data_8BQ3 # _entry.id 8BQ3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8BQ3 pdb_00008bq3 10.2210/pdb8bq3/pdb WWPDB D_1292126418 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2023-11-29 ? 2 'Structure model' 1 1 2026-03-04 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Refinement description' 2 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_entry_details 2 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8BQ3 _pdbx_database_status.recvd_initial_deposition_date 2022-11-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email david.reverter@uab.cat _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Reverter _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5347-0992 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Varejao, N.' 1 0000-0002-6952-8896 'Navarro, S.' 2 0000-0001-8160-9536 'Ventura, S.' 3 0000-0002-9652-6351 'Reverter, D.' 4 0000-0002-5347-0992 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of human R13 mutant of the c-Src SH3 domain in complex with VSL12-peptide' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Varejao, N.' 1 0000-0002-6952-8896 primary 'Navarro, S.' 2 0000-0001-8160-9536 primary 'Ventura, S.' 3 0000-0002-9652-6351 primary 'Reverter, D.' 4 0000-0002-5347-0992 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Proto-oncogene tyrosine-protein kinase Src' 9862.965 1 2.7.10.2 ? ? 'SH3 domain of cSrc protein' 2 polymer syn PRO-LEU-PRO 1317.622 1 ? ? ? 'VSL12 peptide (partial)' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MASMTGGQQMGDARSIVEAMYDYVSEMETDLSFTKGEALIIVENNEGDWWLARKMNSTEVGYIPSNYVKIRDLERGDYKD DDDKKK ; ;MASMTGGQQMGDARSIVEAMYDYVSEMETDLSFTKGEALIIVENNEGDWWLARKMNSTEVGYIPSNYVKIRDLERGDYKD DDDKKK ; A ? 2 'polypeptide(L)' no no VSLARRPLPPLP VSLARRPLPPLP B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 MET n 1 5 THR n 1 6 GLY n 1 7 GLY n 1 8 GLN n 1 9 GLN n 1 10 MET n 1 11 GLY n 1 12 ASP n 1 13 ALA n 1 14 ARG n 1 15 SER n 1 16 ILE n 1 17 VAL n 1 18 GLU n 1 19 ALA n 1 20 MET n 1 21 TYR n 1 22 ASP n 1 23 TYR n 1 24 VAL n 1 25 SER n 1 26 GLU n 1 27 MET n 1 28 GLU n 1 29 THR n 1 30 ASP n 1 31 LEU n 1 32 SER n 1 33 PHE n 1 34 THR n 1 35 LYS n 1 36 GLY n 1 37 GLU n 1 38 ALA n 1 39 LEU n 1 40 ILE n 1 41 ILE n 1 42 VAL n 1 43 GLU n 1 44 ASN n 1 45 ASN n 1 46 GLU n 1 47 GLY n 1 48 ASP n 1 49 TRP n 1 50 TRP n 1 51 LEU n 1 52 ALA n 1 53 ARG n 1 54 LYS n 1 55 MET n 1 56 ASN n 1 57 SER n 1 58 THR n 1 59 GLU n 1 60 VAL n 1 61 GLY n 1 62 TYR n 1 63 ILE n 1 64 PRO n 1 65 SER n 1 66 ASN n 1 67 TYR n 1 68 VAL n 1 69 LYS n 1 70 ILE n 1 71 ARG n 1 72 ASP n 1 73 LEU n 1 74 GLU n 1 75 ARG n 1 76 GLY n 1 77 ASP n 1 78 TYR n 1 79 LYS n 1 80 ASP n 1 81 ASP n 1 82 ASP n 1 83 ASP n 1 84 LYS n 1 85 LYS n 1 86 LYS n 2 1 VAL n 2 2 SER n 2 3 LEU n 2 4 ALA n 2 5 ARG n 2 6 ARG n 2 7 PRO n 2 8 LEU n 2 9 PRO n 2 10 PRO n 2 11 LEU n 2 12 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 86 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SRC _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 12 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 70 ? ? ? A . n A 1 2 ALA 2 71 ? ? ? A . n A 1 3 SER 3 72 ? ? ? A . n A 1 4 MET 4 73 ? ? ? A . n A 1 5 THR 5 74 ? ? ? A . n A 1 6 GLY 6 75 ? ? ? A . n A 1 7 GLY 7 76 ? ? ? A . n A 1 8 GLN 8 77 ? ? ? A . n A 1 9 GLN 9 78 ? ? ? A . n A 1 10 MET 10 79 ? ? ? A . n A 1 11 GLY 11 80 ? ? ? A . n A 1 12 ASP 12 81 81 ASP ASP A . n A 1 13 ALA 13 82 82 ALA ALA A . n A 1 14 ARG 14 83 83 ARG ARG A . n A 1 15 SER 15 84 84 SER SER A . n A 1 16 ILE 16 85 85 ILE ILE A . n A 1 17 VAL 17 86 86 VAL VAL A . n A 1 18 GLU 18 87 87 GLU GLU A . n A 1 19 ALA 19 88 88 ALA ALA A . n A 1 20 MET 20 89 89 MET MET A . n A 1 21 TYR 21 90 90 TYR TYR A . n A 1 22 ASP 22 91 91 ASP ASP A . n A 1 23 TYR 23 92 92 TYR TYR A . n A 1 24 VAL 24 93 93 VAL VAL A . n A 1 25 SER 25 94 94 SER SER A . n A 1 26 GLU 26 95 95 GLU GLU A . n A 1 27 MET 27 96 96 MET MET A . n A 1 28 GLU 28 97 97 GLU GLU A . n A 1 29 THR 29 98 98 THR THR A . n A 1 30 ASP 30 99 99 ASP ASP A . n A 1 31 LEU 31 100 100 LEU LEU A . n A 1 32 SER 32 101 101 SER SER A . n A 1 33 PHE 33 102 102 PHE PHE A . n A 1 34 THR 34 103 103 THR THR A . n A 1 35 LYS 35 104 104 LYS LYS A . n A 1 36 GLY 36 105 105 GLY GLY A . n A 1 37 GLU 37 106 106 GLU GLU A . n A 1 38 ALA 38 107 107 ALA ALA A . n A 1 39 LEU 39 108 108 LEU LEU A . n A 1 40 ILE 40 109 109 ILE ILE A . n A 1 41 ILE 41 110 110 ILE ILE A . n A 1 42 VAL 42 111 111 VAL VAL A . n A 1 43 GLU 43 112 112 GLU GLU A . n A 1 44 ASN 44 113 113 ASN ASN A . n A 1 45 ASN 45 114 114 ASN ASN A . n A 1 46 GLU 46 115 115 GLU GLU A . n A 1 47 GLY 47 116 116 GLY GLY A . n A 1 48 ASP 48 117 117 ASP ASP A . n A 1 49 TRP 49 118 118 TRP TRP A . n A 1 50 TRP 50 119 119 TRP TRP A . n A 1 51 LEU 51 120 120 LEU LEU A . n A 1 52 ALA 52 121 121 ALA ALA A . n A 1 53 ARG 53 122 122 ARG ARG A . n A 1 54 LYS 54 123 123 LYS LYS A . n A 1 55 MET 55 124 124 MET MET A . n A 1 56 ASN 56 125 125 ASN ASN A . n A 1 57 SER 57 126 126 SER SER A . n A 1 58 THR 58 127 127 THR THR A . n A 1 59 GLU 59 128 128 GLU GLU A . n A 1 60 VAL 60 129 129 VAL VAL A . n A 1 61 GLY 61 130 130 GLY GLY A . n A 1 62 TYR 62 131 131 TYR TYR A . n A 1 63 ILE 63 132 132 ILE ILE A . n A 1 64 PRO 64 133 133 PRO PRO A . n A 1 65 SER 65 134 134 SER SER A . n A 1 66 ASN 66 135 135 ASN ASN A . n A 1 67 TYR 67 136 136 TYR TYR A . n A 1 68 VAL 68 137 137 VAL VAL A . n A 1 69 LYS 69 138 138 LYS LYS A . n A 1 70 ILE 70 139 139 ILE ILE A . n A 1 71 ARG 71 140 140 ARG ARG A . n A 1 72 ASP 72 141 ? ? ? A . n A 1 73 LEU 73 142 ? ? ? A . n A 1 74 GLU 74 143 ? ? ? A . n A 1 75 ARG 75 144 ? ? ? A . n A 1 76 GLY 76 145 ? ? ? A . n A 1 77 ASP 77 146 ? ? ? A . n A 1 78 TYR 78 147 ? ? ? A . n A 1 79 LYS 79 148 ? ? ? A . n A 1 80 ASP 80 149 ? ? ? A . n A 1 81 ASP 81 150 ? ? ? A . n A 1 82 ASP 82 151 ? ? ? A . n A 1 83 ASP 83 152 ? ? ? A . n A 1 84 LYS 84 153 ? ? ? A . n A 1 85 LYS 85 154 ? ? ? A . n A 1 86 LYS 86 155 ? ? ? A . n B 2 1 VAL 1 4 ? ? ? B . n B 2 2 SER 2 5 ? ? ? B . n B 2 3 LEU 3 6 ? ? ? B . n B 2 4 ALA 4 7 ? ? ? B . n B 2 5 ARG 5 8 ? ? ? B . n B 2 6 ARG 6 9 ? ? ? B . n B 2 7 PRO 7 10 10 PRO PRO B . n B 2 8 LEU 8 11 11 LEU LEU B . n B 2 9 PRO 9 12 12 PRO PRO B . n B 2 10 PRO 10 13 ? ? ? B . n B 2 11 LEU 11 14 ? ? ? B . n B 2 12 PRO 12 15 ? ? ? B . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.17.1_3660: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.7 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 1.19.2_4158 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 8BQ3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.362 _cell.length_a_esd ? _cell.length_b 39.362 _cell.length_b_esd ? _cell.length_c 148.457 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8BQ3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8BQ3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.44 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% w/vPEG 1500, 0.1M MIB (Sodium malonate dibasic monohydrate, Imidazole, Boric acid) pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-02-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator M _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.919970 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALBA BEAMLINE XALOC' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.919970 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline XALOC _diffrn_source.pdbx_synchrotron_site ALBA # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8BQ3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.66 _reflns.d_resolution_low 148.46 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 2330 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 14.7 _reflns.pdbx_netI_over_sigmaI 14.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.66 _reflns_shell.d_res_low 8.81 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 15 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 280 _reflns_shell.percent_possible_all 96.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.969 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 15 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.948 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8BQ3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.66 _refine.ls_d_res_low 34.09 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 2282 _refine.ls_number_reflns_R_free 238 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.00 _refine.ls_percent_reflns_R_free 10.43 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2359 _refine.ls_R_factor_R_free 0.2815 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2300 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4HVW _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.15 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.29 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 510 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 510 _refine_hist.d_res_high 2.66 _refine_hist.d_res_low 34.09 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 520 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.366 ? 704 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 9.755 ? 69 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.061 ? 77 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 ? 89 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.66 2.79 . . 109 976 99.00 . . . 0.3343 . 0.2397 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.79 34.09 . . 129 1068 99.00 . . . 0.2685 . 0.2273 . . . . . . . . . . . # _struct.entry_id 8BQ3 _struct.title 'Crystal structure of human R13 mutant of the c-Src SH3 domain in complex with VSL12-peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8BQ3 _struct_keywords.text 'Tyrosine Kinase, SH3 domain, mutational library, binding to proline-rich motifs, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 8BQ3 8BQ3 ? 1 ? 1 2 PDB 8BQ3 8BQ3 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8BQ3 A 1 ? 86 ? 8BQ3 70 ? 155 ? 70 155 2 2 8BQ3 B 1 ? 12 ? 8BQ3 4 ? 15 ? 4 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 360 ? 1 MORE -3 ? 1 'SSA (A^2)' 4480 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A 1 2 B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_554 x,x-y,-z-1/6 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -24.7428333333 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 60 ? PRO A 64 ? VAL A 129 PRO A 133 AA1 2 TRP A 49 ? LYS A 54 ? TRP A 118 LYS A 123 AA1 3 ALA A 38 ? GLU A 43 ? ALA A 107 GLU A 112 AA1 4 SER A 15 ? ALA A 19 ? SER A 84 ALA A 88 AA1 5 VAL A 68 ? ILE A 70 ? VAL A 137 ILE A 139 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 63 ? O ILE A 132 N TRP A 50 ? N TRP A 119 AA1 2 3 O LEU A 51 ? O LEU A 120 N VAL A 42 ? N VAL A 111 AA1 3 4 O LEU A 39 ? O LEU A 108 N VAL A 17 ? N VAL A 86 AA1 4 5 N GLU A 18 ? N GLU A 87 O LYS A 69 ? O LYS A 138 # _pdbx_entry_details.entry_id 8BQ3 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 N _pdbx_validate_symm_contact.auth_asym_id_1 B _pdbx_validate_symm_contact.auth_comp_id_1 PRO _pdbx_validate_symm_contact.auth_seq_id_1 10 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 N _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 PRO _pdbx_validate_symm_contact.auth_seq_id_2 10 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 12_554 _pdbx_validate_symm_contact.dist 1.36 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 82 ? ? 176.90 162.83 2 1 ASN A 114 ? ? -33.00 102.42 3 1 ASP A 117 ? ? 71.58 -54.75 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 70 ? A MET 1 2 1 Y 1 A ALA 71 ? A ALA 2 3 1 Y 1 A SER 72 ? A SER 3 4 1 Y 1 A MET 73 ? A MET 4 5 1 Y 1 A THR 74 ? A THR 5 6 1 Y 1 A GLY 75 ? A GLY 6 7 1 Y 1 A GLY 76 ? A GLY 7 8 1 Y 1 A GLN 77 ? A GLN 8 9 1 Y 1 A GLN 78 ? A GLN 9 10 1 Y 1 A MET 79 ? A MET 10 11 1 Y 1 A GLY 80 ? A GLY 11 12 1 Y 1 A ASP 141 ? A ASP 72 13 1 Y 1 A LEU 142 ? A LEU 73 14 1 Y 1 A GLU 143 ? A GLU 74 15 1 Y 1 A ARG 144 ? A ARG 75 16 1 Y 1 A GLY 145 ? A GLY 76 17 1 Y 1 A ASP 146 ? A ASP 77 18 1 Y 1 A TYR 147 ? A TYR 78 19 1 Y 1 A LYS 148 ? A LYS 79 20 1 Y 1 A ASP 149 ? A ASP 80 21 1 Y 1 A ASP 150 ? A ASP 81 22 1 Y 1 A ASP 151 ? A ASP 82 23 1 Y 1 A ASP 152 ? A ASP 83 24 1 Y 1 A LYS 153 ? A LYS 84 25 1 Y 1 A LYS 154 ? A LYS 85 26 1 Y 1 A LYS 155 ? A LYS 86 27 1 Y 1 B VAL 4 ? B VAL 1 28 1 Y 1 B SER 5 ? B SER 2 29 1 Y 1 B LEU 6 ? B LEU 3 30 1 Y 1 B ALA 7 ? B ALA 4 31 1 Y 1 B ARG 8 ? B ARG 5 32 1 Y 1 B ARG 9 ? B ARG 6 33 1 Y 1 B PRO 13 ? B PRO 10 34 1 Y 1 B LEU 14 ? B LEU 11 35 1 Y 1 B PRO 15 ? B PRO 12 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 PRO N N N N 235 PRO CA C N S 236 PRO C C N N 237 PRO O O N N 238 PRO CB C N N 239 PRO CG C N N 240 PRO CD C N N 241 PRO OXT O N N 242 PRO H H N N 243 PRO HA H N N 244 PRO HB2 H N N 245 PRO HB3 H N N 246 PRO HG2 H N N 247 PRO HG3 H N N 248 PRO HD2 H N N 249 PRO HD3 H N N 250 PRO HXT H N N 251 SER N N N N 252 SER CA C N S 253 SER C C N N 254 SER O O N N 255 SER CB C N N 256 SER OG O N N 257 SER OXT O N N 258 SER H H N N 259 SER H2 H N N 260 SER HA H N N 261 SER HB2 H N N 262 SER HB3 H N N 263 SER HG H N N 264 SER HXT H N N 265 THR N N N N 266 THR CA C N S 267 THR C C N N 268 THR O O N N 269 THR CB C N R 270 THR OG1 O N N 271 THR CG2 C N N 272 THR OXT O N N 273 THR H H N N 274 THR H2 H N N 275 THR HA H N N 276 THR HB H N N 277 THR HG1 H N N 278 THR HG21 H N N 279 THR HG22 H N N 280 THR HG23 H N N 281 THR HXT H N N 282 TRP N N N N 283 TRP CA C N S 284 TRP C C N N 285 TRP O O N N 286 TRP CB C N N 287 TRP CG C Y N 288 TRP CD1 C Y N 289 TRP CD2 C Y N 290 TRP NE1 N Y N 291 TRP CE2 C Y N 292 TRP CE3 C Y N 293 TRP CZ2 C Y N 294 TRP CZ3 C Y N 295 TRP CH2 C Y N 296 TRP OXT O N N 297 TRP H H N N 298 TRP H2 H N N 299 TRP HA H N N 300 TRP HB2 H N N 301 TRP HB3 H N N 302 TRP HD1 H N N 303 TRP HE1 H N N 304 TRP HE3 H N N 305 TRP HZ2 H N N 306 TRP HZ3 H N N 307 TRP HH2 H N N 308 TRP HXT H N N 309 TYR N N N N 310 TYR CA C N S 311 TYR C C N N 312 TYR O O N N 313 TYR CB C N N 314 TYR CG C Y N 315 TYR CD1 C Y N 316 TYR CD2 C Y N 317 TYR CE1 C Y N 318 TYR CE2 C Y N 319 TYR CZ C Y N 320 TYR OH O N N 321 TYR OXT O N N 322 TYR H H N N 323 TYR H2 H N N 324 TYR HA H N N 325 TYR HB2 H N N 326 TYR HB3 H N N 327 TYR HD1 H N N 328 TYR HD2 H N N 329 TYR HE1 H N N 330 TYR HE2 H N N 331 TYR HH H N N 332 TYR HXT H N N 333 VAL N N N N 334 VAL CA C N S 335 VAL C C N N 336 VAL O O N N 337 VAL CB C N N 338 VAL CG1 C N N 339 VAL CG2 C N N 340 VAL OXT O N N 341 VAL H H N N 342 VAL H2 H N N 343 VAL HA H N N 344 VAL HB H N N 345 VAL HG11 H N N 346 VAL HG12 H N N 347 VAL HG13 H N N 348 VAL HG21 H N N 349 VAL HG22 H N N 350 VAL HG23 H N N 351 VAL HXT H N N 352 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TRP N CA sing N N 270 TRP N H sing N N 271 TRP N H2 sing N N 272 TRP CA C sing N N 273 TRP CA CB sing N N 274 TRP CA HA sing N N 275 TRP C O doub N N 276 TRP C OXT sing N N 277 TRP CB CG sing N N 278 TRP CB HB2 sing N N 279 TRP CB HB3 sing N N 280 TRP CG CD1 doub Y N 281 TRP CG CD2 sing Y N 282 TRP CD1 NE1 sing Y N 283 TRP CD1 HD1 sing N N 284 TRP CD2 CE2 doub Y N 285 TRP CD2 CE3 sing Y N 286 TRP NE1 CE2 sing Y N 287 TRP NE1 HE1 sing N N 288 TRP CE2 CZ2 sing Y N 289 TRP CE3 CZ3 doub Y N 290 TRP CE3 HE3 sing N N 291 TRP CZ2 CH2 doub Y N 292 TRP CZ2 HZ2 sing N N 293 TRP CZ3 CH2 sing Y N 294 TRP CZ3 HZ3 sing N N 295 TRP CH2 HH2 sing N N 296 TRP OXT HXT sing N N 297 TYR N CA sing N N 298 TYR N H sing N N 299 TYR N H2 sing N N 300 TYR CA C sing N N 301 TYR CA CB sing N N 302 TYR CA HA sing N N 303 TYR C O doub N N 304 TYR C OXT sing N N 305 TYR CB CG sing N N 306 TYR CB HB2 sing N N 307 TYR CB HB3 sing N N 308 TYR CG CD1 doub Y N 309 TYR CG CD2 sing Y N 310 TYR CD1 CE1 sing Y N 311 TYR CD1 HD1 sing N N 312 TYR CD2 CE2 doub Y N 313 TYR CD2 HD2 sing N N 314 TYR CE1 CZ doub Y N 315 TYR CE1 HE1 sing N N 316 TYR CE2 CZ sing Y N 317 TYR CE2 HE2 sing N N 318 TYR CZ OH sing N N 319 TYR OH HH sing N N 320 TYR OXT HXT sing N N 321 VAL N CA sing N N 322 VAL N H sing N N 323 VAL N H2 sing N N 324 VAL CA C sing N N 325 VAL CA CB sing N N 326 VAL CA HA sing N N 327 VAL C O doub N N 328 VAL C OXT sing N N 329 VAL CB CG1 sing N N 330 VAL CB CG2 sing N N 331 VAL CB HB sing N N 332 VAL CG1 HG11 sing N N 333 VAL CG1 HG12 sing N N 334 VAL CG1 HG13 sing N N 335 VAL CG2 HG21 sing N N 336 VAL CG2 HG22 sing N N 337 VAL CG2 HG23 sing N N 338 VAL OXT HXT sing N N 339 # _pdbx_audit_support.funding_organization 'Spanish Ministry of Science, Innovation, and Universities' _pdbx_audit_support.country Spain _pdbx_audit_support.grant_number PID2021-124602OB-I00 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code 4HVW _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.details 4HVW # _atom_sites.entry_id 8BQ3 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.025405 _atom_sites.fract_transf_matrix[1][2] 0.014668 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.029335 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006736 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #