data_8BSS # _entry.id 8BSS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8BSS pdb_00008bss 10.2210/pdb8bss/pdb WWPDB D_1292127020 ? ? BMRB 34773 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'E. coli wild-type LptAm in complex with thanatin derivative 7' 7QS6 unspecified PDB 'E. coli Q62L mutant LptAm in complex with thanatin derivative 7' 7ZED unspecified PDB 'K. pneumoniae wild-type LptAm in complex with thanatin derivative 7' 7ZAX unspecified BMRB 'Solution Structure of thanatin-like derivative 5 in complex with E. coli LptA mutant Q62L' 34773 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8BSS _pdbx_database_status.recvd_initial_deposition_date 2022-11-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Oi, K.K.' 1 0000-0001-8353-868X 'Jurt, S.' 2 0000-0002-6016-8505 'Moehle, K.' 3 0000-0003-1477-0623 'Zerbe, O.' 4 0000-0003-0475-438X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2375-2548 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first eadg3683 _citation.page_last eadg3683 _citation.title 'Peptidomimetic antibiotics disrupt the lipopolysaccharide transport bridge of drug-resistant Enterobacteriaceae.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/sciadv.adg3683 _citation.pdbx_database_id_PubMed 37224246 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schuster, M.' 1 0000-0002-3008-3957 primary 'Brabet, E.' 2 0000-0003-4403-3296 primary 'Oi, K.K.' 3 0000-0001-8353-868X primary 'Desjonqueres, N.' 4 ? primary 'Moehle, K.' 5 0000-0003-1477-0623 primary 'Le Poupon, K.' 6 ? primary 'Hell, S.' 7 ? primary 'Gable, S.' 8 ? primary 'Rithie, V.' 9 ? primary 'Dillinger, S.' 10 ? primary 'Zbinden, P.' 11 0000-0001-9935-3575 primary 'Luther, A.' 12 0000-0002-7548-5175 primary 'Li, C.' 13 ? primary 'Stiegeler, S.' 14 0000-0001-9622-7629 primary ;D'Arco, C. ; 15 0000-0003-1432-835X primary 'Locher, H.' 16 ? primary 'Remus, T.' 17 0000-0001-8406-6493 primary 'DiMaio, S.' 18 ? primary 'Motta, P.' 19 0000-0002-7080-1327 primary 'Wach, A.' 20 0000-0002-5390-4439 primary 'Jung, F.' 21 0000-0003-2791-2934 primary 'Upert, G.' 22 0000-0003-1849-9973 primary 'Obrecht, D.' 23 0000-0003-3569-8878 primary 'Benghezal, M.' 24 0000-0002-4207-0192 primary 'Zerbe, O.' 25 0000-0003-0475-438X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Lipopolysaccharide export system protein LptA' 14521.276 1 ? ? ? ? 2 polymer syn 'Thanatin-like derivative' 1919.318 1 ? ? ? 'HYP = hydroxyproline; LE1 = penicillamine; DAB = diaminobutyric acid; 4FO = D-DAB' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTLGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEG HASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKR ; ;VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTLGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEG HASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKR ; A ? 2 'polypeptide(L)' no yes 'V(HYP)IIY(LE1)NR(DAB)T(4FO)KC(DAB)(DAB)Y' VPIIYXNRATXKCAAY B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 THR n 1 3 GLY n 1 4 ASP n 1 5 THR n 1 6 ASP n 1 7 GLN n 1 8 PRO n 1 9 ILE n 1 10 HIS n 1 11 ILE n 1 12 GLU n 1 13 SER n 1 14 ASP n 1 15 GLN n 1 16 GLN n 1 17 SER n 1 18 LEU n 1 19 ASP n 1 20 MET n 1 21 GLN n 1 22 GLY n 1 23 ASN n 1 24 VAL n 1 25 VAL n 1 26 THR n 1 27 PHE n 1 28 THR n 1 29 GLY n 1 30 ASN n 1 31 VAL n 1 32 ILE n 1 33 VAL n 1 34 THR n 1 35 LEU n 1 36 GLY n 1 37 THR n 1 38 ILE n 1 39 LYS n 1 40 ILE n 1 41 ASN n 1 42 ALA n 1 43 ASP n 1 44 LYS n 1 45 VAL n 1 46 VAL n 1 47 VAL n 1 48 THR n 1 49 ARG n 1 50 PRO n 1 51 GLY n 1 52 GLY n 1 53 GLU n 1 54 GLN n 1 55 GLY n 1 56 LYS n 1 57 GLU n 1 58 VAL n 1 59 ILE n 1 60 ASP n 1 61 GLY n 1 62 TYR n 1 63 GLY n 1 64 LYS n 1 65 PRO n 1 66 ALA n 1 67 THR n 1 68 PHE n 1 69 TYR n 1 70 GLN n 1 71 MET n 1 72 GLN n 1 73 ASP n 1 74 ASN n 1 75 GLY n 1 76 LYS n 1 77 PRO n 1 78 VAL n 1 79 GLU n 1 80 GLY n 1 81 HIS n 1 82 ALA n 1 83 SER n 1 84 GLN n 1 85 MET n 1 86 HIS n 1 87 TYR n 1 88 GLU n 1 89 LEU n 1 90 ALA n 1 91 LYS n 1 92 ASP n 1 93 PHE n 1 94 VAL n 1 95 VAL n 1 96 LEU n 1 97 THR n 1 98 GLY n 1 99 ASN n 1 100 ALA n 1 101 TYR n 1 102 LEU n 1 103 GLN n 1 104 GLN n 1 105 VAL n 1 106 ASP n 1 107 SER n 1 108 ASN n 1 109 ILE n 1 110 LYS n 1 111 GLY n 1 112 ASP n 1 113 LYS n 1 114 ILE n 1 115 THR n 1 116 TYR n 1 117 LEU n 1 118 VAL n 1 119 LYS n 1 120 GLU n 1 121 GLN n 1 122 LYS n 1 123 MET n 1 124 GLN n 1 125 ALA n 1 126 PHE n 1 127 SER n 1 128 ASP n 1 129 LYS n 1 130 GLY n 1 131 LYS n 1 132 ARG n 2 1 VAL n 2 2 HYP n 2 3 ILE n 2 4 ILE n 2 5 TYR n 2 6 LE1 n 2 7 ASN n 2 8 ARG n 2 9 DAB n 2 10 THR n 2 11 4FO n 2 12 LYS n 2 13 CYS n 2 14 DAB n 2 15 DAB n 2 16 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 132 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'lptA, yhbN, b3200, JW3167' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K-12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain K-12 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 16 _pdbx_entity_src_syn.organism_scientific 'Podisus maculiventris' _pdbx_entity_src_syn.organism_common_name 'spined soldier bug' _pdbx_entity_src_syn.ncbi_taxonomy_id 29025 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP LPTA_ECOLI P0ADV1 ? 1 ;VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEG HASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKR ; 28 2 UNP THAN_PODMA P55788 ? 2 VPIIYCNRRTGKCQRM 6 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8BSS A 1 ? 132 ? P0ADV1 28 ? 159 ? 28 159 2 2 8BSS B 1 ? 16 ? P55788 6 ? 21 ? 206 221 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8BSS LEU A 35 ? UNP P0ADV1 GLN 62 'engineered mutation' 62 1 2 8BSS LE1 B 6 ? UNP P55788 CYS 11 'modified residue' 211 2 2 8BSS DAB B 9 ? UNP P55788 ARG 14 'modified residue' 214 3 2 8BSS 4FO B 11 ? UNP P55788 GLY 16 'modified residue' 216 4 2 8BSS DAB B 14 ? UNP P55788 GLN 19 'modified residue' 219 5 2 8BSS DAB B 15 ? UNP P55788 ARG 20 'modified residue' 220 6 2 8BSS TYR B 16 ? UNP P55788 MET 21 'engineered mutation' 221 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 4FO 'D-peptide linking' . '(2R)-2,4-diaminobutanoic acid' ? 'C4 H10 N2 O2' 118.134 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DAB 'L-peptide linking' n '2,4-DIAMINOBUTYRIC ACID' ? 'C4 H10 N2 O2' 118.134 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HYP 'L-peptide linking' n 4-HYDROXYPROLINE HYDROXYPROLINE 'C5 H9 N O3' 131.130 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LE1 'L-peptide linking' n 3-sulfanyl-L-valine 'L-LE1ICILLAMINE; L-Penicillamine' 'C5 H11 N O2 S' 149.211 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 2 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HN(COCA)CB' 1 isotropic 6 1 1 '3D HNCACB' 1 isotropic 7 1 1 '3D 1H-15N NOESY' 1 isotropic 8 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 9 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic 10 1 1 '3D HBHA(CO)NH' 1 isotropic 11 1 1 '3D HCCH-TOCSY' 1 isotropic 12 1 1 '2D (HB)CB(CGCD)HD' 2 isotropic 13 1 1 '2D (HB)CB(CGCDCE)HE' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 10 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err 0.01 _pdbx_nmr_exptl_sample_conditions.temperature_err 0.2 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;300 uM [U-13C; U-15N] E. coli Lipopolysaccharide export system protein LptA mutant Q62L, 500 uM Thanatin-like derivative 5, 50 mM sodium phosphate, 150 mM sodium chloride, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label Q62L_LptAm_15N13C _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '13C, 15N-labelled Q62L mutant LptAm(28-145)' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE NEO' ? Bruker 700 ? 2 'AVANCE NEO' ? Bruker 600 ? # _pdbx_nmr_refine.entry_id 8BSS _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 8BSS _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8BSS _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 3.98 'Guntert, Mumenthaler and Wuthrich' 2 refinement MOE 2020.09 'Chemical Computing Group ULC, 1010 Sherbook St. West, Suite #910, Montreal, QC, Canada, H3A 2R7, 2022' 3 'chemical shift assignment' CYANA 3.98 'Guntert, Mumenthaler and Wuthrich' 4 'peak picking' 'CcpNmr Analysis' 2.5.2 CCPN # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8BSS _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8BSS _struct.title 'Solution Structure of thanatin-like derivative 5 in complex with E. coli LptA mutant Q62L' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8BSS _struct_keywords.text ANTIBIOTIC _struct_keywords.pdbx_keywords ANTIBIOTIC # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 52 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 56 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 79 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 83 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? B LE1 6 SG ? ? ? 1_555 B CYS 13 SG ? ? B LE1 211 B CYS 218 1_555 ? ? ? ? ? ? ? 2.097 ? ? covale1 covale both ? B VAL 1 C ? ? ? 1_555 B HYP 2 N ? ? B VAL 206 B HYP 207 1_555 ? ? ? ? ? ? ? 1.350 ? ? covale2 covale both ? B HYP 2 C ? ? ? 1_555 B ILE 3 N ? ? B HYP 207 B ILE 208 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale3 covale both ? B TYR 5 C ? ? ? 1_555 B LE1 6 N ? ? B TYR 210 B LE1 211 1_555 ? ? ? ? ? ? ? 1.321 ? ? covale4 covale both ? B LE1 6 C ? ? ? 1_555 B ASN 7 N ? ? B LE1 211 B ASN 212 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale5 covale both ? B ARG 8 C ? ? ? 1_555 B DAB 9 N ? ? B ARG 213 B DAB 214 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale6 covale both ? B DAB 9 C ? ? ? 1_555 B THR 10 N ? ? B DAB 214 B THR 215 1_555 ? ? ? ? ? ? ? 1.346 ? ? covale7 covale both ? B THR 10 C ? ? ? 1_555 B 4FO 11 N ? ? B THR 215 B 4FO 216 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale8 covale both ? B 4FO 11 C ? ? ? 1_555 B LYS 12 N ? ? B 4FO 216 B LYS 217 1_555 ? ? ? ? ? ? ? 1.347 ? ? covale9 covale both ? B CYS 13 C ? ? ? 1_555 B DAB 14 N ? ? B CYS 218 B DAB 219 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale10 covale both ? B DAB 14 C ? ? ? 1_555 B DAB 15 N ? ? B DAB 219 B DAB 220 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale11 covale both ? B DAB 15 C ? ? ? 1_555 B TYR 16 N ? ? B DAB 220 B TYR 221 1_555 ? ? ? ? ? ? ? 1.339 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 1 -6.52 2 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 2 4.81 3 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 3 -10.85 4 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 4 -16.70 5 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 5 -12.67 6 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 6 1.03 7 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 7 2.25 8 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 8 8.21 9 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 9 5.77 10 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 10 8.38 11 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 11 -6.62 12 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 12 -19.39 13 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 13 18.88 14 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 14 -9.22 15 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 15 5.17 16 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 16 -8.42 17 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 17 9.39 18 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 18 -7.06 19 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 19 7.47 20 LYS 64 A . ? LYS 91 A PRO 65 A ? PRO 92 A 20 1.26 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 9 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? parallel AA2 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 108 ? THR A 115 ? ASN A 135 THR A 142 AA1 2 VAL A 95 ? GLN A 103 ? VAL A 122 GLN A 130 AA1 3 LYS A 76 ? HIS A 81 ? LYS A 103 HIS A 108 AA1 4 THR A 67 ? GLN A 72 ? THR A 94 GLN A 99 AA1 5 ILE A 38 ? THR A 48 ? ILE A 65 THR A 75 AA1 6 VAL A 24 ? LEU A 35 ? VAL A 51 LEU A 62 AA1 7 ILE A 9 ? SER A 13 ? ILE A 36 SER A 40 AA1 8 ILE B 3 ? ASN B 7 ? ILE B 208 ASN B 212 AA1 9 CYS B 13 ? DAB B 15 ? CYS B 218 DAB B 220 AA2 1 ASN A 108 ? THR A 115 ? ASN A 135 THR A 142 AA2 2 VAL A 95 ? GLN A 103 ? VAL A 122 GLN A 130 AA2 3 GLN A 84 ? GLU A 88 ? GLN A 111 GLU A 115 AA2 4 VAL A 58 ? TYR A 62 ? VAL A 85 TYR A 89 AA2 5 ILE A 38 ? THR A 48 ? ILE A 65 THR A 75 AA2 6 VAL A 24 ? LEU A 35 ? VAL A 51 LEU A 62 AA2 7 ILE A 9 ? SER A 13 ? ILE A 36 SER A 40 AA2 8 ILE B 3 ? ASN B 7 ? ILE B 208 ASN B 212 AA2 9 CYS B 13 ? DAB B 15 ? CYS B 218 DAB B 220 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 114 ? O ILE A 141 N LEU A 96 ? N LEU A 123 AA1 2 3 O TYR A 101 ? O TYR A 128 N HIS A 81 ? N HIS A 108 AA1 3 4 O LYS A 76 ? O LYS A 103 N GLN A 72 ? N GLN A 99 AA1 4 5 O TYR A 69 ? O TYR A 96 N LYS A 39 ? N LYS A 66 AA1 5 6 O ALA A 42 ? O ALA A 69 N VAL A 31 ? N VAL A 58 AA1 6 7 O ILE A 32 ? O ILE A 59 N GLU A 12 ? N GLU A 39 AA1 7 8 N ILE A 11 ? N ILE A 38 O LE1 B 6 ? O LE1 B 211 AA1 8 9 N TYR B 5 ? N TYR B 210 O DAB B 14 ? O DAB B 219 AA2 1 2 O ILE A 114 ? O ILE A 141 N LEU A 96 ? N LEU A 123 AA2 2 3 O VAL A 95 ? O VAL A 122 N HIS A 86 ? N HIS A 113 AA2 3 4 O TYR A 87 ? O TYR A 114 N ILE A 59 ? N ILE A 86 AA2 4 5 O TYR A 62 ? O TYR A 89 N LYS A 44 ? N LYS A 71 AA2 5 6 O ALA A 42 ? O ALA A 69 N VAL A 31 ? N VAL A 58 AA2 6 7 O ILE A 32 ? O ILE A 59 N GLU A 12 ? N GLU A 39 AA2 7 8 N ILE A 11 ? N ILE A 38 O LE1 B 6 ? O LE1 B 211 AA2 8 9 N TYR B 5 ? N TYR B 210 O DAB B 14 ? O DAB B 219 # _atom_sites.entry_id 8BSS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 28 28 VAL VAL A . n A 1 2 THR 2 29 29 THR THR A . n A 1 3 GLY 3 30 30 GLY GLY A . n A 1 4 ASP 4 31 31 ASP ASP A . n A 1 5 THR 5 32 32 THR THR A . n A 1 6 ASP 6 33 33 ASP ASP A . n A 1 7 GLN 7 34 34 GLN GLN A . n A 1 8 PRO 8 35 35 PRO PRO A . n A 1 9 ILE 9 36 36 ILE ILE A . n A 1 10 HIS 10 37 37 HIS HIS A . n A 1 11 ILE 11 38 38 ILE ILE A . n A 1 12 GLU 12 39 39 GLU GLU A . n A 1 13 SER 13 40 40 SER SER A . n A 1 14 ASP 14 41 41 ASP ASP A . n A 1 15 GLN 15 42 42 GLN GLN A . n A 1 16 GLN 16 43 43 GLN GLN A . n A 1 17 SER 17 44 44 SER SER A . n A 1 18 LEU 18 45 45 LEU LEU A . n A 1 19 ASP 19 46 46 ASP ASP A . n A 1 20 MET 20 47 47 MET MET A . n A 1 21 GLN 21 48 48 GLN GLN A . n A 1 22 GLY 22 49 49 GLY GLY A . n A 1 23 ASN 23 50 50 ASN ASN A . n A 1 24 VAL 24 51 51 VAL VAL A . n A 1 25 VAL 25 52 52 VAL VAL A . n A 1 26 THR 26 53 53 THR THR A . n A 1 27 PHE 27 54 54 PHE PHE A . n A 1 28 THR 28 55 55 THR THR A . n A 1 29 GLY 29 56 56 GLY GLY A . n A 1 30 ASN 30 57 57 ASN ASN A . n A 1 31 VAL 31 58 58 VAL VAL A . n A 1 32 ILE 32 59 59 ILE ILE A . n A 1 33 VAL 33 60 60 VAL VAL A . n A 1 34 THR 34 61 61 THR THR A . n A 1 35 LEU 35 62 62 LEU LEU A . n A 1 36 GLY 36 63 63 GLY GLY A . n A 1 37 THR 37 64 64 THR THR A . n A 1 38 ILE 38 65 65 ILE ILE A . n A 1 39 LYS 39 66 66 LYS LYS A . n A 1 40 ILE 40 67 67 ILE ILE A . n A 1 41 ASN 41 68 68 ASN ASN A . n A 1 42 ALA 42 69 69 ALA ALA A . n A 1 43 ASP 43 70 70 ASP ASP A . n A 1 44 LYS 44 71 71 LYS LYS A . n A 1 45 VAL 45 72 72 VAL VAL A . n A 1 46 VAL 46 73 73 VAL VAL A . n A 1 47 VAL 47 74 74 VAL VAL A . n A 1 48 THR 48 75 75 THR THR A . n A 1 49 ARG 49 76 76 ARG ARG A . n A 1 50 PRO 50 77 77 PRO PRO A . n A 1 51 GLY 51 78 78 GLY GLY A . n A 1 52 GLY 52 79 79 GLY GLY A . n A 1 53 GLU 53 80 80 GLU GLU A . n A 1 54 GLN 54 81 81 GLN GLN A . n A 1 55 GLY 55 82 82 GLY GLY A . n A 1 56 LYS 56 83 83 LYS LYS A . n A 1 57 GLU 57 84 84 GLU GLU A . n A 1 58 VAL 58 85 85 VAL VAL A . n A 1 59 ILE 59 86 86 ILE ILE A . n A 1 60 ASP 60 87 87 ASP ASP A . n A 1 61 GLY 61 88 88 GLY GLY A . n A 1 62 TYR 62 89 89 TYR TYR A . n A 1 63 GLY 63 90 90 GLY GLY A . n A 1 64 LYS 64 91 91 LYS LYS A . n A 1 65 PRO 65 92 92 PRO PRO A . n A 1 66 ALA 66 93 93 ALA ALA A . n A 1 67 THR 67 94 94 THR THR A . n A 1 68 PHE 68 95 95 PHE PHE A . n A 1 69 TYR 69 96 96 TYR TYR A . n A 1 70 GLN 70 97 97 GLN GLN A . n A 1 71 MET 71 98 98 MET MET A . n A 1 72 GLN 72 99 99 GLN GLN A . n A 1 73 ASP 73 100 100 ASP ASP A . n A 1 74 ASN 74 101 101 ASN ASN A . n A 1 75 GLY 75 102 102 GLY GLY A . n A 1 76 LYS 76 103 103 LYS LYS A . n A 1 77 PRO 77 104 104 PRO PRO A . n A 1 78 VAL 78 105 105 VAL VAL A . n A 1 79 GLU 79 106 106 GLU GLU A . n A 1 80 GLY 80 107 107 GLY GLY A . n A 1 81 HIS 81 108 108 HIS HIS A . n A 1 82 ALA 82 109 109 ALA ALA A . n A 1 83 SER 83 110 110 SER SER A . n A 1 84 GLN 84 111 111 GLN GLN A . n A 1 85 MET 85 112 112 MET MET A . n A 1 86 HIS 86 113 113 HIS HIS A . n A 1 87 TYR 87 114 114 TYR TYR A . n A 1 88 GLU 88 115 115 GLU GLU A . n A 1 89 LEU 89 116 116 LEU LEU A . n A 1 90 ALA 90 117 117 ALA ALA A . n A 1 91 LYS 91 118 118 LYS LYS A . n A 1 92 ASP 92 119 119 ASP ASP A . n A 1 93 PHE 93 120 120 PHE PHE A . n A 1 94 VAL 94 121 121 VAL VAL A . n A 1 95 VAL 95 122 122 VAL VAL A . n A 1 96 LEU 96 123 123 LEU LEU A . n A 1 97 THR 97 124 124 THR THR A . n A 1 98 GLY 98 125 125 GLY GLY A . n A 1 99 ASN 99 126 126 ASN ASN A . n A 1 100 ALA 100 127 127 ALA ALA A . n A 1 101 TYR 101 128 128 TYR TYR A . n A 1 102 LEU 102 129 129 LEU LEU A . n A 1 103 GLN 103 130 130 GLN GLN A . n A 1 104 GLN 104 131 131 GLN GLN A . n A 1 105 VAL 105 132 132 VAL VAL A . n A 1 106 ASP 106 133 133 ASP ASP A . n A 1 107 SER 107 134 134 SER SER A . n A 1 108 ASN 108 135 135 ASN ASN A . n A 1 109 ILE 109 136 136 ILE ILE A . n A 1 110 LYS 110 137 137 LYS LYS A . n A 1 111 GLY 111 138 138 GLY GLY A . n A 1 112 ASP 112 139 139 ASP ASP A . n A 1 113 LYS 113 140 140 LYS LYS A . n A 1 114 ILE 114 141 141 ILE ILE A . n A 1 115 THR 115 142 142 THR THR A . n A 1 116 TYR 116 143 143 TYR TYR A . n A 1 117 LEU 117 144 144 LEU LEU A . n A 1 118 VAL 118 145 145 VAL VAL A . n A 1 119 LYS 119 146 146 LYS LYS A . n A 1 120 GLU 120 147 147 GLU GLU A . n A 1 121 GLN 121 148 148 GLN GLN A . n A 1 122 LYS 122 149 149 LYS LYS A . n A 1 123 MET 123 150 150 MET MET A . n A 1 124 GLN 124 151 151 GLN GLN A . n A 1 125 ALA 125 152 152 ALA ALA A . n A 1 126 PHE 126 153 153 PHE PHE A . n A 1 127 SER 127 154 154 SER SER A . n A 1 128 ASP 128 155 155 ASP ASP A . n A 1 129 LYS 129 156 156 LYS LYS A . n A 1 130 GLY 130 157 157 GLY GLY A . n A 1 131 LYS 131 158 158 LYS LYS A . n A 1 132 ARG 132 159 159 ARG ARG A . n B 2 1 VAL 1 206 206 VAL VAL B . n B 2 2 HYP 2 207 207 HYP HYP B . n B 2 3 ILE 3 208 208 ILE ILE B . n B 2 4 ILE 4 209 209 ILE ILE B . n B 2 5 TYR 5 210 210 TYR TYR B . n B 2 6 LE1 6 211 211 LE1 LE1 B . n B 2 7 ASN 7 212 212 ASN ASN B . n B 2 8 ARG 8 213 213 ARG ARG B . n B 2 9 DAB 9 214 214 DAB DAB B . n B 2 10 THR 10 215 215 THR THR B . n B 2 11 4FO 11 216 216 4FO 4FO B . n B 2 12 LYS 12 217 217 LYS LYS B . n B 2 13 CYS 13 218 218 CYS CYS B . n B 2 14 DAB 14 219 219 DAB DAB B . n B 2 15 DAB 15 220 220 DAB DAB B . n B 2 16 TYR 16 221 221 TYR TYR B . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email oliver.zerbe@chem.uzh.ch _pdbx_contact_author.name_first Oliver _pdbx_contact_author.name_last Zerbe _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0475-438X # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id HYP _pdbx_struct_mod_residue.label_seq_id 2 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id HYP _pdbx_struct_mod_residue.auth_seq_id 207 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id PRO _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1660 ? 1 MORE -4 ? 1 'SSA (A^2)' 8770 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-06-07 2 'Structure model' 2 0 2023-06-14 3 'Structure model' 3 0 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Source and taxonomy' 5 2 'Structure model' 'Structure summary' 6 3 'Structure model' 'Atomic model' 7 3 'Structure model' 'Data collection' 8 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' entity 3 2 'Structure model' pdbx_entity_src_syn 4 2 'Structure model' pdbx_struct_mod_residue 5 2 'Structure model' struct_ref 6 2 'Structure model' struct_ref_seq 7 2 'Structure model' struct_ref_seq_dif 8 3 'Structure model' atom_site 9 3 'Structure model' chem_comp_atom 10 3 'Structure model' chem_comp_bond 11 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity.pdbx_description' 2 2 'Structure model' '_pdbx_entity_src_syn.organism_common_name' 3 2 'Structure model' '_struct_ref.db_code' 4 2 'Structure model' '_struct_ref.db_name' 5 2 'Structure model' '_struct_ref.pdbx_align_begin' 6 2 'Structure model' '_struct_ref.pdbx_db_accession' 7 2 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 8 2 'Structure model' '_struct_ref_seq.db_align_beg' 9 2 'Structure model' '_struct_ref_seq.db_align_end' 10 2 'Structure model' '_struct_ref_seq.pdbx_db_accession' 11 3 'Structure model' '_atom_site.auth_atom_id' 12 3 'Structure model' '_atom_site.label_atom_id' 13 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # _pdbx_entry_details.entry_id 8BSS _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'E. coli Lipopolysaccharide export system protein LptA mutant Q62L' 300 ? uM '[U-13C; U-15N]' 1 'Thanatin-like derivative 5' 500 ? uM none 1 'sodium phosphate' 50 ? mM none 1 'sodium chloride' 150 ? mM none # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 OD2 A ASP 46 ? ? HH B TYR 221 ? ? 1.60 2 3 HG1 A THR 75 ? ? OE1 A GLU 84 ? ? 1.58 3 6 HG1 A THR 75 ? ? OE1 A GLU 84 ? ? 1.59 4 15 OD2 A ASP 133 ? ? HG A SER 134 ? ? 1.59 5 17 HG1 A THR 32 ? ? OD2 A ASP 33 ? ? 1.60 6 20 HG1 A THR 29 ? ? OD1 A ASP 33 ? ? 1.59 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 123.45 120.30 3.15 0.50 N 2 2 CB B TYR 221 ? ? CG B TYR 221 ? ? CD2 B TYR 221 ? ? 117.31 121.00 -3.69 0.60 N 3 3 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 123.37 120.30 3.07 0.50 N 4 3 NE B ARG 213 ? ? CZ B ARG 213 ? ? NH1 B ARG 213 ? ? 123.61 120.30 3.31 0.50 N 5 3 NE B ARG 213 ? ? CZ B ARG 213 ? ? NH2 B ARG 213 ? ? 117.26 120.30 -3.04 0.50 N 6 4 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 124.91 120.30 4.61 0.50 N 7 4 NE B ARG 213 ? ? CZ B ARG 213 ? ? NH1 B ARG 213 ? ? 124.06 120.30 3.76 0.50 N 8 5 CD A ARG 159 ? ? NE A ARG 159 ? ? CZ A ARG 159 ? ? 132.02 123.60 8.42 1.40 N 9 5 NE B ARG 213 ? ? CZ B ARG 213 ? ? NH1 B ARG 213 ? ? 124.71 120.30 4.41 0.50 N 10 6 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 123.55 120.30 3.25 0.50 N 11 6 NE B ARG 213 ? ? CZ B ARG 213 ? ? NH1 B ARG 213 ? ? 124.38 120.30 4.08 0.50 N 12 7 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 123.38 120.30 3.08 0.50 N 13 8 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 123.34 120.30 3.04 0.50 N 14 8 NE B ARG 213 ? ? CZ B ARG 213 ? ? NH1 B ARG 213 ? ? 123.76 120.30 3.46 0.50 N 15 8 NE B ARG 213 ? ? CZ B ARG 213 ? ? NH2 B ARG 213 ? ? 116.42 120.30 -3.88 0.50 N 16 9 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 123.56 120.30 3.26 0.50 N 17 9 NE B ARG 213 ? ? CZ B ARG 213 ? ? NH1 B ARG 213 ? ? 123.94 120.30 3.64 0.50 N 18 10 NE B ARG 213 ? ? CZ B ARG 213 ? ? NH1 B ARG 213 ? ? 123.66 120.30 3.36 0.50 N 19 11 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 124.51 120.30 4.21 0.50 N 20 11 NE B ARG 213 ? ? CZ B ARG 213 ? ? NH1 B ARG 213 ? ? 123.77 120.30 3.47 0.50 N 21 12 NE A ARG 159 ? ? CZ A ARG 159 ? ? NH1 A ARG 159 ? ? 123.92 120.30 3.62 0.50 N 22 13 NE A ARG 159 ? ? CZ A ARG 159 ? ? NH1 A ARG 159 ? ? 123.40 120.30 3.10 0.50 N 23 13 NE A ARG 159 ? ? CZ A ARG 159 ? ? NH2 A ARG 159 ? ? 117.26 120.30 -3.04 0.50 N 24 14 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 126.35 120.30 6.05 0.50 N 25 14 NE B ARG 213 ? ? CZ B ARG 213 ? ? NH1 B ARG 213 ? ? 123.60 120.30 3.30 0.50 N 26 15 NE B ARG 213 ? ? CZ B ARG 213 ? ? NH1 B ARG 213 ? ? 124.04 120.30 3.74 0.50 N 27 17 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 123.32 120.30 3.02 0.50 N 28 17 NE B ARG 213 ? ? CZ B ARG 213 ? ? NH1 B ARG 213 ? ? 123.87 120.30 3.57 0.50 N 29 17 NE B ARG 213 ? ? CZ B ARG 213 ? ? NH2 B ARG 213 ? ? 117.08 120.30 -3.22 0.50 N 30 18 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH1 A ARG 76 ? ? 123.53 120.30 3.23 0.50 N 31 19 NE A ARG 159 ? ? CZ A ARG 159 ? ? NH1 A ARG 159 ? ? 123.85 120.30 3.55 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 57 ? ? 35.84 61.77 2 1 THR A 64 ? ? 58.71 19.83 3 1 ASP A 70 ? ? -131.16 -38.51 4 1 PRO A 77 ? ? -95.31 47.31 5 1 GLN A 81 ? ? 47.07 12.91 6 1 ASN A 101 ? ? -74.16 21.21 7 1 ALA A 117 ? ? -167.81 51.40 8 1 ASP A 119 ? ? 54.96 -12.91 9 1 VAL A 145 ? ? -73.44 44.56 10 1 LYS A 146 ? ? -168.99 -15.01 11 1 PHE A 153 ? ? -141.47 51.63 12 1 THR B 215 ? ? -144.37 -10.38 13 2 ASP A 31 ? ? -63.83 93.57 14 2 LEU A 62 ? ? -106.79 66.11 15 2 GLN A 81 ? ? -87.22 42.65 16 2 ASP A 100 ? ? -38.50 -36.50 17 2 TYR A 114 ? ? -68.81 98.85 18 2 ASP A 133 ? ? -130.59 -52.92 19 2 SER A 134 ? ? -66.77 89.98 20 2 ASN A 135 ? ? -100.38 74.22 21 2 LYS A 146 ? ? -155.13 3.41 22 2 SER A 154 ? ? -90.69 51.20 23 2 LYS A 156 ? ? -74.64 40.98 24 2 LYS A 158 ? ? -63.25 68.13 25 2 THR B 215 ? ? -141.82 -18.84 26 3 ASP A 41 ? ? -82.69 -73.00 27 3 PRO A 77 ? ? -33.77 85.54 28 3 LYS A 83 ? ? 171.48 155.41 29 3 ASN A 101 ? ? -73.85 27.62 30 3 LEU A 116 ? ? -65.80 10.98 31 3 LYS A 118 ? ? -161.92 40.14 32 3 ASP A 119 ? ? 57.73 5.54 33 3 VAL A 132 ? ? -73.39 28.86 34 3 ASP A 133 ? ? -160.60 -58.85 35 3 VAL A 145 ? ? -67.29 30.11 36 3 THR B 215 ? ? -140.46 14.38 37 4 THR A 29 ? ? -155.13 2.74 38 4 ASP A 31 ? ? -69.60 86.14 39 4 ASN A 57 ? ? 36.14 58.61 40 4 PRO A 77 ? ? -85.73 32.06 41 4 GLN A 81 ? ? -76.29 45.50 42 4 ASN A 101 ? ? -79.19 28.91 43 4 ALA A 117 ? ? -87.49 44.35 44 4 LYS A 118 ? ? -151.26 -10.99 45 4 GLN A 148 ? ? -158.89 -50.14 46 4 ASP A 155 ? ? -114.09 -150.57 47 4 LYS A 156 ? ? -68.11 78.33 48 4 THR B 215 ? ? -138.17 -59.85 49 5 ASP A 33 ? ? -133.77 -140.41 50 5 ASN A 57 ? ? 19.78 86.56 51 5 ASP A 70 ? ? -150.93 -23.37 52 5 THR A 75 ? ? -155.37 52.15 53 5 ASP A 119 ? ? 59.74 -17.55 54 5 VAL A 145 ? ? -78.74 44.56 55 5 GLN A 148 ? ? 59.49 -22.05 56 5 LYS A 158 ? ? -74.67 49.21 57 5 4FO B 216 ? ? 68.27 -15.53 58 6 GLN A 81 ? ? -85.05 40.13 59 6 LYS A 91 ? ? -155.55 89.54 60 6 LEU A 116 ? ? -81.31 45.58 61 6 ALA A 117 ? ? -157.93 18.83 62 6 LYS A 118 ? ? -161.43 -36.34 63 6 ASP A 133 ? ? -137.43 -49.40 64 6 VAL A 145 ? ? -80.77 38.19 65 6 LYS A 149 ? ? -81.64 38.79 66 7 ASP A 33 ? ? -154.66 -141.44 67 7 THR A 64 ? ? 65.55 -12.34 68 7 ALA A 117 ? ? -157.57 -8.46 69 7 ASP A 119 ? ? 56.85 -43.06 70 7 ASP A 133 ? ? -135.42 -81.91 71 7 LYS A 146 ? ? 68.94 -5.31 72 7 SER A 154 ? ? -150.39 83.61 73 7 ASP A 155 ? ? -102.66 -112.66 74 7 LYS A 156 ? ? -147.53 -19.72 75 7 THR B 215 ? ? -145.09 11.29 76 7 4FO B 216 ? ? 74.62 -31.66 77 8 THR A 32 ? ? -143.08 -37.99 78 8 ASN A 57 ? ? 39.68 58.14 79 8 LYS A 91 ? ? -158.83 78.39 80 8 ALA A 117 ? ? -143.04 18.50 81 8 LYS A 118 ? ? -169.10 -46.61 82 8 ASP A 133 ? ? -156.96 -35.47 83 8 VAL A 145 ? ? -74.66 39.82 84 8 LYS A 146 ? ? -156.21 -43.32 85 8 GLN A 148 ? ? 58.66 -26.57 86 8 ASP A 155 ? ? -67.19 86.95 87 8 LYS A 156 ? ? -88.73 47.98 88 8 LYS A 158 ? ? -58.40 178.56 89 9 ASN A 57 ? ? 36.96 58.35 90 9 GLN A 81 ? ? -155.81 -36.50 91 9 LYS A 118 ? ? -147.71 47.65 92 9 LYS A 146 ? ? -114.85 56.79 93 9 MET A 150 ? ? -64.99 84.89 94 9 LYS A 156 ? ? -174.40 140.66 95 9 LYS A 158 ? ? -146.26 13.51 96 10 MET A 47 ? ? -76.72 38.03 97 10 ASN A 57 ? ? 38.97 65.69 98 10 THR A 75 ? ? -143.66 59.90 99 10 VAL A 132 ? ? -69.68 16.24 100 10 ASP A 133 ? ? -163.09 -77.55 101 10 LYS A 146 ? ? -156.54 52.41 102 10 SER A 154 ? ? -69.36 -164.17 103 10 ASP A 155 ? ? 35.60 76.69 104 11 THR A 64 ? ? 70.23 -3.96 105 11 ASP A 100 ? ? -22.27 -61.83 106 11 ASN A 101 ? ? -79.81 26.44 107 11 ASP A 119 ? ? 58.63 -13.77 108 11 ASP A 133 ? ? -147.82 -12.67 109 11 ASP A 139 ? ? -69.18 2.14 110 11 VAL A 145 ? ? -77.38 38.69 111 12 THR A 29 ? ? -57.71 109.30 112 12 GLN A 34 ? ? -48.50 150.51 113 12 ASN A 50 ? ? -142.76 -14.80 114 12 PRO A 77 ? ? -61.15 96.90 115 12 GLN A 81 ? ? -78.94 25.29 116 12 ASN A 101 ? ? -69.50 13.52 117 12 ASP A 119 ? ? 62.80 -60.66 118 12 THR A 124 ? ? -150.57 5.99 119 12 GLN A 131 ? ? -124.48 -168.43 120 12 VAL A 145 ? ? -83.90 43.13 121 12 LYS A 146 ? ? -163.56 27.53 122 12 LYS A 149 ? ? -159.64 58.42 123 13 ASP A 33 ? ? -68.25 -178.60 124 13 THR A 64 ? ? 52.41 8.77 125 13 LYS A 91 ? ? -165.44 73.22 126 13 ASP A 100 ? ? -36.71 -72.59 127 13 ASN A 101 ? ? -82.64 42.69 128 13 LYS A 118 ? ? -140.47 -8.44 129 13 GLN A 148 ? ? -68.32 92.97 130 13 4FO B 216 ? ? 67.42 -0.22 131 14 GLN A 81 ? ? -73.56 47.99 132 14 ASP A 100 ? ? -48.21 -19.37 133 14 LYS A 118 ? ? -142.65 10.20 134 14 VAL A 132 ? ? -79.72 42.39 135 14 ASP A 133 ? ? -172.63 -33.15 136 14 LYS A 149 ? ? -150.99 32.98 137 14 ASP A 155 ? ? -43.32 2.26 138 15 THR A 29 ? ? -148.75 44.61 139 15 ASN A 57 ? ? 55.01 79.14 140 15 ASP A 70 ? ? -147.67 -8.11 141 15 GLU A 80 ? ? -33.80 133.24 142 15 LEU A 144 ? ? -76.36 45.19 143 15 GLN A 148 ? ? -64.88 21.83 144 15 LYS A 156 ? ? -147.48 55.42 145 15 LYS A 158 ? ? -145.58 -6.19 146 15 HYP B 207 ? ? -69.22 89.30 147 15 DAB B 214 ? ? 57.11 -8.41 148 15 THR B 215 ? ? -146.24 -37.68 149 16 MET A 47 ? ? -76.09 37.50 150 16 ASN A 101 ? ? -64.20 13.88 151 16 MET A 112 ? ? -141.26 16.68 152 16 ASP A 119 ? ? 68.18 -38.01 153 16 VAL A 122 ? ? -104.14 65.49 154 16 GLN A 148 ? ? -154.50 -1.89 155 16 LYS A 149 ? ? -155.96 52.28 156 16 DAB B 214 ? ? -66.69 1.19 157 16 4FO B 216 ? ? 64.46 -8.27 158 17 MET A 47 ? ? -65.59 0.16 159 17 THR A 64 ? ? -144.98 31.25 160 17 ASP A 70 ? ? -143.53 -5.52 161 17 ASP A 119 ? ? 62.71 85.82 162 17 LEU A 123 ? ? -108.38 67.37 163 17 ASP A 133 ? ? -122.79 -58.31 164 17 SER A 134 ? ? -69.31 49.16 165 17 ASN A 135 ? ? -77.33 24.92 166 17 THR A 142 ? ? -157.52 38.75 167 17 TYR A 143 ? ? -38.24 132.70 168 17 LYS A 146 ? ? 60.27 95.03 169 18 ASP A 33 ? ? -54.84 99.98 170 18 ASN A 57 ? ? 64.16 131.86 171 18 THR A 64 ? ? 57.64 11.51 172 18 ASP A 100 ? ? 42.22 -117.60 173 18 ASP A 119 ? ? 65.50 -17.48 174 18 GLN A 131 ? ? -117.61 -163.98 175 18 ASP A 139 ? ? -64.12 0.12 176 18 MET A 150 ? ? -69.61 31.93 177 18 ASP A 155 ? ? -97.01 -155.68 178 18 LYS A 156 ? ? -145.07 13.83 179 19 ASN A 57 ? ? 39.51 64.19 180 19 LEU A 62 ? ? -97.72 55.76 181 19 LYS A 91 ? ? -153.89 45.16 182 19 ASP A 100 ? ? 29.89 -89.29 183 19 ASN A 101 ? ? -52.32 52.10 184 19 ASP A 119 ? ? 37.17 33.59 185 19 SER A 134 ? ? -49.81 158.69 186 19 LEU A 144 ? ? -78.08 47.72 187 19 LYS A 146 ? ? -147.31 55.72 188 19 LYS A 156 ? ? -69.15 55.92 189 19 LYS A 158 ? ? -145.55 46.45 190 20 THR A 29 ? ? -65.38 -172.40 191 20 ASP A 31 ? ? 48.59 19.54 192 20 THR A 64 ? ? 71.79 -3.43 193 20 LYS A 83 ? ? -82.29 48.92 194 20 VAL A 132 ? ? -77.48 25.95 195 20 ASP A 133 ? ? -158.91 -91.14 196 20 SER A 154 ? ? -108.56 55.44 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 THR A 29 ? ? GLY A 30 ? ? 149.27 2 1 THR A 64 ? ? ILE A 65 ? ? 149.51 3 1 GLN A 97 ? ? MET A 98 ? ? 148.11 4 1 SER A 154 ? ? ASP A 155 ? ? -141.87 5 2 VAL A 28 ? ? THR A 29 ? ? 134.99 6 2 DAB B 220 ? ? TYR B 221 ? ? 130.29 7 3 DAB B 220 ? ? TYR B 221 ? ? 110.95 8 4 VAL A 28 ? ? THR A 29 ? ? -149.20 9 4 VAL A 52 ? ? THR A 53 ? ? 144.79 10 4 DAB B 220 ? ? TYR B 221 ? ? 132.36 11 6 VAL A 28 ? ? THR A 29 ? ? 138.10 12 6 DAB B 220 ? ? TYR B 221 ? ? 123.45 13 7 GLY A 30 ? ? ASP A 31 ? ? -144.38 14 7 DAB B 220 ? ? TYR B 221 ? ? 131.73 15 8 GLN A 97 ? ? MET A 98 ? ? 148.80 16 8 DAB B 220 ? ? TYR B 221 ? ? 145.56 17 9 GLY A 30 ? ? ASP A 31 ? ? -145.11 18 9 DAB B 220 ? ? TYR B 221 ? ? 131.64 19 10 THR A 32 ? ? ASP A 33 ? ? -149.80 20 10 LYS B 217 ? ? CYS B 218 ? ? -148.66 21 10 CYS B 218 ? ? DAB B 219 ? ? 146.53 22 10 DAB B 220 ? ? TYR B 221 ? ? 131.49 23 11 ASP A 139 ? ? LYS A 140 ? ? 146.84 24 11 DAB B 220 ? ? TYR B 221 ? ? 113.98 25 13 DAB B 220 ? ? TYR B 221 ? ? 135.69 26 14 ASN A 135 ? ? ILE A 136 ? ? 139.41 27 14 DAB B 220 ? ? TYR B 221 ? ? 148.70 28 15 VAL A 28 ? ? THR A 29 ? ? -149.17 29 15 GLN A 42 ? ? GLN A 43 ? ? 148.03 30 15 LYS A 71 ? ? VAL A 72 ? ? 149.20 31 15 THR A 75 ? ? ARG A 76 ? ? -144.88 32 15 GLY A 79 ? ? GLU A 80 ? ? 120.17 33 15 MET A 98 ? ? GLN A 99 ? ? 147.11 34 15 DAB B 219 ? ? DAB B 220 ? ? 144.12 35 16 THR A 32 ? ? ASP A 33 ? ? -143.60 36 16 ASP A 41 ? ? GLN A 42 ? ? 143.43 37 16 GLU A 115 ? ? LEU A 116 ? ? -144.98 38 16 ALA A 117 ? ? LYS A 118 ? ? -144.50 39 16 ASP A 119 ? ? PHE A 120 ? ? -145.59 40 16 GLY A 138 ? ? ASP A 139 ? ? 148.80 41 16 DAB B 220 ? ? TYR B 221 ? ? 132.97 42 17 GLN A 43 ? ? SER A 44 ? ? 147.59 43 17 GLN A 148 ? ? LYS A 149 ? ? 138.42 44 17 HYP B 207 ? ? ILE B 208 ? ? 141.51 45 17 DAB B 220 ? ? TYR B 221 ? ? 149.97 46 18 VAL A 28 ? ? THR A 29 ? ? 137.49 47 18 DAB B 220 ? ? TYR B 221 ? ? 133.30 48 19 GLN A 99 ? ? ASP A 100 ? ? 147.96 49 19 DAB B 220 ? ? TYR B 221 ? ? 141.90 50 20 DAB B 219 ? ? DAB B 220 ? ? 148.35 51 20 DAB B 220 ? ? TYR B 221 ? ? 109.21 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 18 _pdbx_validate_main_chain_plane.auth_comp_id VAL _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 28 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -11.50 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 ARG A 76 ? ? 0.088 'SIDE CHAIN' 2 3 ARG A 76 ? ? 0.082 'SIDE CHAIN' 3 4 TYR A 89 ? ? 0.066 'SIDE CHAIN' 4 6 TYR A 89 ? ? 0.087 'SIDE CHAIN' 5 6 TYR A 96 ? ? 0.099 'SIDE CHAIN' 6 7 TYR A 143 ? ? 0.083 'SIDE CHAIN' 7 9 ARG A 76 ? ? 0.089 'SIDE CHAIN' 8 9 TYR B 221 ? ? 0.070 'SIDE CHAIN' 9 14 TYR A 89 ? ? 0.135 'SIDE CHAIN' 10 15 ARG B 213 ? ? 0.087 'SIDE CHAIN' 11 17 TYR A 143 ? ? 0.094 'SIDE CHAIN' 12 18 TYR B 221 ? ? 0.074 'SIDE CHAIN' 13 19 ARG B 213 ? ? 0.079 'SIDE CHAIN' 14 20 TYR A 89 ? ? 0.075 'SIDE CHAIN' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 4FO N N N N 1 4FO CA C N R 2 4FO C C N N 3 4FO O O N N 4 4FO CB C N N 5 4FO CG C N N 6 4FO NZ N N N 7 4FO OXT O N N 8 4FO H H N N 9 4FO H2 H N N 10 4FO HA H N N 11 4FO HB2 H N N 12 4FO HB3 H N N 13 4FO HG3 H N N 14 4FO HG2 H N N 15 4FO HZ3 H N N 16 4FO HZ2 H N N 17 4FO HXT H N N 18 ALA N N N N 19 ALA CA C N S 20 ALA C C N N 21 ALA O O N N 22 ALA CB C N N 23 ALA OXT O N N 24 ALA H H N N 25 ALA H2 H N N 26 ALA HA H N N 27 ALA HB1 H N N 28 ALA HB2 H N N 29 ALA HB3 H N N 30 ALA HXT H N N 31 ARG N N N N 32 ARG CA C N S 33 ARG C C N N 34 ARG O O N N 35 ARG CB C N N 36 ARG CG C N N 37 ARG CD C N N 38 ARG NE N N N 39 ARG CZ C N N 40 ARG NH1 N N N 41 ARG NH2 N N N 42 ARG OXT O N N 43 ARG H H N N 44 ARG H2 H N N 45 ARG HA H N N 46 ARG HB2 H N N 47 ARG HB3 H N N 48 ARG HG2 H N N 49 ARG HG3 H N N 50 ARG HD2 H N N 51 ARG HD3 H N N 52 ARG HE H N N 53 ARG HH11 H N N 54 ARG HH12 H N N 55 ARG HH21 H N N 56 ARG HH22 H N N 57 ARG HXT H N N 58 ASN N N N N 59 ASN CA C N S 60 ASN C C N N 61 ASN O O N N 62 ASN CB C N N 63 ASN CG C N N 64 ASN OD1 O N N 65 ASN ND2 N N N 66 ASN OXT O N N 67 ASN H H N N 68 ASN H2 H N N 69 ASN HA H N N 70 ASN HB2 H N N 71 ASN HB3 H N N 72 ASN HD21 H N N 73 ASN HD22 H N N 74 ASN HXT H N N 75 ASP N N N N 76 ASP CA C N S 77 ASP C C N N 78 ASP O O N N 79 ASP CB C N N 80 ASP CG C N N 81 ASP OD1 O N N 82 ASP OD2 O N N 83 ASP OXT O N N 84 ASP H H N N 85 ASP H2 H N N 86 ASP HA H N N 87 ASP HB2 H N N 88 ASP HB3 H N N 89 ASP HD2 H N N 90 ASP HXT H N N 91 CYS N N N N 92 CYS CA C N R 93 CYS C C N N 94 CYS O O N N 95 CYS CB C N N 96 CYS SG S N N 97 CYS OXT O N N 98 CYS H H N N 99 CYS H2 H N N 100 CYS HA H N N 101 CYS HB2 H N N 102 CYS HB3 H N N 103 CYS HG H N N 104 CYS HXT H N N 105 DAB N N N N 106 DAB CA C N S 107 DAB C C N N 108 DAB O O N N 109 DAB CB C N N 110 DAB CG C N N 111 DAB ND N N N 112 DAB OXT O N N 113 DAB H H N N 114 DAB H2 H N N 115 DAB HA H N N 116 DAB HB2 H N N 117 DAB HB3 H N N 118 DAB HG2 H N N 119 DAB HG3 H N N 120 DAB HD1 H N N 121 DAB HD2 H N N 122 DAB HXT H N N 123 GLN N N N N 124 GLN CA C N S 125 GLN C C N N 126 GLN O O N N 127 GLN CB C N N 128 GLN CG C N N 129 GLN CD C N N 130 GLN OE1 O N N 131 GLN NE2 N N N 132 GLN OXT O N N 133 GLN H H N N 134 GLN H2 H N N 135 GLN HA H N N 136 GLN HB2 H N N 137 GLN HB3 H N N 138 GLN HG2 H N N 139 GLN HG3 H N N 140 GLN HE21 H N N 141 GLN HE22 H N N 142 GLN HXT H N N 143 GLU N N N N 144 GLU CA C N S 145 GLU C C N N 146 GLU O O N N 147 GLU CB C N N 148 GLU CG C N N 149 GLU CD C N N 150 GLU OE1 O N N 151 GLU OE2 O N N 152 GLU OXT O N N 153 GLU H H N N 154 GLU H2 H N N 155 GLU HA H N N 156 GLU HB2 H N N 157 GLU HB3 H N N 158 GLU HG2 H N N 159 GLU HG3 H N N 160 GLU HE2 H N N 161 GLU HXT H N N 162 GLY N N N N 163 GLY CA C N N 164 GLY C C N N 165 GLY O O N N 166 GLY OXT O N N 167 GLY H H N N 168 GLY H2 H N N 169 GLY HA2 H N N 170 GLY HA3 H N N 171 GLY HXT H N N 172 HIS N N N N 173 HIS CA C N S 174 HIS C C N N 175 HIS O O N N 176 HIS CB C N N 177 HIS CG C Y N 178 HIS ND1 N Y N 179 HIS CD2 C Y N 180 HIS CE1 C Y N 181 HIS NE2 N Y N 182 HIS OXT O N N 183 HIS H H N N 184 HIS H2 H N N 185 HIS HA H N N 186 HIS HB2 H N N 187 HIS HB3 H N N 188 HIS HD1 H N N 189 HIS HD2 H N N 190 HIS HE1 H N N 191 HIS HE2 H N N 192 HIS HXT H N N 193 HYP N N N N 194 HYP CA C N S 195 HYP C C N N 196 HYP O O N N 197 HYP CB C N N 198 HYP CG C N R 199 HYP CD C N N 200 HYP OD1 O N N 201 HYP OXT O N N 202 HYP H H N N 203 HYP HA H N N 204 HYP HB2 H N N 205 HYP HB3 H N N 206 HYP HG H N N 207 HYP HD22 H N N 208 HYP HD23 H N N 209 HYP HD1 H N N 210 HYP HXT H N N 211 ILE N N N N 212 ILE CA C N S 213 ILE C C N N 214 ILE O O N N 215 ILE CB C N S 216 ILE CG1 C N N 217 ILE CG2 C N N 218 ILE CD1 C N N 219 ILE OXT O N N 220 ILE H H N N 221 ILE H2 H N N 222 ILE HA H N N 223 ILE HB H N N 224 ILE HG12 H N N 225 ILE HG13 H N N 226 ILE HG21 H N N 227 ILE HG22 H N N 228 ILE HG23 H N N 229 ILE HD11 H N N 230 ILE HD12 H N N 231 ILE HD13 H N N 232 ILE HXT H N N 233 LE1 O O N N 234 LE1 C C N N 235 LE1 CA C N R 236 LE1 N N N N 237 LE1 CB C N N 238 LE1 C9 C N N 239 LE1 C8 C N N 240 LE1 SG S N N 241 LE1 OXT O N N 242 LE1 HA H N N 243 LE1 H H N N 244 LE1 H2 H N N 245 LE1 H9 H N N 246 LE1 H9A H N N 247 LE1 H9B H N N 248 LE1 H8 H N N 249 LE1 H8A H N N 250 LE1 H8B H N N 251 LE1 HSG H N N 252 LE1 HXT H N N 253 LEU N N N N 254 LEU CA C N S 255 LEU C C N N 256 LEU O O N N 257 LEU CB C N N 258 LEU CG C N N 259 LEU CD1 C N N 260 LEU CD2 C N N 261 LEU OXT O N N 262 LEU H H N N 263 LEU H2 H N N 264 LEU HA H N N 265 LEU HB2 H N N 266 LEU HB3 H N N 267 LEU HG H N N 268 LEU HD11 H N N 269 LEU HD12 H N N 270 LEU HD13 H N N 271 LEU HD21 H N N 272 LEU HD22 H N N 273 LEU HD23 H N N 274 LEU HXT H N N 275 LYS N N N N 276 LYS CA C N S 277 LYS C C N N 278 LYS O O N N 279 LYS CB C N N 280 LYS CG C N N 281 LYS CD C N N 282 LYS CE C N N 283 LYS NZ N N N 284 LYS OXT O N N 285 LYS H H N N 286 LYS H2 H N N 287 LYS HA H N N 288 LYS HB2 H N N 289 LYS HB3 H N N 290 LYS HG2 H N N 291 LYS HG3 H N N 292 LYS HD2 H N N 293 LYS HD3 H N N 294 LYS HE2 H N N 295 LYS HE3 H N N 296 LYS HZ1 H N N 297 LYS HZ2 H N N 298 LYS HZ3 H N N 299 LYS HXT H N N 300 MET N N N N 301 MET CA C N S 302 MET C C N N 303 MET O O N N 304 MET CB C N N 305 MET CG C N N 306 MET SD S N N 307 MET CE C N N 308 MET OXT O N N 309 MET H H N N 310 MET H2 H N N 311 MET HA H N N 312 MET HB2 H N N 313 MET HB3 H N N 314 MET HG2 H N N 315 MET HG3 H N N 316 MET HE1 H N N 317 MET HE2 H N N 318 MET HE3 H N N 319 MET HXT H N N 320 PHE N N N N 321 PHE CA C N S 322 PHE C C N N 323 PHE O O N N 324 PHE CB C N N 325 PHE CG C Y N 326 PHE CD1 C Y N 327 PHE CD2 C Y N 328 PHE CE1 C Y N 329 PHE CE2 C Y N 330 PHE CZ C Y N 331 PHE OXT O N N 332 PHE H H N N 333 PHE H2 H N N 334 PHE HA H N N 335 PHE HB2 H N N 336 PHE HB3 H N N 337 PHE HD1 H N N 338 PHE HD2 H N N 339 PHE HE1 H N N 340 PHE HE2 H N N 341 PHE HZ H N N 342 PHE HXT H N N 343 PRO N N N N 344 PRO CA C N S 345 PRO C C N N 346 PRO O O N N 347 PRO CB C N N 348 PRO CG C N N 349 PRO CD C N N 350 PRO OXT O N N 351 PRO H H N N 352 PRO HA H N N 353 PRO HB2 H N N 354 PRO HB3 H N N 355 PRO HG2 H N N 356 PRO HG3 H N N 357 PRO HD2 H N N 358 PRO HD3 H N N 359 PRO HXT H N N 360 SER N N N N 361 SER CA C N S 362 SER C C N N 363 SER O O N N 364 SER CB C N N 365 SER OG O N N 366 SER OXT O N N 367 SER H H N N 368 SER H2 H N N 369 SER HA H N N 370 SER HB2 H N N 371 SER HB3 H N N 372 SER HG H N N 373 SER HXT H N N 374 THR N N N N 375 THR CA C N S 376 THR C C N N 377 THR O O N N 378 THR CB C N R 379 THR OG1 O N N 380 THR CG2 C N N 381 THR OXT O N N 382 THR H H N N 383 THR H2 H N N 384 THR HA H N N 385 THR HB H N N 386 THR HG1 H N N 387 THR HG21 H N N 388 THR HG22 H N N 389 THR HG23 H N N 390 THR HXT H N N 391 TYR N N N N 392 TYR CA C N S 393 TYR C C N N 394 TYR O O N N 395 TYR CB C N N 396 TYR CG C Y N 397 TYR CD1 C Y N 398 TYR CD2 C Y N 399 TYR CE1 C Y N 400 TYR CE2 C Y N 401 TYR CZ C Y N 402 TYR OH O N N 403 TYR OXT O N N 404 TYR H H N N 405 TYR H2 H N N 406 TYR HA H N N 407 TYR HB2 H N N 408 TYR HB3 H N N 409 TYR HD1 H N N 410 TYR HD2 H N N 411 TYR HE1 H N N 412 TYR HE2 H N N 413 TYR HH H N N 414 TYR HXT H N N 415 VAL N N N N 416 VAL CA C N S 417 VAL C C N N 418 VAL O O N N 419 VAL CB C N N 420 VAL CG1 C N N 421 VAL CG2 C N N 422 VAL OXT O N N 423 VAL H H N N 424 VAL H2 H N N 425 VAL HA H N N 426 VAL HB H N N 427 VAL HG11 H N N 428 VAL HG12 H N N 429 VAL HG13 H N N 430 VAL HG21 H N N 431 VAL HG22 H N N 432 VAL HG23 H N N 433 VAL HXT H N N 434 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 4FO CG NZ sing N N 1 4FO CG CB sing N N 2 4FO N CA sing N N 3 4FO CA CB sing N N 4 4FO CA C sing N N 5 4FO C O doub N N 6 4FO C OXT sing N N 7 4FO N H sing N N 8 4FO N H2 sing N N 9 4FO CA HA sing N N 10 4FO CB HB2 sing N N 11 4FO CB HB3 sing N N 12 4FO CG HG3 sing N N 13 4FO CG HG2 sing N N 14 4FO NZ HZ3 sing N N 15 4FO NZ HZ2 sing N N 16 4FO OXT HXT sing N N 17 ALA N CA sing N N 18 ALA N H sing N N 19 ALA N H2 sing N N 20 ALA CA C sing N N 21 ALA CA CB sing N N 22 ALA CA HA sing N N 23 ALA C O doub N N 24 ALA C OXT sing N N 25 ALA CB HB1 sing N N 26 ALA CB HB2 sing N N 27 ALA CB HB3 sing N N 28 ALA OXT HXT sing N N 29 ARG N CA sing N N 30 ARG N H sing N N 31 ARG N H2 sing N N 32 ARG CA C sing N N 33 ARG CA CB sing N N 34 ARG CA HA sing N N 35 ARG C O doub N N 36 ARG C OXT sing N N 37 ARG CB CG sing N N 38 ARG CB HB2 sing N N 39 ARG CB HB3 sing N N 40 ARG CG CD sing N N 41 ARG CG HG2 sing N N 42 ARG CG HG3 sing N N 43 ARG CD NE sing N N 44 ARG CD HD2 sing N N 45 ARG CD HD3 sing N N 46 ARG NE CZ sing N N 47 ARG NE HE sing N N 48 ARG CZ NH1 sing N N 49 ARG CZ NH2 doub N N 50 ARG NH1 HH11 sing N N 51 ARG NH1 HH12 sing N N 52 ARG NH2 HH21 sing N N 53 ARG NH2 HH22 sing N N 54 ARG OXT HXT sing N N 55 ASN N CA sing N N 56 ASN N H sing N N 57 ASN N H2 sing N N 58 ASN CA C sing N N 59 ASN CA CB sing N N 60 ASN CA HA sing N N 61 ASN C O doub N N 62 ASN C OXT sing N N 63 ASN CB CG sing N N 64 ASN CB HB2 sing N N 65 ASN CB HB3 sing N N 66 ASN CG OD1 doub N N 67 ASN CG ND2 sing N N 68 ASN ND2 HD21 sing N N 69 ASN ND2 HD22 sing N N 70 ASN OXT HXT sing N N 71 ASP N CA sing N N 72 ASP N H sing N N 73 ASP N H2 sing N N 74 ASP CA C sing N N 75 ASP CA CB sing N N 76 ASP CA HA sing N N 77 ASP C O doub N N 78 ASP C OXT sing N N 79 ASP CB CG sing N N 80 ASP CB HB2 sing N N 81 ASP CB HB3 sing N N 82 ASP CG OD1 doub N N 83 ASP CG OD2 sing N N 84 ASP OD2 HD2 sing N N 85 ASP OXT HXT sing N N 86 CYS N CA sing N N 87 CYS N H sing N N 88 CYS N H2 sing N N 89 CYS CA C sing N N 90 CYS CA CB sing N N 91 CYS CA HA sing N N 92 CYS C O doub N N 93 CYS C OXT sing N N 94 CYS CB SG sing N N 95 CYS CB HB2 sing N N 96 CYS CB HB3 sing N N 97 CYS SG HG sing N N 98 CYS OXT HXT sing N N 99 DAB N CA sing N N 100 DAB N H sing N N 101 DAB N H2 sing N N 102 DAB CA C sing N N 103 DAB CA CB sing N N 104 DAB CA HA sing N N 105 DAB C O doub N N 106 DAB C OXT sing N N 107 DAB CB CG sing N N 108 DAB CB HB2 sing N N 109 DAB CB HB3 sing N N 110 DAB CG ND sing N N 111 DAB CG HG2 sing N N 112 DAB CG HG3 sing N N 113 DAB ND HD1 sing N N 114 DAB ND HD2 sing N N 115 DAB OXT HXT sing N N 116 GLN N CA sing N N 117 GLN N H sing N N 118 GLN N H2 sing N N 119 GLN CA C sing N N 120 GLN CA CB sing N N 121 GLN CA HA sing N N 122 GLN C O doub N N 123 GLN C OXT sing N N 124 GLN CB CG sing N N 125 GLN CB HB2 sing N N 126 GLN CB HB3 sing N N 127 GLN CG CD sing N N 128 GLN CG HG2 sing N N 129 GLN CG HG3 sing N N 130 GLN CD OE1 doub N N 131 GLN CD NE2 sing N N 132 GLN NE2 HE21 sing N N 133 GLN NE2 HE22 sing N N 134 GLN OXT HXT sing N N 135 GLU N CA sing N N 136 GLU N H sing N N 137 GLU N H2 sing N N 138 GLU CA C sing N N 139 GLU CA CB sing N N 140 GLU CA HA sing N N 141 GLU C O doub N N 142 GLU C OXT sing N N 143 GLU CB CG sing N N 144 GLU CB HB2 sing N N 145 GLU CB HB3 sing N N 146 GLU CG CD sing N N 147 GLU CG HG2 sing N N 148 GLU CG HG3 sing N N 149 GLU CD OE1 doub N N 150 GLU CD OE2 sing N N 151 GLU OE2 HE2 sing N N 152 GLU OXT HXT sing N N 153 GLY N CA sing N N 154 GLY N H sing N N 155 GLY N H2 sing N N 156 GLY CA C sing N N 157 GLY CA HA2 sing N N 158 GLY CA HA3 sing N N 159 GLY C O doub N N 160 GLY C OXT sing N N 161 GLY OXT HXT sing N N 162 HIS N CA sing N N 163 HIS N H sing N N 164 HIS N H2 sing N N 165 HIS CA C sing N N 166 HIS CA CB sing N N 167 HIS CA HA sing N N 168 HIS C O doub N N 169 HIS C OXT sing N N 170 HIS CB CG sing N N 171 HIS CB HB2 sing N N 172 HIS CB HB3 sing N N 173 HIS CG ND1 sing Y N 174 HIS CG CD2 doub Y N 175 HIS ND1 CE1 doub Y N 176 HIS ND1 HD1 sing N N 177 HIS CD2 NE2 sing Y N 178 HIS CD2 HD2 sing N N 179 HIS CE1 NE2 sing Y N 180 HIS CE1 HE1 sing N N 181 HIS NE2 HE2 sing N N 182 HIS OXT HXT sing N N 183 HYP N CA sing N N 184 HYP N CD sing N N 185 HYP N H sing N N 186 HYP CA C sing N N 187 HYP CA CB sing N N 188 HYP CA HA sing N N 189 HYP C O doub N N 190 HYP C OXT sing N N 191 HYP CB CG sing N N 192 HYP CB HB2 sing N N 193 HYP CB HB3 sing N N 194 HYP CG CD sing N N 195 HYP CG OD1 sing N N 196 HYP CG HG sing N N 197 HYP CD HD22 sing N N 198 HYP CD HD23 sing N N 199 HYP OD1 HD1 sing N N 200 HYP OXT HXT sing N N 201 ILE N CA sing N N 202 ILE N H sing N N 203 ILE N H2 sing N N 204 ILE CA C sing N N 205 ILE CA CB sing N N 206 ILE CA HA sing N N 207 ILE C O doub N N 208 ILE C OXT sing N N 209 ILE CB CG1 sing N N 210 ILE CB CG2 sing N N 211 ILE CB HB sing N N 212 ILE CG1 CD1 sing N N 213 ILE CG1 HG12 sing N N 214 ILE CG1 HG13 sing N N 215 ILE CG2 HG21 sing N N 216 ILE CG2 HG22 sing N N 217 ILE CG2 HG23 sing N N 218 ILE CD1 HD11 sing N N 219 ILE CD1 HD12 sing N N 220 ILE CD1 HD13 sing N N 221 ILE OXT HXT sing N N 222 LE1 O C doub N N 223 LE1 C OXT sing N N 224 LE1 CA C sing N N 225 LE1 CA CB sing N N 226 LE1 CA HA sing N N 227 LE1 N CA sing N N 228 LE1 N H sing N N 229 LE1 N H2 sing N N 230 LE1 CB C9 sing N N 231 LE1 CB C8 sing N N 232 LE1 C9 H9 sing N N 233 LE1 C9 H9A sing N N 234 LE1 C9 H9B sing N N 235 LE1 C8 H8 sing N N 236 LE1 C8 H8A sing N N 237 LE1 C8 H8B sing N N 238 LE1 SG CB sing N N 239 LE1 SG HSG sing N N 240 LE1 OXT HXT sing N N 241 LEU N CA sing N N 242 LEU N H sing N N 243 LEU N H2 sing N N 244 LEU CA C sing N N 245 LEU CA CB sing N N 246 LEU CA HA sing N N 247 LEU C O doub N N 248 LEU C OXT sing N N 249 LEU CB CG sing N N 250 LEU CB HB2 sing N N 251 LEU CB HB3 sing N N 252 LEU CG CD1 sing N N 253 LEU CG CD2 sing N N 254 LEU CG HG sing N N 255 LEU CD1 HD11 sing N N 256 LEU CD1 HD12 sing N N 257 LEU CD1 HD13 sing N N 258 LEU CD2 HD21 sing N N 259 LEU CD2 HD22 sing N N 260 LEU CD2 HD23 sing N N 261 LEU OXT HXT sing N N 262 LYS N CA sing N N 263 LYS N H sing N N 264 LYS N H2 sing N N 265 LYS CA C sing N N 266 LYS CA CB sing N N 267 LYS CA HA sing N N 268 LYS C O doub N N 269 LYS C OXT sing N N 270 LYS CB CG sing N N 271 LYS CB HB2 sing N N 272 LYS CB HB3 sing N N 273 LYS CG CD sing N N 274 LYS CG HG2 sing N N 275 LYS CG HG3 sing N N 276 LYS CD CE sing N N 277 LYS CD HD2 sing N N 278 LYS CD HD3 sing N N 279 LYS CE NZ sing N N 280 LYS CE HE2 sing N N 281 LYS CE HE3 sing N N 282 LYS NZ HZ1 sing N N 283 LYS NZ HZ2 sing N N 284 LYS NZ HZ3 sing N N 285 LYS OXT HXT sing N N 286 MET N CA sing N N 287 MET N H sing N N 288 MET N H2 sing N N 289 MET CA C sing N N 290 MET CA CB sing N N 291 MET CA HA sing N N 292 MET C O doub N N 293 MET C OXT sing N N 294 MET CB CG sing N N 295 MET CB HB2 sing N N 296 MET CB HB3 sing N N 297 MET CG SD sing N N 298 MET CG HG2 sing N N 299 MET CG HG3 sing N N 300 MET SD CE sing N N 301 MET CE HE1 sing N N 302 MET CE HE2 sing N N 303 MET CE HE3 sing N N 304 MET OXT HXT sing N N 305 PHE N CA sing N N 306 PHE N H sing N N 307 PHE N H2 sing N N 308 PHE CA C sing N N 309 PHE CA CB sing N N 310 PHE CA HA sing N N 311 PHE C O doub N N 312 PHE C OXT sing N N 313 PHE CB CG sing N N 314 PHE CB HB2 sing N N 315 PHE CB HB3 sing N N 316 PHE CG CD1 doub Y N 317 PHE CG CD2 sing Y N 318 PHE CD1 CE1 sing Y N 319 PHE CD1 HD1 sing N N 320 PHE CD2 CE2 doub Y N 321 PHE CD2 HD2 sing N N 322 PHE CE1 CZ doub Y N 323 PHE CE1 HE1 sing N N 324 PHE CE2 CZ sing Y N 325 PHE CE2 HE2 sing N N 326 PHE CZ HZ sing N N 327 PHE OXT HXT sing N N 328 PRO N CA sing N N 329 PRO N CD sing N N 330 PRO N H sing N N 331 PRO CA C sing N N 332 PRO CA CB sing N N 333 PRO CA HA sing N N 334 PRO C O doub N N 335 PRO C OXT sing N N 336 PRO CB CG sing N N 337 PRO CB HB2 sing N N 338 PRO CB HB3 sing N N 339 PRO CG CD sing N N 340 PRO CG HG2 sing N N 341 PRO CG HG3 sing N N 342 PRO CD HD2 sing N N 343 PRO CD HD3 sing N N 344 PRO OXT HXT sing N N 345 SER N CA sing N N 346 SER N H sing N N 347 SER N H2 sing N N 348 SER CA C sing N N 349 SER CA CB sing N N 350 SER CA HA sing N N 351 SER C O doub N N 352 SER C OXT sing N N 353 SER CB OG sing N N 354 SER CB HB2 sing N N 355 SER CB HB3 sing N N 356 SER OG HG sing N N 357 SER OXT HXT sing N N 358 THR N CA sing N N 359 THR N H sing N N 360 THR N H2 sing N N 361 THR CA C sing N N 362 THR CA CB sing N N 363 THR CA HA sing N N 364 THR C O doub N N 365 THR C OXT sing N N 366 THR CB OG1 sing N N 367 THR CB CG2 sing N N 368 THR CB HB sing N N 369 THR OG1 HG1 sing N N 370 THR CG2 HG21 sing N N 371 THR CG2 HG22 sing N N 372 THR CG2 HG23 sing N N 373 THR OXT HXT sing N N 374 TYR N CA sing N N 375 TYR N H sing N N 376 TYR N H2 sing N N 377 TYR CA C sing N N 378 TYR CA CB sing N N 379 TYR CA HA sing N N 380 TYR C O doub N N 381 TYR C OXT sing N N 382 TYR CB CG sing N N 383 TYR CB HB2 sing N N 384 TYR CB HB3 sing N N 385 TYR CG CD1 doub Y N 386 TYR CG CD2 sing Y N 387 TYR CD1 CE1 sing Y N 388 TYR CD1 HD1 sing N N 389 TYR CD2 CE2 doub Y N 390 TYR CD2 HD2 sing N N 391 TYR CE1 CZ doub Y N 392 TYR CE1 HE1 sing N N 393 TYR CE2 CZ sing Y N 394 TYR CE2 HE2 sing N N 395 TYR CZ OH sing N N 396 TYR OH HH sing N N 397 TYR OXT HXT sing N N 398 VAL N CA sing N N 399 VAL N H sing N N 400 VAL N H2 sing N N 401 VAL CA C sing N N 402 VAL CA CB sing N N 403 VAL CA HA sing N N 404 VAL C O doub N N 405 VAL C OXT sing N N 406 VAL CB CG1 sing N N 407 VAL CB CG2 sing N N 408 VAL CB HB sing N N 409 VAL CG1 HG11 sing N N 410 VAL CG1 HG12 sing N N 411 VAL CG1 HG13 sing N N 412 VAL CG2 HG21 sing N N 413 VAL CG2 HG22 sing N N 414 VAL CG2 HG23 sing N N 415 VAL OXT HXT sing N N 416 # _pdbx_audit_support.funding_organization Innosuisse _pdbx_audit_support.country 'European Union' _pdbx_audit_support.grant_number '33285.1 IP-LS' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 LE1 ? ? LE1 ? ? 'SUBJECT OF INVESTIGATION' ? 2 HYP ? ? HYP ? ? 'SUBJECT OF INVESTIGATION' ? 3 DAB ? ? DAB ? ? 'SUBJECT OF INVESTIGATION' ? 4 4FO ? ? 4FO ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ? #