.ptnr1_auth_seq_id 12 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id FEC _struct_conn.ptnr2_auth_seq_id 403 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.579 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 89 A . ? GLU 89 A PRO 90 A ? PRO 90 A 1 -1.91 2 GLY 137 A . ? GLY 137 A PRO 138 A ? PRO 138 A 1 -0.05 3 GLY 231 A . ? GLY 231 A PRO 232 A ? PRO 232 A 1 4.05 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 79 ? LEU A 85 ? PHE A 79 LEU A 85 AA1 2 VAL A 5 ? ALA A 11 ? VAL A 5 ALA A 11 AA1 3 GLU A 106 ? VAL A 111 ? GLU A 106 VAL A 111 AA1 4 ARG A 139 ? ALA A 142 ? ARG A 139 ALA A 142 AA2 1 TYR A 215 ? GLN A 220 ? TYR A 215 GLN A 220 AA2 2 THR A 175 ? HIS A 182 ? THR A 175 HIS A 182 AA2 3 HIS A 249 ? THR A 253 ? HIS A 249 THR A 253 AA2 4 ALA A 282 ? HIS A 284 ? ALA A 282 HIS A 284 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 80 ? O LYS A 80 N LEU A 7 ? N LEU A 7 AA1 2 3 N MET A 10 ? N MET A 10 O ILE A 110 ? O ILE A 110 AA1 3 4 N ALA A 107 ? N ALA A 107 O ARG A 139 ? O ARG A 139 AA2 1 2 O GLY A 218 ? O GLY A 218 N VAL A 179 ? N VAL A 179 AA2 2 3 N ILE A 178 ? N ILE A 178 O ILE A 251 ? O ILE A 251 AA2 3 4 N TYR A 252 ? N TYR A 252 O HIS A 284 ? O HIS A 284 # _atom_sites.entry_id 8BCN _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.026710 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.006040 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014785 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016228 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? FE ? ? 20.90327 4.99816 ? ? 2.55100 38.46870 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 MET 99 99 99 MET MET A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 TRP 146 146 146 TRP TRP A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 GLN 154 154 154 GLN GLN A . n A 1 155 MET 155 155 155 MET MET A . n A 1 156 TRP 156 156 156 TRP TRP A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 PRO 168 168 168 PRO PRO A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 THR 175 175 175 THR THR A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 HIS 182 182 182 HIS HIS A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 GLN 190 190 190 GLN GLN A . n A 1 191 HIS 191 191 191 HIS HIS A . n A 1 192 ASN 192 192 192 ASN ASN A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 TYR 195 195 195 TYR TYR A . n A 1 196 PRO 196 196 196 PRO PRO A . n A 1 197 ASN 197 197 197 ASN ASN A . n A 1 198 GLN 198 198 198 GLN GLN A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 GLN 200 200 200 GLN GLN A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 THR 202 202 202 THR THR A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 ASP 204 204 204 ASP ASP A . n A 1 205 PHE 205 205 205 PHE PHE A . n A 1 206 ILE 206 206 206 ILE ILE A . n A 1 207 PHE 207 207 207 PHE PHE A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 VAL 211 211 211 VAL VAL A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 PRO 213 213 213 PRO PRO A . n A 1 214 HIS 214 214 214 HIS HIS A . n A 1 215 TYR 215 215 215 TYR TYR A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 TRP 219 219 219 TRP TRP A . n A 1 220 GLN 220 220 220 GLN GLN A . n A 1 221 SER 221 221 221 SER SER A . n A 1 222 GLU 222 222 222 GLU GLU A . n A 1 223 GLY 223 223 223 GLY GLY A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 THR 225 225 225 THR THR A . n A 1 226 GLY 226 226 226 GLY GLY A . n A 1 227 GLU 227 227 227 GLU GLU A . n A 1 228 PRO 228 228 228 PRO PRO A . n A 1 229 TRP 229 229 229 TRP TRP A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 PRO 232 232 232 PRO PRO A . n A 1 233 ASP 233 233 233 ASP ASP A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 GLN 235 235 235 GLN GLN A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 THR 238 238 238 THR THR A . n A 1 239 ARG 239 239 239 ARG ARG A . n A 1 240 GLU 240 240 240 GLU GLU A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 TYR 242 242 242 TYR TYR A . n A 1 243 GLY 243 243 243 GLY GLY A . n A 1 244 ARG 244 244 244 ARG ARG A . n A 1 245 GLU 245 245 245 GLU GLU A . n A 1 246 LYS 246 246 246 LYS LYS A . n A 1 247 TYR 247 247 247 TYR TYR A . n A 1 248 LYS 248 248 248 LYS LYS A . n A 1 249 HIS 249 249 249 HIS HIS A . n A 1 250 PHE 250 250 250 PHE PHE A . n A 1 251 ILE 251 251 251 ILE ILE A . n A 1 252 TYR 252 252 252 TYR TYR A . n A 1 253 THR 253 253 253 THR THR A . n A 1 254 PRO 254 254 254 PRO PRO A . n A 1 255 VAL 255 255 255 VAL VAL A . n A 1 256 GLY 256 256 256 GLY GLY A . n A 1 257 PHE 257 257 257 PHE PHE A . n A 1 258 VAL 258 258 258 VAL VAL A . n A 1 259 ALA 259 259 259 ALA ALA A . n A 1 260 GLU 260 260 260 GLU GLU A . n A 1 261 HIS 261 261 261 HIS HIS A . n A 1 262 LEU 262 262 262 LEU LEU A . n A 1 263 GLU 263 263 263 GLU GLU A . n A 1 264 VAL 264 264 264 VAL VAL A . n A 1 265 LEU 265 265 265 LEU LEU A . n A 1 266 TYR 266 266 266 TYR TYR A . n A 1 267 ASP 267 267 267 ASP ASP A . n A 1 268 ASN 268 268 268 ASN ASN A . n A 1 269 ASP 269 269 269 ASP ASP A . n A 1 270 TYR 270 270 270 TYR TYR A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 CYS 272 272 272 CYS CYS A . n A 1 273 LYS 273 273 273 LYS LYS A . n A 1 274 VAL 274 274 274 VAL VAL A . n A 1 275 VAL 275 275 275 VAL VAL A . n A 1 276 THR 276 276 276 THR THR A . n A 1 277 ASP 277 277 277 ASP ASP A . n A 1 278 GLU 278 278 278 GLU GLU A . n A 1 279 VAL 279 279 279 VAL VAL A . n A 1 280 GLY 280 280 280 GLY GLY A . n A 1 281 ALA 281 281 281 ALA ALA A . n A 1 282 ALA 282 282 282 ALA ALA A . n A 1 283 TYR 283 283 283 TYR TYR A . n A 1 284 HIS 284 284 284 HIS HIS A . n A 1 285 ARG 285 285 285 ARG ARG A . n A 1 286 PRO 286 286 286 PRO PRO A . n A 1 287 PRO 287 287 287 PRO PRO A . n A 1 288 MET 288 288 288 MET MET A . n A 1 289 PRO 289 289 289 PRO PRO A . n A 1 290 ASN 290 290 290 ASN ASN A . n A 1 291 SER 291 291 291 SER SER A . n A 1 292 ASP 292 292 292 ASP ASP A . n A 1 293 PRO 293 293 293 PRO PRO A . n A 1 294 GLU 294 294 294 GLU GLU A . n A 1 295 PHE 295 295 295 PHE PHE A . n A 1 296 LEU 296 296 296 LEU LEU A . n A 1 297 GLU 297 297 297 GLU GLU A . n A 1 298 VAL 298 298 298 VAL VAL A . n A 1 299 LEU 299 299 299 LEU LEU A . n A 1 300 ARG 300 300 300 ARG ARG A . n A 1 301 THR 301 301 301 THR THR A . n A 1 302 VAL 302 302 302 VAL VAL A . n A 1 303 VAL 303 303 303 VAL VAL A . n A 1 304 TRP 304 304 304 TRP TRP A . n A 1 305 GLU 305 305 305 GLU GLU A . n A 1 306 LYS 306 306 306 LYS LYS A . n A 1 307 TYR 307 307 307 TYR TYR A . n A 1 308 SER 308 308 308 SER SER A . n A 1 309 ASN 309 309 309 ASN ASN A . n A 1 310 LEU 310 310 310 LEU LEU A . n A 1 311 GLU 311 311 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email stefan.hofbauer@boku.ac.at _pdbx_contact_author.name_first Stefan _pdbx_contact_author.name_last Hofbauer _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-3375-7715 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 401 406 GOL GOL A . C 3 ACT 1 402 409 ACT ACT A . D 4 FEC 1 403 410 FEC VEC A . E 5 CL 1 404 1 CL CL A . F 6 HOH 1 501 24 HOH HOH A . F 6 HOH 2 502 1 HOH HOH A . F 6 HOH 3 503 17 HOH HOH A . F 6 HOH 4 504 58 HOH HOH A . F 6 HOH 5 505 8 HOH HOH A . F 6 HOH 6 506 42 HOH HOH A . F 6 HOH 7 507 57 HOH HOH A . F 6 HOH 8 508 27 HOH HOH A . F 6 HOH 9 509 41 HOH HOH A . F 6 HOH 10 510 10 HOH HOH A . F 6 HOH 11 511 32 HOH HOH A . F 6 HOH 12 512 39 HOH HOH A . F 6 HOH 13 513 6 HOH HOH A . F 6 HOH 14 514 12 HOH HOH A . F 6 HOH 15 515 38 HOH HOH A . F 6 HOH 16 516 11 HOH HOH A . F 6 HOH 17 517 19 HOH HOH A . F 6 HOH 18 518 4 HOH HOH A . F 6 HOH 19 519 54 HOH HOH A . F 6 HOH 20 520 43 HOH HOH A . F 6 HOH 21 521 48 HOH HOH A . F 6 HOH 22 522 5 HOH HOH A . F 6 HOH 23 523 44 HOH HOH A . F 6 HOH 24 524 26 HOH HOH A . F 6 HOH 25 525 25 HOH HOH A . F 6 HOH 26 526 36 HOH HOH A . F 6 HOH 27 527 50 HOH HOH A . F 6 HOH 28 528 2 HOH HOH A . F 6 HOH 29 529 45 HOH HOH A . F 6 HOH 30 530 47 HOH HOH A . F 6 HOH 31 531 53 HOH HOH A . F 6 HOH 32 532 30 HOH HOH A . F 6 HOH 33 533 35 HOH HOH A . F 6 HOH 34 534 37 HOH HOH A . F 6 HOH 35 535 3 HOH HOH A . F 6 HOH 36 536 13 HOH HOH A . F 6 HOH 37 537 9 HOH HOH A . F 6 HOH 38 538 55 HOH HOH A . F 6 HOH 39 539 16 HOH HOH A . F 6 HOH 40 540 33 HOH HOH A . F 6 HOH 41 541 31 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1900 ? 1 MORE -37 ? 1 'SSA (A^2)' 13540 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OH ? A TYR 12 ? A TYR 12 ? 1_555 FE ? D FEC . ? A FEC 403 ? 1_555 ND ? D FEC . ? A FEC 403 ? 1_555 108.8 ? 2 OH ? A TYR 12 ? A TYR 12 ? 1_555 FE ? D FEC . ? A FEC 403 ? 1_555 NB ? D FEC . ? A FEC 403 ? 1_555 88.8 ? 3 ND ? D FEC . ? A FEC 403 ? 1_555 FE ? D FEC . ? A FEC 403 ? 1_555 NB ? D FEC . ? A FEC 403 ? 1_555 162.2 ? 4 OH ? A TYR 12 ? A TYR 12 ? 1_555 FE ? D FEC . ? A FEC 403 ? 1_555 NA ? D FEC . ? A FEC 403 ? 1_555 111.7 ? 5 ND ? D FEC . ? A FEC 403 ? 1_555 FE ? D FEC . ? A FEC 403 ? 1_555 NA ? D FEC . ? A FEC 403 ? 1_555 83.5 ? 6 NB ? D FEC . ? A FEC 403 ? 1_555 FE ? D FEC . ? A FEC 403 ? 1_555 NA ? D FEC . ? A FEC 403 ? 1_555 87.4 ? 7 OH ? A TYR 12 ? A TYR 12 ? 1_555 FE ? D FEC . ? A FEC 403 ? 1_555 NC ? D FEC . ? A FEC 403 ? 1_555 86.6 ? 8 ND ? D FEC . ? A FEC 403 ? 1_555 FE ? D FEC . ? A FEC 403 ? 1_555 NC ? D FEC . ? A FEC 403 ? 1_555 88.5 ? 9 NB ? D FEC . ? A FEC 403 ? 1_555 FE ? D FEC . ? A FEC 403 ? 1_555 NC ? D FEC . ? A FEC 403 ? 1_555 95.5 ? 10 NA ? D FEC . ? A FEC 403 ? 1_555 FE ? D FEC . ? A FEC 403 ? 1_555 NC ? D FEC . ? A FEC 403 ? 1_555 161.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-01-11 2 'Structure model' 2 0 2023-04-05 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Obsolete ? ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Author supporting evidence' 4 2 'Structure model' 'Data collection' 5 2 'Structure model' 'Derived calculations' 6 2 'Structure model' 'Non-polymer description' 7 2 'Structure model' Other 8 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' chem_comp 3 2 'Structure model' entity 4 2 'Structure model' pdbx_database_PDB_obs_spr 5 2 'Structure model' pdbx_database_status 6 2 'Structure model' pdbx_entity_instance_feature 7 2 'Structure model' pdbx_entity_nonpoly 8 2 'Structure model' pdbx_nonpoly_scheme 9 2 'Structure model' pdbx_struct_assembly_gen 10 2 'Structure model' pdbx_struct_assembly_prop 11 2 'Structure model' pdbx_struct_conn_angle 12 2 'Structure model' struct_asym 13 2 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.B_iso_or_equiv' 2 2 'Structure model' '_atom_site.Cartn_x' 3 2 'Structure model' '_atom_site.Cartn_y' 4 2 'Structure model' '_atom_site.Cartn_z' 5 2 'Structure model' '_atom_site.auth_atom_id' 6 2 'Structure model' '_atom_site.auth_comp_id' 7 2 'Structure model' '_atom_site.auth_seq_id' 8 2 'Structure model' '_atom_site.label_asym_id' 9 2 'Structure model' '_atom_site.label_atom_id' 10 2 'Structure model' '_atom_site.label_comp_id' 11 2 'Structure model' '_atom_site.label_entity_id' 12 2 'Structure model' '_atom_site.occupancy' 13 2 'Structure model' '_atom_site.type_symbol' 14 2 'Structure model' '_chem_comp.formula' 15 2 'Structure model' '_chem_comp.formula_weight' 16 2 'Structure model' '_chem_comp.id' 17 2 'Structure model' '_chem_comp.mon_nstd_flag' 18 2 'Structure model' '_chem_comp.name' 19 2 'Structure model' '_chem_comp.pdbx_synonyms' 20 2 'Structure model' '_chem_comp.type' 21 2 'Structure model' '_pdbx_database_status.status_code' 22 2 'Structure model' '_pdbx_database_status.status_code_sf' 23 2 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 24 2 'Structure model' '_pdbx_struct_assembly_prop.value' 25 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 26 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 27 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 28 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 29 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 30 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 31 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 32 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 33 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 34 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 35 2 'Structure model' '_pdbx_struct_conn_angle.value' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y+1/2,-z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 9.84786337609 13.7264993641 8.12859662307 0.705134841511 ? 0.0337138835066 ? -0.0521618103183 ? 0.483352531241 ? 0.0141086005895 ? 0.417976536103 ? 1.32733115598 ? -0.0734215491296 ? 0.803450129918 ? 5.44887827691 ? 1.39375707656 ? 1.90386515801 ? -0.115424049729 ? 0.164208569534 ? 0.270409516341 ? -1.17314789941 ? -0.141297571981 ? 0.304180505648 ? -0.549479069384 ? -0.0856510192927 ? 0.266971953177 ? 2 'X-RAY DIFFRACTION' ? refined 14.0793595026 4.21608899909 6.61982255345 0.466502645293 ? 0.0243375697347 ? 0.0808058988036 ? 0.449493924676 ? 0.0186581406502 ? 0.349644127916 ? 1.52014700774 ? -0.836165528032 ? -0.186209585091 ? 3.2510045492 ? 0.729631156025 ? 1.84869274664 ? 0.0894152805055 ? 0.302523562042 ? 0.0354559049478 ? -0.941248652447 ? -0.12103960756 ? 0.0459673529307 ? -0.379970243677 ? 0.0046615980412 ? 0.0407837730279 ? 3 'X-RAY DIFFRACTION' ? refined 10.3810048747 -2.84121245134 18.9898661609 0.271831905341 ? -0.0119552836904 ? 0.0482061653272 ? 0.29743442014 ? -0.0198066367918 ? 0.426073221436 ? 1.13493236325 ? -0.381966645752 ? 0.0353884512188 ? 3.07061918279 ? 0.0296346650925 ? 2.66978456721 ? 0.0492009452294 ? 0.209473444911 ? -0.0875613913317 ? -0.201291995788 ? -0.0442157381457 ? 0.0333952506619 ? 0.135316973424 ? -0.0996450940082 ? -0.034257601754 ? 4 'X-RAY DIFFRACTION' ? refined 6.09226738773 3.74977560484 30.250897113 0.285425291971 ? -0.0157044306605 ? 0.0413288302515 ? 0.347206065276 ? -0.0140845526479 ? 0.425362848555 ? 1.77455358001 ? 1.01586308529 ? 0.121588549715 ? 1.95913430045 ? 0.356264017287 ? 2.36127196969 ? 0.0306896849527 ? -0.167002883803 ? 0.0934966973696 ? 0.219301874688 ? -0.0414132154253 ? 0.364556970306 ? 0.0159810035665 ? -0.250867770558 ? -0.0326777315955 ? 5 'X-RAY DIFFRACTION' ? refined 18.0480619324 3.26845863312 26.6065079146 0.279836732776 ? 0.0325048184298 ? 0.0473432030285 ? 0.328503400091 ? 0.0163513784881 ? 0.465262557531 ? 1.23825910383 ? 0.688682592825 ? 0.558367657241 ? 3.03601245355 ? 0.962592736966 ? 2.1234863317 ? 0.096803020477 ? 0.0131780575831 ? 0.120228170484 ? 0.128898653125 ? -0.0347661813968 ? -0.226800125165 ? 0.0845625241602 ? 0.0882548490265 ? -0.0853736938363 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 4 ? A 32 A 35 ? ? ;chain 'A' and (resid 4 through 35 ) ; 2 'X-RAY DIFFRACTION' 2 A 33 A 36 ? A 98 A 101 ? ? ;chain 'A' and (resid 36 through 101 ) ; 3 'X-RAY DIFFRACTION' 3 A 99 A 102 ? A 179 A 182 ? ? ;chain 'A' and (resid 102 through 182 ) ; 4 'X-RAY DIFFRACTION' 4 A 180 A 183 ? A 230 A 233 ? ? ;chain 'A' and (resid 183 through 233 ) ; 5 'X-RAY DIFFRACTION' 5 A 231 A 234 ? A 307 A 310 ? ? ;chain 'A' and (resid 234 through 310 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 8BCN _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 NE2 A GLN 166 ? ? 1_555 OD1 A ASN 192 ? ? 1_655 2.13 2 1 OE2 A GLU 19 ? ? 1_555 NZ A LYS 80 ? ? 2_655 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 113 ? ? -161.26 117.64 2 1 SER A 120 ? ? -108.45 -89.21 3 1 TRP A 146 ? ? -156.83 18.33 4 1 ASN A 268 ? ? -94.19 -64.24 5 1 TYR A 270 ? ? -104.03 -61.31 6 1 ASN A 290 ? ? 45.29 -133.69 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A GLU 311 ? A GLU 311 # _pdbx_audit_support.funding_organization 'Austrian Science Fund' _pdbx_audit_support.country Austria _pdbx_audit_support.grant_number P33544 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 'ACETATE ION' ACT 4 '1,3,5,8-TETRAMETHYL-PORPHINE-2,4,6,7-TETRAPROPIONIC ACID FERROUS COMPLEX' FEC 5 'CHLORIDE ION' CL 6 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 1 21 1' _space_group.name_Hall 'P 2yb' _space_group.IT_number 4 _space_group.crystal_system monoclinic _space_group.id 1 #