data_8BV9 # _entry.id 8BV9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8BV9 pdb_00008bv9 10.2210/pdb8bv9/pdb WWPDB D_1292127184 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2023-10-18 ? 2 'Structure model' 1 1 2023-10-25 ? 3 'Structure model' 1 2 2024-10-23 ? 4 'Structure model' 2 0 2025-11-05 ? # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' author 'Coordinate replacement' 'Chirality error' 'The most important reason for the correction is the Cis/Trans isomer of Pro79.' # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' Advisory 4 4 'Structure model' 'Atomic model' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Non-polymer description' 9 4 'Structure model' Other 10 4 'Structure model' 'Polymer sequence' 11 4 'Structure model' 'Refinement description' 12 4 'Structure model' 'Source and taxonomy' 13 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation_author 2 3 'Structure model' pdbx_entry_details 3 3 'Structure model' pdbx_modification_feature 4 4 'Structure model' atom_site 5 4 'Structure model' atom_site_anisotrop 6 4 'Structure model' atom_sites 7 4 'Structure model' chem_comp 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond 10 4 'Structure model' entity 11 4 'Structure model' entity_poly 12 4 'Structure model' entity_poly_seq 13 4 'Structure model' entity_src_gen 14 4 'Structure model' pdbx_contact_author 15 4 'Structure model' pdbx_entity_nonpoly 16 4 'Structure model' pdbx_modification_feature 17 4 'Structure model' pdbx_nonpoly_scheme 18 4 'Structure model' pdbx_poly_seq_scheme 19 4 'Structure model' pdbx_refine_tls 20 4 'Structure model' pdbx_refine_tls_group 21 4 'Structure model' pdbx_struct_assembly_gen 22 4 'Structure model' pdbx_struct_assembly_prop 23 4 'Structure model' pdbx_struct_sheet_hbond 24 4 'Structure model' pdbx_unobs_or_zero_occ_residues 25 4 'Structure model' pdbx_validate_close_contact 26 4 'Structure model' pdbx_validate_peptide_omega 27 4 'Structure model' pdbx_validate_planes 28 4 'Structure model' pdbx_validate_symm_contact 29 4 'Structure model' pdbx_validate_torsion 30 4 'Structure model' refine 31 4 'Structure model' refine_hist 32 4 'Structure model' refine_ls_restr 33 4 'Structure model' refine_ls_shell 34 4 'Structure model' reflns 35 4 'Structure model' software 36 4 'Structure model' struct_asym 37 4 'Structure model' struct_conf 38 4 'Structure model' struct_conn 39 4 'Structure model' struct_mon_prot_cis 40 4 'Structure model' struct_ref 41 4 'Structure model' struct_ref_seq 42 4 'Structure model' struct_ref_seq_dif 43 4 'Structure model' struct_sheet_range # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation_author.identifier_ORCID' 2 3 'Structure model' '_pdbx_entry_details.has_protein_modification' 3 4 'Structure model' '_atom_sites.fract_transf_matrix[2][1]' 4 4 'Structure model' '_atom_sites.fract_transf_matrix[3][2]' 5 4 'Structure model' '_chem_comp.formula' 6 4 'Structure model' '_chem_comp.formula_weight' 7 4 'Structure model' '_chem_comp.id' 8 4 'Structure model' '_chem_comp.mon_nstd_flag' 9 4 'Structure model' '_chem_comp.name' 10 4 'Structure model' '_chem_comp.pdbx_synonyms' 11 4 'Structure model' '_chem_comp.type' 12 4 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 13 4 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 14 4 'Structure model' '_entity_src_gen.pdbx_end_seq_num' 15 4 'Structure model' '_pdbx_modification_feature.label_seq_id' 16 4 'Structure model' '_pdbx_modification_feature.modified_residue_label_seq_id' 17 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 18 4 'Structure model' '_pdbx_struct_assembly_prop.value' 19 4 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_seq_id' 20 4 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_comp_id' 21 4 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_seq_id' 22 4 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_comp_id' 23 4 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_seq_id' 24 4 'Structure model' '_refine.B_iso_mean' 25 4 'Structure model' '_refine.aniso_B[1][1]' 26 4 'Structure model' '_refine.aniso_B[1][3]' 27 4 'Structure model' '_refine.aniso_B[2][2]' 28 4 'Structure model' '_refine.aniso_B[3][3]' 29 4 'Structure model' '_refine.correlation_coeff_Fo_to_Fc' 30 4 'Structure model' '_refine.correlation_coeff_Fo_to_Fc_free' 31 4 'Structure model' '_refine.details' 32 4 'Structure model' '_refine.ls_R_factor_R_free' 33 4 'Structure model' '_refine.ls_R_factor_R_work' 34 4 'Structure model' '_refine.ls_R_factor_all' 35 4 'Structure model' '_refine.ls_R_factor_obs' 36 4 'Structure model' '_refine.ls_d_res_high' 37 4 'Structure model' '_refine.ls_d_res_low' 38 4 'Structure model' '_refine.ls_number_reflns_R_free' 39 4 'Structure model' '_refine.ls_number_reflns_R_work' 40 4 'Structure model' '_refine.ls_number_reflns_obs' 41 4 'Structure model' '_refine.ls_percent_reflns_R_free' 42 4 'Structure model' '_refine.ls_percent_reflns_obs' 43 4 'Structure model' '_refine.overall_SU_B' 44 4 'Structure model' '_refine.overall_SU_ML' 45 4 'Structure model' '_refine.pdbx_overall_ESU_R' 46 4 'Structure model' '_refine.pdbx_overall_ESU_R_Free' 47 4 'Structure model' '_refine.pdbx_solvent_vdw_probe_radii' 48 4 'Structure model' '_refine.pdbx_stereochemistry_target_values' 49 4 'Structure model' '_refine.solvent_model_details' 50 4 'Structure model' '_refine_hist.d_res_high' 51 4 'Structure model' '_refine_hist.d_res_low' 52 4 'Structure model' '_refine_hist.number_atoms_solvent' 53 4 'Structure model' '_refine_hist.number_atoms_total' 54 4 'Structure model' '_refine_hist.pdbx_number_atoms_ligand' 55 4 'Structure model' '_reflns.d_resolution_low' 56 4 'Structure model' '_software.version' 57 4 'Structure model' '_struct_conf.beg_label_seq_id' 58 4 'Structure model' '_struct_conf.end_label_seq_id' 59 4 'Structure model' '_struct_conn.pdbx_dist_value' 60 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 61 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 62 4 'Structure model' '_struct_ref.pdbx_align_begin' 63 4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 64 4 'Structure model' '_struct_ref_seq.db_align_beg' 65 4 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_beg' 66 4 'Structure model' '_struct_ref_seq.seq_align_end' 67 4 'Structure model' '_struct_sheet_range.beg_label_seq_id' 68 4 'Structure model' '_struct_sheet_range.end_auth_comp_id' 69 4 'Structure model' '_struct_sheet_range.end_auth_seq_id' 70 4 'Structure model' '_struct_sheet_range.end_label_comp_id' 71 4 'Structure model' '_struct_sheet_range.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8BV9 _pdbx_database_status.recvd_initial_deposition_date 2023-01-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email jgavira@iact.ugr-csic.es _pdbx_contact_author.name_first Jose _pdbx_contact_author.name_last Gavira _pdbx_contact_author.name_mi A _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7386-6484 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gavira, J.A.' 1 0000-0002-7386-6484 'Martinez-Rodriguez, S.' 2 0000-0001-6675-1550 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 682 _citation.language ? _citation.page_first 85 _citation.page_last 90 _citation.title 'First 3-D structural evidence of a native-like intertwined dimer in the acylphosphatase family.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2023.09.053 _citation.pdbx_database_id_PubMed 37804591 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Martinez-Rodriguez, S.' 1 0000-0001-6675-1550 primary 'Camara-Artigas, A.' 2 ? primary 'Gavira, J.A.' 3 0000-0002-7386-6484 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Acylphosphatase 10425.834 1 3.6.1.7 ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 3 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 4 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Acylphosphate phosphohydrolase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SKVCIIAWVYGRVQGVGFRYTTQYEAKRLGLTGYAKNLDDGSVEVVACGEEGQVEKLMQWLKSGGPRSARVERVLSEPHH PSGELTDFRIRLE ; _entity_poly.pdbx_seq_one_letter_code_can ;SKVCIIAWVYGRVQGVGFRYTTQYEAKRLGLTGYAKNLDDGSVEVVACGEEGQVEKLMQWLKSGGPRSARVERVLSEPHH PSGELTDFRIRLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 'SULFATE ION' SO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LYS n 1 3 VAL n 1 4 CYS n 1 5 ILE n 1 6 ILE n 1 7 ALA n 1 8 TRP n 1 9 VAL n 1 10 TYR n 1 11 GLY n 1 12 ARG n 1 13 VAL n 1 14 GLN n 1 15 GLY n 1 16 VAL n 1 17 GLY n 1 18 PHE n 1 19 ARG n 1 20 TYR n 1 21 THR n 1 22 THR n 1 23 GLN n 1 24 TYR n 1 25 GLU n 1 26 ALA n 1 27 LYS n 1 28 ARG n 1 29 LEU n 1 30 GLY n 1 31 LEU n 1 32 THR n 1 33 GLY n 1 34 TYR n 1 35 ALA n 1 36 LYS n 1 37 ASN n 1 38 LEU n 1 39 ASP n 1 40 ASP n 1 41 GLY n 1 42 SER n 1 43 VAL n 1 44 GLU n 1 45 VAL n 1 46 VAL n 1 47 ALA n 1 48 CYS n 1 49 GLY n 1 50 GLU n 1 51 GLU n 1 52 GLY n 1 53 GLN n 1 54 VAL n 1 55 GLU n 1 56 LYS n 1 57 LEU n 1 58 MET n 1 59 GLN n 1 60 TRP n 1 61 LEU n 1 62 LYS n 1 63 SER n 1 64 GLY n 1 65 GLY n 1 66 PRO n 1 67 ARG n 1 68 SER n 1 69 ALA n 1 70 ARG n 1 71 VAL n 1 72 GLU n 1 73 ARG n 1 74 VAL n 1 75 LEU n 1 76 SER n 1 77 GLU n 1 78 PRO n 1 79 HIS n 1 80 HIS n 1 81 PRO n 1 82 SER n 1 83 GLY n 1 84 GLU n 1 85 LEU n 1 86 THR n 1 87 ASP n 1 88 PHE n 1 89 ARG n 1 90 ILE n 1 91 ARG n 1 92 LEU n 1 93 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 93 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'yccX, Z1320, ECs1052' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-22b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 2 2 SER SER A . n A 1 2 LYS 2 3 3 LYS LYS A . n A 1 3 VAL 3 4 4 VAL VAL A . n A 1 4 CYS 4 5 5 CYS CYS A . n A 1 5 ILE 5 6 6 ILE ILE A . n A 1 6 ILE 6 7 7 ILE ILE A . n A 1 7 ALA 7 8 8 ALA ALA A . n A 1 8 TRP 8 9 9 TRP TRP A . n A 1 9 VAL 9 10 10 VAL VAL A . n A 1 10 TYR 10 11 11 TYR TYR A . n A 1 11 GLY 11 12 12 GLY GLY A . n A 1 12 ARG 12 13 13 ARG ARG A . n A 1 13 VAL 13 14 14 VAL VAL A . n A 1 14 GLN 14 15 15 GLN GLN A . n A 1 15 GLY 15 16 16 GLY GLY A . n A 1 16 VAL 16 17 17 VAL VAL A . n A 1 17 GLY 17 18 18 GLY GLY A . n A 1 18 PHE 18 19 19 PHE PHE A . n A 1 19 ARG 19 20 20 ARG ARG A . n A 1 20 TYR 20 21 21 TYR TYR A . n A 1 21 THR 21 22 22 THR THR A . n A 1 22 THR 22 23 23 THR THR A . n A 1 23 GLN 23 24 24 GLN GLN A . n A 1 24 TYR 24 25 25 TYR TYR A . n A 1 25 GLU 25 26 26 GLU GLU A . n A 1 26 ALA 26 27 27 ALA ALA A . n A 1 27 LYS 27 28 28 LYS LYS A . n A 1 28 ARG 28 29 29 ARG ARG A . n A 1 29 LEU 29 30 30 LEU LEU A . n A 1 30 GLY 30 31 31 GLY GLY A . n A 1 31 LEU 31 32 32 LEU LEU A . n A 1 32 THR 32 33 33 THR THR A . n A 1 33 GLY 33 34 34 GLY GLY A . n A 1 34 TYR 34 35 35 TYR TYR A . n A 1 35 ALA 35 36 36 ALA ALA A . n A 1 36 LYS 36 37 37 LYS LYS A . n A 1 37 ASN 37 38 38 ASN ASN A . n A 1 38 LEU 38 39 39 LEU LEU A . n A 1 39 ASP 39 40 40 ASP ASP A . n A 1 40 ASP 40 41 41 ASP ASP A . n A 1 41 GLY 41 42 42 GLY GLY A . n A 1 42 SER 42 43 43 SER SER A . n A 1 43 VAL 43 44 44 VAL VAL A . n A 1 44 GLU 44 45 45 GLU GLU A . n A 1 45 VAL 45 46 46 VAL VAL A . n A 1 46 VAL 46 47 47 VAL VAL A . n A 1 47 ALA 47 48 48 ALA ALA A . n A 1 48 CYS 48 49 49 CYS CYS A . n A 1 49 GLY 49 50 50 GLY GLY A . n A 1 50 GLU 50 51 51 GLU GLU A . n A 1 51 GLU 51 52 52 GLU GLU A . n A 1 52 GLY 52 53 53 GLY GLY A . n A 1 53 GLN 53 54 54 GLN GLN A . n A 1 54 VAL 54 55 55 VAL VAL A . n A 1 55 GLU 55 56 56 GLU GLU A . n A 1 56 LYS 56 57 57 LYS LYS A . n A 1 57 LEU 57 58 58 LEU LEU A . n A 1 58 MET 58 59 59 MET MET A . n A 1 59 GLN 59 60 60 GLN GLN A . n A 1 60 TRP 60 61 61 TRP TRP A . n A 1 61 LEU 61 62 62 LEU LEU A . n A 1 62 LYS 62 63 63 LYS LYS A . n A 1 63 SER 63 64 64 SER SER A . n A 1 64 GLY 64 65 65 GLY GLY A . n A 1 65 GLY 65 66 66 GLY GLY A . n A 1 66 PRO 66 67 67 PRO PRO A . n A 1 67 ARG 67 68 68 ARG ARG A . n A 1 68 SER 68 69 69 SER SER A . n A 1 69 ALA 69 70 70 ALA ALA A . n A 1 70 ARG 70 71 71 ARG ARG A . n A 1 71 VAL 71 72 72 VAL VAL A . n A 1 72 GLU 72 73 73 GLU GLU A . n A 1 73 ARG 73 74 74 ARG ARG A . n A 1 74 VAL 74 75 75 VAL VAL A . n A 1 75 LEU 75 76 76 LEU LEU A . n A 1 76 SER 76 77 77 SER SER A . n A 1 77 GLU 77 78 78 GLU GLU A . n A 1 78 PRO 78 79 79 PRO PRO A . n A 1 79 HIS 79 80 80 HIS HIS A . n A 1 80 HIS 80 81 81 HIS HIS A . n A 1 81 PRO 81 82 82 PRO PRO A . n A 1 82 SER 82 83 83 SER SER A . n A 1 83 GLY 83 84 84 GLY GLY A . n A 1 84 GLU 84 85 85 GLU GLU A . n A 1 85 LEU 85 86 86 LEU LEU A . n A 1 86 THR 86 87 87 THR THR A . n A 1 87 ASP 87 88 88 ASP ASP A . n A 1 88 PHE 88 89 89 PHE PHE A . n A 1 89 ARG 89 90 90 ARG ARG A . n A 1 90 ILE 90 91 91 ILE ILE A . n A 1 91 ARG 91 92 92 ARG ARG A . n A 1 92 LEU 92 93 93 LEU LEU A . n A 1 93 GLU 93 94 94 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 101 102 EDO EDO A . C 2 EDO 1 102 103 EDO EDO A . D 2 EDO 1 103 104 EDO EDO A . E 3 SO4 1 104 1 SO4 SO4 A . F 3 SO4 1 105 2 SO4 SO4 A . G 3 SO4 1 106 3 SO4 SO4 A . H 4 HOH 1 201 1 HOH HOH A . H 4 HOH 2 202 8 HOH HOH A . H 4 HOH 3 203 4 HOH HOH A . H 4 HOH 4 204 10 HOH HOH A . H 4 HOH 5 205 6 HOH HOH A . H 4 HOH 6 206 9 HOH HOH A . H 4 HOH 7 207 5 HOH HOH A . H 4 HOH 8 208 2 HOH HOH A . H 4 HOH 9 209 7 HOH HOH A . H 4 HOH 10 210 3 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0431 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8BV9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 40.415 _cell.length_a_esd ? _cell.length_b 81.944 _cell.length_b_esd ? _cell.length_c 63.994 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8BV9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 21 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8BV9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.4 _exptl_crystal.description Neddle _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M AS 30% w/v PEG4K' _exptl_crystal_grow.pdbx_pH_range 4.0-9.0 _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-11-18 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator Si _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9677 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9677 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-3 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 68.94 _reflns.entry_id 8BV9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.55 _reflns.d_resolution_low 41.97 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3631 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.109 _reflns.pdbx_Rpim_I_all 0.053 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.094 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.55 _reflns_shell.d_res_low 2.67 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 431 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.44 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.981 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -1.259 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 2.055 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -0.796 _refine.B_iso_max ? _refine.B_iso_mean 67.180 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.954 _refine.correlation_coeff_Fo_to_Fc_free 0.946 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8BV9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.552 _refine.ls_d_res_low 41.006 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3630 _refine.ls_number_reflns_R_free 162 _refine.ls_number_reflns_R_work 3468 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.534 _refine.ls_percent_reflns_R_free 4.463 _refine.ls_R_factor_all 0.208 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2782 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2049 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.953 _refine.pdbx_overall_ESU_R_Free 0.349 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 12.890 _refine.overall_SU_ML 0.262 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.552 _refine_hist.d_res_low 41.006 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 769 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 732 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.012 807 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 773 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 1.675 1.862 1085 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.548 1.783 1773 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 7.316 5.000 100 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 8.118 5.000 11 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 14.795 10.000 143 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 12.575 10.000 38 ? r_dihedral_angle_6_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.068 0.200 114 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 978 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 202 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? 0.193 0.200 117 ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.195 0.200 599 ? r_symmetry_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.171 0.200 347 ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.081 0.200 421 ? r_symmetry_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? 0.122 0.200 13 ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.148 0.200 34 ? r_symmetry_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.161 0.200 75 ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.366 0.200 7 ? r_symmetry_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.023 0.200 3 ? r_xyhbond_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 6.033 6.167 385 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 5.988 6.168 385 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 8.538 11.120 484 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 8.544 11.123 485 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 7.780 7.380 422 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 7.593 7.283 411 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? 11.988 13.150 599 ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 11.710 12.975 582 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 15.205 66.988 815 ? r_lrange_it ? ? ? 'X-RAY DIFFRACTION' ? 15.196 66.981 816 ? r_lrange_other ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.552 2.618 257 . 17 238 99.2218 . 0.338 . . 0.336 . . . . . 0.306 . . . . . 20 . 0.933 0.917 0.365 'X-RAY DIFFRACTION' 2.618 2.689 269 . 11 258 100.0000 . 0.322 . . 0.311 . . . . . 0.271 . . . . . 20 . 0.936 0.788 0.652 'X-RAY DIFFRACTION' 2.689 2.767 232 . 13 218 99.5690 . 0.306 . . 0.298 . . . . . 0.260 . . . . . 20 . 0.943 0.840 0.452 'X-RAY DIFFRACTION' 2.767 2.851 256 . 11 244 99.6094 . 0.296 . . 0.297 . . . . . 0.241 . . . . . 20 . 0.937 0.946 0.278 'X-RAY DIFFRACTION' 2.851 2.944 237 . 5 231 99.5781 . 0.303 . . 0.302 . . . . . 0.241 . . . . . 20 . 0.937 0.938 0.331 'X-RAY DIFFRACTION' 2.944 3.047 232 . 10 220 99.1379 . 0.252 . . 0.242 . . . . . 0.203 . . . . . 20 . 0.959 0.921 0.497 'X-RAY DIFFRACTION' 3.047 3.162 217 . 9 206 99.0783 . 0.245 . . 0.239 . . . . . 0.204 . . . . . 20 . 0.958 0.919 0.379 'X-RAY DIFFRACTION' 3.162 3.290 218 . 12 205 99.5413 . 0.204 . . 0.198 . . . . . 0.171 . . . . . 20 . 0.974 0.945 0.319 'X-RAY DIFFRACTION' 3.290 3.435 206 . 7 197 99.0291 . 0.197 . . 0.200 . . . . . 0.193 . . . . . 20 . 0.972 0.995 0.112 'X-RAY DIFFRACTION' 3.435 3.602 199 . 8 183 95.9799 . 0.214 . . 0.209 . . . . . 0.191 . . . . . 20 . 0.971 0.898 0.339 'X-RAY DIFFRACTION' 3.602 3.795 187 . 9 161 90.9091 . 0.187 . . 0.185 . . . . . 0.188 . . . . . 20 . 0.984 0.974 0.222 'X-RAY DIFFRACTION' 3.795 4.023 180 . 7 171 98.8889 . 0.218 . . 0.213 . . . . . 0.201 . . . . . 20 . 0.972 0.943 0.346 'X-RAY DIFFRACTION' 4.023 4.298 168 . 11 157 100.0000 . 0.173 . . 0.171 . . . . . 0.169 . . . . . 20 . 0.986 0.987 0.192 'X-RAY DIFFRACTION' 4.298 4.638 165 . 6 158 99.3939 . 0.140 . . 0.138 . . . . . 0.137 . . . . . 20 . 0.989 0.995 0.170 'X-RAY DIFFRACTION' 4.638 5.074 153 . 5 147 99.3464 . 0.162 . . 0.159 . . . . . 0.166 . . . . . 20 . 0.986 0.919 0.347 'X-RAY DIFFRACTION' 5.074 5.662 134 . 7 126 99.2537 . 0.152 . . 0.144 . . . . . 0.144 . . . . . 20 . 0.987 0.960 0.339 'X-RAY DIFFRACTION' 5.662 6.517 121 . 3 115 97.5207 . 0.231 . . 0.230 . . . . . 0.239 . . . . . 20 . 0.974 0.977 0.303 'X-RAY DIFFRACTION' 6.517 7.932 104 . 3 100 99.0385 . 0.201 . . 0.205 . . . . . 0.202 . . . . . 20 . 0.973 0.986 0.076 'X-RAY DIFFRACTION' 7.932 11.013 87 . 5 79 96.5517 . 0.171 . . 0.165 . . . . . 0.182 . . . . . 20 . 0.983 0.971 0.292 'X-RAY DIFFRACTION' 11.013 41.006 61 . 3 54 93.4426 . 0.369 . . 0.364 . . . . . 0.386 . . . . . 20 . 0.926 0.773 0.670 # _struct.entry_id 8BV9 _struct.title 'Acylphosphatase from E. coli' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8BV9 _struct_keywords.text 'ALPHA AND BETA PROTEINS, HYDROLASE, AMYLOID, PHOSPHATASE, Intertwined' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ACYP_ECO57 _struct_ref.pdbx_db_accession P0AB66 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SKVCIIAWVYGRVQGVGFRYTTQYEAKRLGLTGYAKNLDDGSVEVVACGEEGQVEKLMQWLKSGGPRSARVERVLSEPHH PSGELTDFRIR ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8BV9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AB66 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 92 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8BV9 LEU A 92 ? UNP P0AB66 ? ? 'expression tag' 93 1 1 8BV9 GLU A 93 ? UNP P0AB66 ? ? 'expression tag' 94 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 940 ? 1 MORE -34 ? 1 'SSA (A^2)' 6480 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 17 ? LEU A 29 ? GLY A 18 LEU A 30 1 ? 13 HELX_P HELX_P2 AA2 GLU A 51 ? SER A 63 ? GLU A 52 SER A 64 1 ? 13 HELX_P HELX_P3 AA3 HIS A 80 ? LEU A 85 ? HIS A 81 LEU A 86 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 4 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 48 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 5 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 49 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.070 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 4 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 48 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 5 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 49 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 77 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 78 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 78 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 79 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -17.10 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 32 ? ASN A 37 ? THR A 33 ASN A 38 AA1 2 VAL A 43 ? GLU A 50 ? VAL A 44 GLU A 51 AA1 3 LYS A 2 ? ARG A 12 ? LYS A 3 ARG A 13 AA1 4 ARG A 70 ? GLU A 77 ? ARG A 71 GLU A 78 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 32 ? N THR A 33 O CYS A 48 ? O CYS A 49 AA1 2 3 O VAL A 45 ? O VAL A 46 N ALA A 7 ? N ALA A 8 AA1 3 4 N TYR A 10 ? N TYR A 11 O ARG A 73 ? O ARG A 74 # _pdbx_entry_details.entry_id 8BV9 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 29 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 A _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 201 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.12 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O1 A EDO 103 ? ? 1_555 O1 A EDO 103 ? ? 3_555 1.96 2 1 O2 A SO4 105 ? ? 1_555 O2 A SO4 105 ? ? 3_556 2.19 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 64 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -69.35 _pdbx_validate_torsion.psi 1.32 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ASP _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 88 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 PHE _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 89 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -149.42 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 68 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id A _pdbx_validate_planes.rmsd 0.104 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 SER N N N N 300 SER CA C N S 301 SER C C N N 302 SER O O N N 303 SER CB C N N 304 SER OG O N N 305 SER OXT O N N 306 SER H H N N 307 SER H2 H N N 308 SER HA H N N 309 SER HB2 H N N 310 SER HB3 H N N 311 SER HG H N N 312 SER HXT H N N 313 SO4 S S N N 314 SO4 O1 O N N 315 SO4 O2 O N N 316 SO4 O3 O N N 317 SO4 O4 O N N 318 THR N N N N 319 THR CA C N S 320 THR C C N N 321 THR O O N N 322 THR CB C N R 323 THR OG1 O N N 324 THR CG2 C N N 325 THR OXT O N N 326 THR H H N N 327 THR H2 H N N 328 THR HA H N N 329 THR HB H N N 330 THR HG1 H N N 331 THR HG21 H N N 332 THR HG22 H N N 333 THR HG23 H N N 334 THR HXT H N N 335 TRP N N N N 336 TRP CA C N S 337 TRP C C N N 338 TRP O O N N 339 TRP CB C N N 340 TRP CG C Y N 341 TRP CD1 C Y N 342 TRP CD2 C Y N 343 TRP NE1 N Y N 344 TRP CE2 C Y N 345 TRP CE3 C Y N 346 TRP CZ2 C Y N 347 TRP CZ3 C Y N 348 TRP CH2 C Y N 349 TRP OXT O N N 350 TRP H H N N 351 TRP H2 H N N 352 TRP HA H N N 353 TRP HB2 H N N 354 TRP HB3 H N N 355 TRP HD1 H N N 356 TRP HE1 H N N 357 TRP HE3 H N N 358 TRP HZ2 H N N 359 TRP HZ3 H N N 360 TRP HH2 H N N 361 TRP HXT H N N 362 TYR N N N N 363 TYR CA C N S 364 TYR C C N N 365 TYR O O N N 366 TYR CB C N N 367 TYR CG C Y N 368 TYR CD1 C Y N 369 TYR CD2 C Y N 370 TYR CE1 C Y N 371 TYR CE2 C Y N 372 TYR CZ C Y N 373 TYR OH O N N 374 TYR OXT O N N 375 TYR H H N N 376 TYR H2 H N N 377 TYR HA H N N 378 TYR HB2 H N N 379 TYR HB3 H N N 380 TYR HD1 H N N 381 TYR HD2 H N N 382 TYR HE1 H N N 383 TYR HE2 H N N 384 TYR HH H N N 385 TYR HXT H N N 386 VAL N N N N 387 VAL CA C N S 388 VAL C C N N 389 VAL O O N N 390 VAL CB C N N 391 VAL CG1 C N N 392 VAL CG2 C N N 393 VAL OXT O N N 394 VAL H H N N 395 VAL H2 H N N 396 VAL HA H N N 397 VAL HB H N N 398 VAL HG11 H N N 399 VAL HG12 H N N 400 VAL HG13 H N N 401 VAL HG21 H N N 402 VAL HG22 H N N 403 VAL HG23 H N N 404 VAL HXT H N N 405 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 SO4 S O1 doub N N 299 SO4 S O2 doub N N 300 SO4 S O3 sing N N 301 SO4 S O4 sing N N 302 THR N CA sing N N 303 THR N H sing N N 304 THR N H2 sing N N 305 THR CA C sing N N 306 THR CA CB sing N N 307 THR CA HA sing N N 308 THR C O doub N N 309 THR C OXT sing N N 310 THR CB OG1 sing N N 311 THR CB CG2 sing N N 312 THR CB HB sing N N 313 THR OG1 HG1 sing N N 314 THR CG2 HG21 sing N N 315 THR CG2 HG22 sing N N 316 THR CG2 HG23 sing N N 317 THR OXT HXT sing N N 318 TRP N CA sing N N 319 TRP N H sing N N 320 TRP N H2 sing N N 321 TRP CA C sing N N 322 TRP CA CB sing N N 323 TRP CA HA sing N N 324 TRP C O doub N N 325 TRP C OXT sing N N 326 TRP CB CG sing N N 327 TRP CB HB2 sing N N 328 TRP CB HB3 sing N N 329 TRP CG CD1 doub Y N 330 TRP CG CD2 sing Y N 331 TRP CD1 NE1 sing Y N 332 TRP CD1 HD1 sing N N 333 TRP CD2 CE2 doub Y N 334 TRP CD2 CE3 sing Y N 335 TRP NE1 CE2 sing Y N 336 TRP NE1 HE1 sing N N 337 TRP CE2 CZ2 sing Y N 338 TRP CE3 CZ3 doub Y N 339 TRP CE3 HE3 sing N N 340 TRP CZ2 CH2 doub Y N 341 TRP CZ2 HZ2 sing N N 342 TRP CZ3 CH2 sing Y N 343 TRP CZ3 HZ3 sing N N 344 TRP CH2 HH2 sing N N 345 TRP OXT HXT sing N N 346 TYR N CA sing N N 347 TYR N H sing N N 348 TYR N H2 sing N N 349 TYR CA C sing N N 350 TYR CA CB sing N N 351 TYR CA HA sing N N 352 TYR C O doub N N 353 TYR C OXT sing N N 354 TYR CB CG sing N N 355 TYR CB HB2 sing N N 356 TYR CB HB3 sing N N 357 TYR CG CD1 doub Y N 358 TYR CG CD2 sing Y N 359 TYR CD1 CE1 sing Y N 360 TYR CD1 HD1 sing N N 361 TYR CD2 CE2 doub Y N 362 TYR CD2 HD2 sing N N 363 TYR CE1 CZ doub Y N 364 TYR CE1 HE1 sing N N 365 TYR CE2 CZ sing Y N 366 TYR CE2 HE2 sing N N 367 TYR CZ OH sing N N 368 TYR OH HH sing N N 369 TYR OXT HXT sing N N 370 VAL N CA sing N N 371 VAL N H sing N N 372 VAL N H2 sing N N 373 VAL CA C sing N N 374 VAL CA CB sing N N 375 VAL CA HA sing N N 376 VAL C O doub N N 377 VAL C OXT sing N N 378 VAL CB CG1 sing N N 379 VAL CB CG2 sing N N 380 VAL CB HB sing N N 381 VAL CG1 HG11 sing N N 382 VAL CG1 HG12 sing N N 383 VAL CG1 HG13 sing N N 384 VAL CG2 HG21 sing N N 385 VAL CG2 HG22 sing N N 386 VAL CG2 HG23 sing N N 387 VAL OXT HXT sing N N 388 # _pdbx_audit_support.funding_organization 'Ministerio de Ciencia e Innovacion (MCIN)' _pdbx_audit_support.country Spain _pdbx_audit_support.grant_number PID2020-116261GB-I00 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2GV1 _pdbx_initial_refinement_model.details ? # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_reference 10.15151/ESRF-ES-541423054 _pdbx_related_exp_data_set.metadata_reference ? _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.details ? # _atom_sites.entry_id 8BV9 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.024743 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012203 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015626 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #