data_8BWB # _entry.id 8BWB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.373 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8BWB pdb_00008bwb 10.2210/pdb8bwb/pdb WWPDB D_1292127222 ? ? BMRB 34776 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Spider toxin Pha1b (PnTx3-6) from Phoneutria nigriventer targeting CaV2.x calcium channels and TRPA1 channel' _pdbx_database_related.db_id 34776 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8BWB _pdbx_database_status.recvd_initial_deposition_date 2022-12-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mironov, P.A.' 1 0000-0002-7884-3257 'Chernaya, E.M.' 2 0000-0002-1271-0259 'Paramonov, A.S.' 3 0000-0003-3614-560X 'Shenkarev, Z.O.' 4 0000-0003-1383-3522 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Toxins _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2072-6651 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 15 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Recombinant Production, NMR Solution Structure, and Membrane Interaction of the Ph alpha 1 beta Toxin, a TRPA1 Modulator from the Brazilian Armed Spider Phoneutria nigriventer . ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/toxins15060378 _citation.pdbx_database_id_PubMed 37368679 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lyukmanova, E.N.' 1 ? primary 'Mironov, P.A.' 2 ? primary 'Kulbatskii, D.S.' 3 ? primary 'Shulepko, M.A.' 4 ? primary 'Paramonov, A.S.' 5 ? primary 'Chernaya, E.M.' 6 ? primary 'Logashina, Y.A.' 7 ? primary 'Andreev, Y.A.' 8 ? primary 'Kirpichnikov, M.P.' 9 ? primary 'Shenkarev, Z.O.' 10 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8BWB _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8BWB _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Omega-ctenitoxin-Pn4a _entity.formula_weight 6055.089 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Omega-CNTX-Pn4a,CTK 01512-2,Neurotoxin Tx3-6,PnTx3-6,Ph-alpha-1-beta toxin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ACIPRGEICTDDCECCGCDNQCYCPPGSSLGIFKCSCAHANKYFCNRKKEKCKKA _entity_poly.pdbx_seq_one_letter_code_can ACIPRGEICTDDCECCGCDNQCYCPPGSSLGIFKCSCAHANKYFCNRKKEKCKKA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 CYS n 1 3 ILE n 1 4 PRO n 1 5 ARG n 1 6 GLY n 1 7 GLU n 1 8 ILE n 1 9 CYS n 1 10 THR n 1 11 ASP n 1 12 ASP n 1 13 CYS n 1 14 GLU n 1 15 CYS n 1 16 CYS n 1 17 GLY n 1 18 CYS n 1 19 ASP n 1 20 ASN n 1 21 GLN n 1 22 CYS n 1 23 TYR n 1 24 CYS n 1 25 PRO n 1 26 PRO n 1 27 GLY n 1 28 SER n 1 29 SER n 1 30 LEU n 1 31 GLY n 1 32 ILE n 1 33 PHE n 1 34 LYS n 1 35 CYS n 1 36 SER n 1 37 CYS n 1 38 ALA n 1 39 HIS n 1 40 ALA n 1 41 ASN n 1 42 LYS n 1 43 TYR n 1 44 PHE n 1 45 CYS n 1 46 ASN n 1 47 ARG n 1 48 LYS n 1 49 LYS n 1 50 GLU n 1 51 LYS n 1 52 CYS n 1 53 LYS n 1 54 LYS n 1 55 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 55 _entity_src_gen.gene_src_common_name 'Brazilian armed spider' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Phoneutria nigriventer' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6918 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-32a(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TX90B_PHONI _struct_ref.pdbx_db_accession P81792 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ACIPRGEICTDDCECCGCDNQCYCPPGSSLGIFKCSCAHANKYFCNRKKEKCKKA _struct_ref.pdbx_align_begin 36 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8BWB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 55 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P81792 _struct_ref_seq.db_align_beg 36 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 90 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 55 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H NOESY' 1 isotropic 2 1 1 '2D 1H-1H TOCSY' 1 isotropic 3 1 1 '2D 1H-13C HSQC' 1 isotropic 4 1 2 '3D 1H-15N NOESY' 1 isotropic 5 1 2 '3D 1H-15N TOCSY' 1 isotropic 6 1 2 '2D 1H-15N HSQC' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 1 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1.7 mM Pha1b, 5 % [U-99% 2H] D2O, 95% H2O/5% D2O' '95% H2O/5% D2O' 'natural abundance' solution ? 2 '2.7 mM [U-100% 15N] Pha1b, 5 % [U-99% 2H] D2O, 20 uM sodium acetate, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N_sample solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 8BWB _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 8BWB _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8BWB _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 2 'chemical shift assignment' CARA 1.9.1.7 'Keller and Wuthrich' 3 'structure calculation' CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 4 'peak picking' CARA 1.9.1.7 'Keller and Wuthrich' 5 processing TopSpin 4.0.7 'Bruker Biospin' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8BWB _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8BWB _struct.title 'Spider toxin Pha1b (PnTx3-6) from Phoneutria nigriventer targeting CaV2.x calcium channels and TRPA1 channel' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8BWB _struct_keywords.text 'toxin, spider toxin, neurotoxin, cystine-knot peptide, antagonist of CaV2.x calcium channels and TRPA1 channel' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 40 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 49 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 40 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 49 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 2 A CYS 16 1_555 ? ? ? ? ? ? ? 1.975 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 9 A CYS 22 1_555 ? ? ? ? ? ? ? 1.987 ? ? disulf3 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 13 A CYS 52 1_555 ? ? ? ? ? ? ? 1.921 ? ? disulf4 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 15 A CYS 37 1_555 ? ? ? ? ? ? ? 1.873 ? ? disulf5 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 45 SG ? ? A CYS 18 A CYS 45 1_555 ? ? ? ? ? ? ? 1.891 ? ? disulf6 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 24 A CYS 35 1_555 ? ? ? ? ? ? ? 2.032 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 20 ? TYR A 23 ? ASN A 20 TYR A 23 AA1 2 SER A 36 ? HIS A 39 ? SER A 36 HIS A 39 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLN _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 21 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 21 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ALA _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 38 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 38 # _database_PDB_matrix.entry_id 8BWB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 8BWB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ALA 55 55 55 ALA ALA A . n # _pdbx_contact_author.id 5 _pdbx_contact_author.email pavel.mironov@student.msu.ru _pdbx_contact_author.name_first Pavel _pdbx_contact_author.name_last Mironov _pdbx_contact_author.name_mi M. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7884-3257 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-06-21 2 'Structure model' 1 1 2023-07-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Pha1b 1.7 ? mM 'natural abundance' 1 D2O 5 ? % '[U-99% 2H]' 2 Pha1b 2.7 ? mM '[U-100% 15N]' 2 D2O 5 ? % '[U-99% 2H]' 2 'sodium acetate' 20 ? uM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 16 ? ? -58.94 -172.29 2 1 LYS A 34 ? ? -94.55 -60.70 3 1 LYS A 51 ? ? -100.14 -81.01 4 2 CYS A 16 ? ? -60.43 -169.63 5 2 LYS A 51 ? ? -100.45 -72.45 6 3 CYS A 16 ? ? -57.73 -175.84 7 3 CYS A 24 ? ? -113.53 74.43 8 3 LYS A 51 ? ? -101.62 -77.46 9 4 CYS A 16 ? ? -58.55 -174.35 10 4 CYS A 24 ? ? -113.59 74.13 11 4 LYS A 51 ? ? -100.50 -79.15 12 5 CYS A 16 ? ? -60.92 -166.93 13 5 CYS A 24 ? ? -112.86 76.93 14 5 TYR A 43 ? ? -93.03 -62.83 15 5 LYS A 51 ? ? -99.19 -80.65 16 5 CYS A 52 ? ? -69.74 -77.25 17 5 LYS A 53 ? ? 179.15 -176.67 18 5 LYS A 54 ? ? -95.99 47.99 19 6 CYS A 16 ? ? -59.14 -173.03 20 6 CYS A 24 ? ? -113.55 76.33 21 6 HIS A 39 ? ? -59.59 104.91 22 6 LYS A 51 ? ? -99.92 -78.63 23 7 CYS A 24 ? ? -112.84 76.87 24 7 PRO A 26 ? ? -69.74 86.00 25 7 ALA A 40 ? ? -151.19 89.45 26 7 LYS A 51 ? ? -101.14 -71.89 27 8 CYS A 16 ? ? -58.28 -174.41 28 8 LYS A 51 ? ? -101.87 -80.25 29 8 LYS A 53 ? ? -51.01 171.28 30 8 LYS A 54 ? ? -69.72 80.47 31 9 CYS A 16 ? ? -59.12 -174.20 32 9 CYS A 24 ? ? -117.08 68.91 33 9 ASN A 41 ? ? -78.32 -71.13 34 9 LYS A 51 ? ? -88.97 -77.14 35 10 CYS A 16 ? ? -59.37 -171.67 36 10 CYS A 24 ? ? -118.03 76.00 37 10 LYS A 34 ? ? -96.01 -67.40 38 10 LYS A 51 ? ? -93.20 -79.73 39 11 CYS A 16 ? ? -60.28 -169.62 40 11 TYR A 43 ? ? -95.48 -60.89 41 11 LYS A 51 ? ? -100.31 -77.60 42 12 CYS A 16 ? ? -59.97 -170.01 43 12 CYS A 24 ? ? -113.93 72.81 44 12 LYS A 34 ? ? -95.29 -65.07 45 12 TYR A 43 ? ? -100.20 -60.09 46 12 LYS A 51 ? ? -100.47 -73.05 47 13 CYS A 16 ? ? -69.12 -80.35 48 13 CYS A 24 ? ? -113.24 78.35 49 13 LYS A 51 ? ? -100.57 -78.21 50 14 CYS A 16 ? ? -58.62 -174.68 51 14 CYS A 24 ? ? -113.04 75.81 52 14 ASN A 41 ? ? -81.47 -73.59 53 14 LYS A 51 ? ? -101.29 -67.42 54 15 CYS A 16 ? ? -61.76 -168.96 55 15 CYS A 24 ? ? -115.07 77.39 56 15 ASN A 41 ? ? -81.60 -70.90 57 15 LYS A 51 ? ? -100.65 -79.22 58 16 CYS A 16 ? ? -61.55 -165.74 59 16 CYS A 24 ? ? -114.76 76.21 60 16 LYS A 51 ? ? -99.86 -76.10 61 17 CYS A 16 ? ? -59.73 -172.08 62 17 CYS A 24 ? ? -116.40 77.19 63 17 HIS A 39 ? ? -58.08 104.08 64 17 LYS A 51 ? ? -99.89 -71.33 65 18 CYS A 16 ? ? -59.76 -173.58 66 18 CYS A 24 ? ? -113.08 79.15 67 18 ASN A 41 ? ? -81.53 -70.25 68 18 LYS A 51 ? ? -99.81 -81.97 69 18 CYS A 52 ? ? -70.30 -77.58 70 18 LYS A 53 ? ? -177.67 -175.87 71 18 LYS A 54 ? ? -93.29 41.98 72 19 CYS A 16 ? ? -61.11 -167.82 73 19 CYS A 24 ? ? -116.26 75.31 74 19 TYR A 43 ? ? -90.29 -62.45 75 19 LYS A 51 ? ? -101.40 -63.90 76 20 CYS A 2 ? ? -171.68 -179.94 77 20 CYS A 16 ? ? -58.26 -174.88 78 20 CYS A 24 ? ? -113.43 74.50 79 20 PRO A 26 ? ? -69.81 98.38 80 20 ASN A 41 ? ? -82.62 -72.77 81 20 LYS A 51 ? ? -100.71 -77.05 # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 22-14-00326 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ? #