data_8BY0 # _entry.id 8BY0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8BY0 pdb_00008by0 10.2210/pdb8by0/pdb WWPDB D_1292127338 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'different protein mutant' 8AQX unspecified PDB 'different protein mutant' 8AQY unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8BY0 _pdbx_database_status.recvd_initial_deposition_date 2022-12-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Igareta, N.V.' 1 0000-0002-8767-3456 'Ward, T.R.' 2 0000-0001-8602-5468 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'streptavidin mutant S112I with an iridium catalyst for CH activation' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Igareta, N.V.' 1 0000-0002-8767-3456 primary 'Ward, T.R.' 2 0000-0001-8602-5468 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8BY0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.428 _cell.length_a_esd ? _cell.length_b 57.428 _cell.length_b_esd ? _cell.length_c 183.123 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8BY0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Streptavidin 16492.914 1 ? ? ? ? 2 non-polymer syn ;tert-butyl 7'-[5-[(3aS,4S,6aR)-2-oxidanylidene-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoylamino]-1-chloranyl-2,3,4,5,6-pentamethyl-spiro[1$l^{8}-iridapentacyclo[2.2.0.0^{1,3}.0^{1,5}.0^{2,6}]hexane-1,2'-3-aza-1-azonia-2$l^{8}-iridatricyclo[6.3.1.0^{4,12}]dodeca-1(11),4,6,8(12),9-pentaene]-3'-carboxylate ; 847.487 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 water nat water 18.015 12 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKN NYRNAHSATTWSGQYVGGAEARINTQWLLTIGTTEANAWRSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ ; _entity_poly.pdbx_seq_one_letter_code_can ;ASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKN NYRNAHSATTWSGQYVGGAEARINTQWLLTIGTTEANAWRSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 SER n 1 3 MET n 1 4 THR n 1 5 GLY n 1 6 GLY n 1 7 GLN n 1 8 GLN n 1 9 MET n 1 10 GLY n 1 11 ARG n 1 12 ASP n 1 13 GLU n 1 14 ALA n 1 15 GLY n 1 16 ILE n 1 17 THR n 1 18 GLY n 1 19 THR n 1 20 TRP n 1 21 TYR n 1 22 ASN n 1 23 GLN n 1 24 LEU n 1 25 GLY n 1 26 SER n 1 27 THR n 1 28 PHE n 1 29 ILE n 1 30 VAL n 1 31 THR n 1 32 ALA n 1 33 GLY n 1 34 ALA n 1 35 ASP n 1 36 GLY n 1 37 ALA n 1 38 LEU n 1 39 THR n 1 40 GLY n 1 41 THR n 1 42 TYR n 1 43 GLU n 1 44 SER n 1 45 ALA n 1 46 VAL n 1 47 GLY n 1 48 ASN n 1 49 ALA n 1 50 GLU n 1 51 SER n 1 52 ARG n 1 53 TYR n 1 54 VAL n 1 55 LEU n 1 56 THR n 1 57 GLY n 1 58 ARG n 1 59 TYR n 1 60 ASP n 1 61 SER n 1 62 ALA n 1 63 PRO n 1 64 ALA n 1 65 THR n 1 66 ASP n 1 67 GLY n 1 68 SER n 1 69 GLY n 1 70 THR n 1 71 ALA n 1 72 LEU n 1 73 GLY n 1 74 TRP n 1 75 THR n 1 76 VAL n 1 77 ALA n 1 78 TRP n 1 79 LYS n 1 80 ASN n 1 81 ASN n 1 82 TYR n 1 83 ARG n 1 84 ASN n 1 85 ALA n 1 86 HIS n 1 87 SER n 1 88 ALA n 1 89 THR n 1 90 THR n 1 91 TRP n 1 92 SER n 1 93 GLY n 1 94 GLN n 1 95 TYR n 1 96 VAL n 1 97 GLY n 1 98 GLY n 1 99 ALA n 1 100 GLU n 1 101 ALA n 1 102 ARG n 1 103 ILE n 1 104 ASN n 1 105 THR n 1 106 GLN n 1 107 TRP n 1 108 LEU n 1 109 LEU n 1 110 THR n 1 111 ILE n 1 112 GLY n 1 113 THR n 1 114 THR n 1 115 GLU n 1 116 ALA n 1 117 ASN n 1 118 ALA n 1 119 TRP n 1 120 ARG n 1 121 SER n 1 122 THR n 1 123 LEU n 1 124 VAL n 1 125 GLY n 1 126 HIS n 1 127 ASP n 1 128 THR n 1 129 PHE n 1 130 THR n 1 131 LYS n 1 132 VAL n 1 133 LYS n 1 134 PRO n 1 135 SER n 1 136 ALA n 1 137 ALA n 1 138 SER n 1 139 ILE n 1 140 ASP n 1 141 ALA n 1 142 ALA n 1 143 LYS n 1 144 LYS n 1 145 ALA n 1 146 GLY n 1 147 VAL n 1 148 ASN n 1 149 ASN n 1 150 GLY n 1 151 ASN n 1 152 PRO n 1 153 LEU n 1 154 ASP n 1 155 ALA n 1 156 VAL n 1 157 GLN n 1 158 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 158 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces avidinii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1895 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SAV_STRAV _struct_ref.pdbx_db_accession P22629 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWS GQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ ; _struct_ref.pdbx_align_begin 38 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8BY0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 13 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 158 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22629 _struct_ref_seq.db_align_beg 38 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 14 _struct_ref_seq.pdbx_auth_seq_align_end 159 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8BY0 ALA A 1 ? UNP P22629 ? ? 'expression tag' 2 1 1 8BY0 SER A 2 ? UNP P22629 ? ? 'expression tag' 3 2 1 8BY0 MET A 3 ? UNP P22629 ? ? 'expression tag' 4 3 1 8BY0 THR A 4 ? UNP P22629 ? ? 'expression tag' 5 4 1 8BY0 GLY A 5 ? UNP P22629 ? ? 'expression tag' 6 5 1 8BY0 GLY A 6 ? UNP P22629 ? ? 'expression tag' 7 6 1 8BY0 GLN A 7 ? UNP P22629 ? ? 'expression tag' 8 7 1 8BY0 GLN A 8 ? UNP P22629 ? ? 'expression tag' 9 8 1 8BY0 MET A 9 ? UNP P22629 ? ? 'expression tag' 10 9 1 8BY0 GLY A 10 ? UNP P22629 ? ? 'expression tag' 11 10 1 8BY0 ARG A 11 ? UNP P22629 ? ? 'expression tag' 12 11 1 8BY0 ASP A 12 ? UNP P22629 ? ? 'expression tag' 13 12 1 8BY0 ILE A 111 ? UNP P22629 SER 136 conflict 112 13 1 8BY0 ARG A 120 ? UNP P22629 LYS 145 conflict 121 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NOF non-polymer . ;tert-butyl 7'-[5-[(3aS,4S,6aR)-2-oxidanylidene-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoylamino]-1-chloranyl-2,3,4,5,6-pentamethyl-spiro[1$l^{8}-iridapentacyclo[2.2.0.0^{1,3}.0^{1,5}.0^{2,6}]hexane-1,2'-3-aza-1-azonia-2$l^{8}-iridatricyclo[6.3.1.0^{4,12}]dodeca-1(11),4,6,8(12),9-pentaene]-3'-carboxylate ; 'iridium catalyst for CH activation' 'C34 H45 Cl Ir N5 O4 S 1' 847.487 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8BY0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.29 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.26 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;2.0 M ammonium sulfate 0.1 M sodium acetate (soaking under pH 6.0) ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-08-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.99988 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.99988 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8BY0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.10 _reflns.d_resolution_low 45.78 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9422 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.191 _reflns.pdbx_Rpim_I_all 0.065 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.180 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 8.91 45.78 ? ? ? ? ? ? 163 ? ? ? ? ? ? ? ? ? ? ? 12.1 ? ? ? 0.050 0.017 ? 1 1 0.998 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? ? 2.10 2.16 ? ? ? ? ? ? 755 ? ? ? ? ? ? ? ? ? ? ? 16.5 ? ? ? 2.424 0.824 ? 2 1 0.573 ? ? ? ? 2.279 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -2.850 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -2.850 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] 5.700 _refine.B_iso_max ? _refine.B_iso_mean 44.640 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.954 _refine.correlation_coeff_Fo_to_Fc_free 0.935 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8BY0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.100 _refine.ls_d_res_low 41.862 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9206 _refine.ls_number_reflns_R_free 449 _refine.ls_number_reflns_R_work 8757 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.718 _refine.ls_percent_reflns_R_free 4.877 _refine.ls_R_factor_all 0.216 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2507 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2143 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.211 _refine.pdbx_overall_ESU_R_Free 0.182 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 8.258 _refine.overall_SU_ML 0.189 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.100 _refine_hist.d_res_low 41.862 _refine_hist.number_atoms_solvent 12 _refine_hist.number_atoms_total 996 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 928 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 56 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.012 1015 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 845 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.174 1.747 1420 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.921 1.620 1944 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.190 5.000 122 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 9.991 5.000 7 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.271 10.000 129 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.517 10.000 44 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.069 0.200 150 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 1161 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 216 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.219 0.200 161 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.209 0.200 803 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.189 0.200 480 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.104 0.200 519 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.112 0.200 24 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.154 0.200 24 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.133 0.200 102 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.055 0.200 6 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 3.340 4.458 489 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.338 4.464 490 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.800 6.687 610 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.797 6.694 611 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.085 4.860 526 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.989 4.803 519 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 5.765 7.206 797 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.633 7.122 786 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 8.302 54.665 1123 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 8.288 54.688 1123 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.100 2.154 681 . 25 656 100.0000 . 0.375 . . 0.375 . . . . . 0.359 . 20 . 0.792 0.712 0.382 'X-RAY DIFFRACTION' 2.154 2.213 667 . 38 609 97.0015 . 0.354 . . 0.351 . . . . . 0.333 . 20 . 0.814 0.843 0.410 'X-RAY DIFFRACTION' 2.213 2.277 642 . 22 451 73.6760 . 0.604 . . 0.603 . . . . . 0.598 . 20 . 0.658 0.583 0.623 'X-RAY DIFFRACTION' 2.277 2.347 614 . 34 580 100.0000 . 0.339 . . 0.337 . . . . . 0.308 . 20 . 0.849 0.823 0.388 'X-RAY DIFFRACTION' 2.347 2.424 609 . 29 580 100.0000 . 0.291 . . 0.293 . . . . . 0.272 . 20 . 0.889 0.942 0.269 'X-RAY DIFFRACTION' 2.424 2.509 592 . 28 564 100.0000 . 0.287 . . 0.286 . . . . . 0.249 . 20 . 0.907 0.920 0.300 'X-RAY DIFFRACTION' 2.509 2.603 565 . 37 528 100.0000 . 0.280 . . 0.275 . . . . . 0.243 . 20 . 0.929 0.851 0.373 'X-RAY DIFFRACTION' 2.603 2.709 548 . 30 517 99.8175 . 0.243 . . 0.242 . . . . . 0.209 . 20 . 0.949 0.955 0.276 'X-RAY DIFFRACTION' 2.709 2.829 522 . 25 497 100.0000 . 0.186 . . 0.179 . . . . . 0.148 . 20 . 0.972 0.927 0.357 'X-RAY DIFFRACTION' 2.829 2.966 508 . 16 492 100.0000 . 0.178 . . 0.177 . . . . . 0.155 . 20 . 0.977 0.977 0.209 'X-RAY DIFFRACTION' 2.966 3.126 495 . 27 468 100.0000 . 0.164 . . 0.166 . . . . . 0.147 . 20 . 0.981 0.988 0.139 'X-RAY DIFFRACTION' 3.126 3.314 456 . 22 434 100.0000 . 0.143 . . 0.142 . . . . . 0.127 . 20 . 0.985 0.985 0.164 'X-RAY DIFFRACTION' 3.314 3.541 436 . 22 414 100.0000 . 0.165 . . 0.161 . . . . . 0.150 . 20 . 0.983 0.966 0.244 'X-RAY DIFFRACTION' 3.541 3.823 412 . 15 377 95.1456 . 0.191 . . 0.189 . . . . . 0.171 . 20 . 0.974 0.963 0.235 'X-RAY DIFFRACTION' 3.823 4.184 378 . 15 360 99.2063 . 0.153 . . 0.151 . . . . . 0.141 . 20 . 0.983 0.965 0.233 'X-RAY DIFFRACTION' 4.184 4.672 341 . 18 323 100.0000 . 0.151 . . 0.151 . . . . . 0.153 . 20 . 0.987 0.987 0.156 'X-RAY DIFFRACTION' 4.672 5.384 316 . 16 300 100.0000 . 0.151 . . 0.151 . . . . . 0.156 . 20 . 0.986 0.983 0.153 'X-RAY DIFFRACTION' 5.384 6.567 273 . 15 258 100.0000 . 0.204 . . 0.201 . . . . . 0.196 . 20 . 0.971 0.968 0.249 'X-RAY DIFFRACTION' 6.567 9.175 220 . 8 212 100.0000 . 0.200 . . 0.198 . . . . . 0.210 . 20 . 0.972 0.913 0.246 'X-RAY DIFFRACTION' 9.175 41.862 144 . 7 137 100.0000 . 0.277 . . 0.269 . . . . . 0.273 . 20 . 0.932 0.821 0.506 # _struct.entry_id 8BY0 _struct.title 'streptavidin mutant S112I K121R with an iridium catalyst for CH activation' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8BY0 _struct_keywords.text 'Artificial Metalloenzyme, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 12 ? THR A 17 ? ASP A 13 THR A 18 1 ? 6 HELX_P HELX_P2 AA2 GLU A 115 ? ARG A 120 ? GLU A 116 ARG A 121 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 18 ? ASN A 22 ? GLY A 19 ASN A 23 AA1 2 THR A 27 ? ALA A 32 ? THR A 28 ALA A 33 AA1 3 ALA A 37 ? GLU A 43 ? ALA A 38 GLU A 44 AA1 4 TYR A 53 ? TYR A 59 ? TYR A 54 TYR A 60 AA1 5 THR A 70 ? LYS A 79 ? THR A 71 LYS A 80 AA1 6 ASN A 84 ? VAL A 96 ? ASN A 85 VAL A 97 AA1 7 ARG A 102 ? ILE A 111 ? ARG A 103 ILE A 112 AA1 8 THR A 122 ? THR A 130 ? THR A 123 THR A 131 AA1 9 GLY A 18 ? ASN A 22 ? GLY A 19 ASN A 23 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TRP A 20 ? N TRP A 21 O PHE A 28 ? O PHE A 29 AA1 2 3 N THR A 31 ? N THR A 32 O THR A 39 ? O THR A 40 AA1 3 4 N TYR A 42 ? N TYR A 43 O TYR A 53 ? O TYR A 54 AA1 4 5 N THR A 56 ? N THR A 57 O THR A 75 ? O THR A 76 AA1 5 6 N TRP A 78 ? N TRP A 79 O ALA A 85 ? O ALA A 86 AA1 6 7 N VAL A 96 ? N VAL A 97 O ARG A 102 ? O ARG A 103 AA1 7 8 N THR A 105 ? N THR A 106 O ASP A 127 ? O ASP A 128 AA1 8 9 O THR A 130 ? O THR A 131 N TYR A 21 ? N TYR A 22 # _atom_sites.entry_id 8BY0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017413 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017413 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005461 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 CL 17 17 11.460 0.010 7.196 1.166 6.255 18.519 1.645 47.778 -9.338 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 IR 77 77 27.322 1.593 16.740 8.866 15.621 0.418 5.837 45.001 3.070 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.056 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 2 ? ? ? A . n A 1 2 SER 2 3 ? ? ? A . n A 1 3 MET 3 4 ? ? ? A . n A 1 4 THR 4 5 ? ? ? A . n A 1 5 GLY 5 6 ? ? ? A . n A 1 6 GLY 6 7 ? ? ? A . n A 1 7 GLN 7 8 ? ? ? A . n A 1 8 GLN 8 9 ? ? ? A . n A 1 9 MET 9 10 ? ? ? A . n A 1 10 GLY 10 11 ? ? ? A . n A 1 11 ARG 11 12 12 ARG ARG A . n A 1 12 ASP 12 13 13 ASP ASP A . n A 1 13 GLU 13 14 14 GLU GLU A . n A 1 14 ALA 14 15 15 ALA ALA A . n A 1 15 GLY 15 16 16 GLY GLY A . n A 1 16 ILE 16 17 17 ILE ILE A . n A 1 17 THR 17 18 18 THR THR A . n A 1 18 GLY 18 19 19 GLY GLY A . n A 1 19 THR 19 20 20 THR THR A . n A 1 20 TRP 20 21 21 TRP TRP A . n A 1 21 TYR 21 22 22 TYR TYR A . n A 1 22 ASN 22 23 23 ASN ASN A . n A 1 23 GLN 23 24 24 GLN GLN A . n A 1 24 LEU 24 25 25 LEU LEU A . n A 1 25 GLY 25 26 26 GLY GLY A . n A 1 26 SER 26 27 27 SER SER A . n A 1 27 THR 27 28 28 THR THR A . n A 1 28 PHE 28 29 29 PHE PHE A . n A 1 29 ILE 29 30 30 ILE ILE A . n A 1 30 VAL 30 31 31 VAL VAL A . n A 1 31 THR 31 32 32 THR THR A . n A 1 32 ALA 32 33 33 ALA ALA A . n A 1 33 GLY 33 34 34 GLY GLY A . n A 1 34 ALA 34 35 35 ALA ALA A . n A 1 35 ASP 35 36 36 ASP ASP A . n A 1 36 GLY 36 37 37 GLY GLY A . n A 1 37 ALA 37 38 38 ALA ALA A . n A 1 38 LEU 38 39 39 LEU LEU A . n A 1 39 THR 39 40 40 THR THR A . n A 1 40 GLY 40 41 41 GLY GLY A . n A 1 41 THR 41 42 42 THR THR A . n A 1 42 TYR 42 43 43 TYR TYR A . n A 1 43 GLU 43 44 44 GLU GLU A . n A 1 44 SER 44 45 45 SER SER A . n A 1 45 ALA 45 46 46 ALA ALA A . n A 1 46 VAL 46 47 47 VAL VAL A . n A 1 47 GLY 47 48 48 GLY GLY A . n A 1 48 ASN 48 49 49 ASN ASN A . n A 1 49 ALA 49 50 50 ALA ALA A . n A 1 50 GLU 50 51 51 GLU GLU A . n A 1 51 SER 51 52 52 SER SER A . n A 1 52 ARG 52 53 53 ARG ARG A . n A 1 53 TYR 53 54 54 TYR TYR A . n A 1 54 VAL 54 55 55 VAL VAL A . n A 1 55 LEU 55 56 56 LEU LEU A . n A 1 56 THR 56 57 57 THR THR A . n A 1 57 GLY 57 58 58 GLY GLY A . n A 1 58 ARG 58 59 59 ARG ARG A . n A 1 59 TYR 59 60 60 TYR TYR A . n A 1 60 ASP 60 61 61 ASP ASP A . n A 1 61 SER 61 62 62 SER SER A . n A 1 62 ALA 62 63 63 ALA ALA A . n A 1 63 PRO 63 64 64 PRO PRO A . n A 1 64 ALA 64 65 65 ALA ALA A . n A 1 65 THR 65 66 66 THR THR A . n A 1 66 ASP 66 67 67 ASP ASP A . n A 1 67 GLY 67 68 68 GLY GLY A . n A 1 68 SER 68 69 69 SER SER A . n A 1 69 GLY 69 70 70 GLY GLY A . n A 1 70 THR 70 71 71 THR THR A . n A 1 71 ALA 71 72 72 ALA ALA A . n A 1 72 LEU 72 73 73 LEU LEU A . n A 1 73 GLY 73 74 74 GLY GLY A . n A 1 74 TRP 74 75 75 TRP TRP A . n A 1 75 THR 75 76 76 THR THR A . n A 1 76 VAL 76 77 77 VAL VAL A . n A 1 77 ALA 77 78 78 ALA ALA A . n A 1 78 TRP 78 79 79 TRP TRP A . n A 1 79 LYS 79 80 80 LYS LYS A . n A 1 80 ASN 80 81 81 ASN ASN A . n A 1 81 ASN 81 82 82 ASN ASN A . n A 1 82 TYR 82 83 83 TYR TYR A . n A 1 83 ARG 83 84 84 ARG ARG A . n A 1 84 ASN 84 85 85 ASN ASN A . n A 1 85 ALA 85 86 86 ALA ALA A . n A 1 86 HIS 86 87 87 HIS HIS A . n A 1 87 SER 87 88 88 SER SER A . n A 1 88 ALA 88 89 89 ALA ALA A . n A 1 89 THR 89 90 90 THR THR A . n A 1 90 THR 90 91 91 THR THR A . n A 1 91 TRP 91 92 92 TRP TRP A . n A 1 92 SER 92 93 93 SER SER A . n A 1 93 GLY 93 94 94 GLY GLY A . n A 1 94 GLN 94 95 95 GLN GLN A . n A 1 95 TYR 95 96 96 TYR TYR A . n A 1 96 VAL 96 97 97 VAL VAL A . n A 1 97 GLY 97 98 98 GLY GLY A . n A 1 98 GLY 98 99 99 GLY GLY A . n A 1 99 ALA 99 100 100 ALA ALA A . n A 1 100 GLU 100 101 101 GLU GLU A . n A 1 101 ALA 101 102 102 ALA ALA A . n A 1 102 ARG 102 103 103 ARG ARG A . n A 1 103 ILE 103 104 104 ILE ILE A . n A 1 104 ASN 104 105 105 ASN ASN A . n A 1 105 THR 105 106 106 THR THR A . n A 1 106 GLN 106 107 107 GLN GLN A . n A 1 107 TRP 107 108 108 TRP TRP A . n A 1 108 LEU 108 109 109 LEU LEU A . n A 1 109 LEU 109 110 110 LEU LEU A . n A 1 110 THR 110 111 111 THR THR A . n A 1 111 ILE 111 112 112 ILE ILE A . n A 1 112 GLY 112 113 113 GLY GLY A . n A 1 113 THR 113 114 114 THR THR A . n A 1 114 THR 114 115 115 THR THR A . n A 1 115 GLU 115 116 116 GLU GLU A . n A 1 116 ALA 116 117 117 ALA ALA A . n A 1 117 ASN 117 118 118 ASN ASN A . n A 1 118 ALA 118 119 119 ALA ALA A . n A 1 119 TRP 119 120 120 TRP TRP A . n A 1 120 ARG 120 121 121 ARG ARG A . n A 1 121 SER 121 122 122 SER SER A . n A 1 122 THR 122 123 123 THR THR A . n A 1 123 LEU 123 124 124 LEU LEU A . n A 1 124 VAL 124 125 125 VAL VAL A . n A 1 125 GLY 125 126 126 GLY GLY A . n A 1 126 HIS 126 127 127 HIS HIS A . n A 1 127 ASP 127 128 128 ASP ASP A . n A 1 128 THR 128 129 129 THR THR A . n A 1 129 PHE 129 130 130 PHE PHE A . n A 1 130 THR 130 131 131 THR THR A . n A 1 131 LYS 131 132 132 LYS LYS A . n A 1 132 VAL 132 133 133 VAL VAL A . n A 1 133 LYS 133 134 134 LYS LYS A . n A 1 134 PRO 134 135 ? ? ? A . n A 1 135 SER 135 136 ? ? ? A . n A 1 136 ALA 136 137 ? ? ? A . n A 1 137 ALA 137 138 ? ? ? A . n A 1 138 SER 138 139 ? ? ? A . n A 1 139 ILE 139 140 ? ? ? A . n A 1 140 ASP 140 141 ? ? ? A . n A 1 141 ALA 141 142 ? ? ? A . n A 1 142 ALA 142 143 ? ? ? A . n A 1 143 LYS 143 144 ? ? ? A . n A 1 144 LYS 144 145 ? ? ? A . n A 1 145 ALA 145 146 ? ? ? A . n A 1 146 GLY 146 147 ? ? ? A . n A 1 147 VAL 147 148 ? ? ? A . n A 1 148 ASN 148 149 ? ? ? A . n A 1 149 ASN 149 150 ? ? ? A . n A 1 150 GLY 150 151 ? ? ? A . n A 1 151 ASN 151 152 ? ? ? A . n A 1 152 PRO 152 153 ? ? ? A . n A 1 153 LEU 153 154 ? ? ? A . n A 1 154 ASP 154 155 ? ? ? A . n A 1 155 ALA 155 156 ? ? ? A . n A 1 156 VAL 156 157 ? ? ? A . n A 1 157 GLN 157 158 ? ? ? A . n A 1 158 GLN 158 159 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email nico.igareta@unibas.ch _pdbx_contact_author.name_first Nico _pdbx_contact_author.name_last Igareta _pdbx_contact_author.name_mi V _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8767-3456 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NOF 1 201 201 NOF LIG A . C 3 SO4 1 202 1 SO4 SO4 A . D 3 SO4 1 203 2 SO4 SO4 A . E 4 HOH 1 301 12 HOH HOH A . E 4 HOH 2 302 1 HOH HOH A . E 4 HOH 3 303 11 HOH HOH A . E 4 HOH 4 304 5 HOH HOH A . E 4 HOH 5 305 13 HOH HOH A . E 4 HOH 6 306 8 HOH HOH A . E 4 HOH 7 307 2 HOH HOH A . E 4 HOH 8 308 7 HOH HOH A . E 4 HOH 9 309 6 HOH HOH A . E 4 HOH 10 310 9 HOH HOH A . E 4 HOH 11 311 10 HOH HOH A . E 4 HOH 12 312 3 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 10760 ? 1 MORE -112 ? 1 'SSA (A^2)' 18220 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z 0.0000000000 -1.0000000000 0.0000000000 57.4280000000 -1.0000000000 0.0000000000 0.0000000000 57.4280000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 10_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 57.4280000000 0.0000000000 -1.0000000000 0.0000000000 57.4280000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 15_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id SO4 _pdbx_struct_special_symmetry.auth_seq_id 203 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id SO4 _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-12-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0352 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . 5 # _pdbx_entry_details.entry_id 8BY0 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A GLU 51 ? ? HH A TYR 54 ? ? 1.27 2 1 C A LYS 134 ? ? O A HOH 303 ? ? 2.16 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 LYS _pdbx_validate_rmsd_bond.auth_seq_id_1 134 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CD _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 LYS _pdbx_validate_rmsd_bond.auth_seq_id_2 134 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.847 _pdbx_validate_rmsd_bond.bond_target_value 1.520 _pdbx_validate_rmsd_bond.bond_deviation 0.327 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.034 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A ARG 53 ? ? CD A ARG 53 ? ? NE A ARG 53 ? A 79.84 111.80 -31.96 2.10 N 2 1 CG A ARG 53 ? ? CD A ARG 53 ? ? NE A ARG 53 ? B 77.43 111.80 -34.37 2.10 N 3 1 CB A LYS 134 ? ? CA A LYS 134 ? ? C A LYS 134 ? ? 69.97 110.40 -40.43 2.00 N 4 1 CB A LYS 134 ? ? CG A LYS 134 ? ? CD A LYS 134 ? ? 156.14 111.60 44.54 2.60 N 5 1 CG A LYS 134 ? ? CD A LYS 134 ? ? CE A LYS 134 ? ? 71.91 111.90 -39.99 3.00 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 52 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 68.08 _pdbx_validate_torsion.psi -153.75 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 53 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.092 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A LYS 134 ? C ? A LYS 133 C 2 1 Y 0 A LYS 134 ? O ? A LYS 133 O 3 1 Y 0 A LYS 134 ? CD ? A LYS 133 CD 4 1 Y 0 A LYS 134 ? CE ? A LYS 133 CE 5 1 Y 0 A LYS 134 ? NZ ? A LYS 133 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 2 ? A ALA 1 2 1 Y 1 A SER 3 ? A SER 2 3 1 Y 1 A MET 4 ? A MET 3 4 1 Y 1 A THR 5 ? A THR 4 5 1 Y 1 A GLY 6 ? A GLY 5 6 1 Y 1 A GLY 7 ? A GLY 6 7 1 Y 1 A GLN 8 ? A GLN 7 8 1 Y 1 A GLN 9 ? A GLN 8 9 1 Y 1 A MET 10 ? A MET 9 10 1 Y 1 A GLY 11 ? A GLY 10 11 1 Y 1 A PRO 135 ? A PRO 134 12 1 Y 1 A SER 136 ? A SER 135 13 1 Y 1 A ALA 137 ? A ALA 136 14 1 Y 1 A ALA 138 ? A ALA 137 15 1 Y 1 A SER 139 ? A SER 138 16 1 Y 1 A ILE 140 ? A ILE 139 17 1 Y 1 A ASP 141 ? A ASP 140 18 1 Y 1 A ALA 142 ? A ALA 141 19 1 Y 1 A ALA 143 ? A ALA 142 20 1 Y 1 A LYS 144 ? A LYS 143 21 1 Y 1 A LYS 145 ? A LYS 144 22 1 Y 1 A ALA 146 ? A ALA 145 23 1 Y 1 A GLY 147 ? A GLY 146 24 1 Y 1 A VAL 148 ? A VAL 147 25 1 Y 1 A ASN 149 ? A ASN 148 26 1 Y 1 A ASN 150 ? A ASN 149 27 1 Y 1 A GLY 151 ? A GLY 150 28 1 Y 1 A ASN 152 ? A ASN 151 29 1 Y 1 A PRO 153 ? A PRO 152 30 1 Y 1 A LEU 154 ? A LEU 153 31 1 Y 1 A ASP 155 ? A ASP 154 32 1 Y 1 A ALA 156 ? A ALA 155 33 1 Y 1 A VAL 157 ? A VAL 156 34 1 Y 1 A GLN 158 ? A GLN 157 35 1 Y 1 A GLN 159 ? A GLN 158 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 NOF N1 N Y N 236 NOF N3 N N N 237 NOF C4 C N N 238 NOF C5 C N N 239 NOF C6 C N N 240 NOF C7 C N N 241 NOF C8 C N N 242 NOF C10 C N N 243 NOF C13 C Y N 244 NOF C15 C Y N 245 NOF C17 C Y N 246 NOF C20 C N N 247 NOF C21 C N N 248 NOF C22 C N N 249 NOF C24 C N N 250 NOF C26 C N S 251 NOF C28 C N R 252 NOF C1 C N N 253 NOF C2 C N N 254 NOF C3 C N N 255 NOF C9 C N N 256 NOF C11 C Y N 257 NOF C12 C Y N 258 NOF IR1 IR N N 259 NOF C14 C Y N 260 NOF C16 C Y N 261 NOF C18 C Y N 262 NOF C19 C Y N 263 NOF N2 N N N 264 NOF O1 O N N 265 NOF C23 C N N 266 NOF C25 C N S 267 NOF S1 S N N 268 NOF C27 C N N 269 NOF N4 N N N 270 NOF C29 C N N 271 NOF O2 O N N 272 NOF N5 N N N 273 NOF C30 C N N 274 NOF O3 O N N 275 NOF O4 O N N 276 NOF C31 C N N 277 NOF C32 C N N 278 NOF C33 C N N 279 NOF C34 C N N 280 NOF CL46 CL N N 281 NOF H1 H N N 282 NOF H2 H N N 283 NOF H3 H N N 284 NOF H4 H N N 285 NOF H5 H N N 286 NOF H6 H N N 287 NOF H7 H N N 288 NOF H8 H N N 289 NOF H9 H N N 290 NOF H10 H N N 291 NOF H11 H N N 292 NOF H12 H N N 293 NOF H13 H N N 294 NOF H14 H N N 295 NOF H15 H N N 296 NOF H16 H N N 297 NOF H17 H N N 298 NOF H18 H N N 299 NOF H19 H N N 300 NOF H20 H N N 301 NOF H21 H N N 302 NOF H22 H N N 303 NOF H23 H N N 304 NOF H24 H N N 305 NOF H25 H N N 306 NOF H26 H N N 307 NOF H27 H N N 308 NOF H28 H N N 309 NOF H29 H N N 310 NOF H30 H N N 311 NOF H31 H N N 312 NOF H32 H N N 313 NOF H33 H N N 314 NOF H34 H N N 315 NOF H35 H N N 316 NOF H36 H N N 317 NOF H37 H N N 318 NOF H38 H N N 319 NOF H39 H N N 320 NOF H40 H N N 321 NOF H41 H N N 322 NOF H42 H N N 323 NOF H43 H N N 324 NOF H44 H N N 325 NOF H45 H N N 326 PHE N N N N 327 PHE CA C N S 328 PHE C C N N 329 PHE O O N N 330 PHE CB C N N 331 PHE CG C Y N 332 PHE CD1 C Y N 333 PHE CD2 C Y N 334 PHE CE1 C Y N 335 PHE CE2 C Y N 336 PHE CZ C Y N 337 PHE OXT O N N 338 PHE H H N N 339 PHE H2 H N N 340 PHE HA H N N 341 PHE HB2 H N N 342 PHE HB3 H N N 343 PHE HD1 H N N 344 PHE HD2 H N N 345 PHE HE1 H N N 346 PHE HE2 H N N 347 PHE HZ H N N 348 PHE HXT H N N 349 PRO N N N N 350 PRO CA C N S 351 PRO C C N N 352 PRO O O N N 353 PRO CB C N N 354 PRO CG C N N 355 PRO CD C N N 356 PRO OXT O N N 357 PRO H H N N 358 PRO HA H N N 359 PRO HB2 H N N 360 PRO HB3 H N N 361 PRO HG2 H N N 362 PRO HG3 H N N 363 PRO HD2 H N N 364 PRO HD3 H N N 365 PRO HXT H N N 366 SER N N N N 367 SER CA C N S 368 SER C C N N 369 SER O O N N 370 SER CB C N N 371 SER OG O N N 372 SER OXT O N N 373 SER H H N N 374 SER H2 H N N 375 SER HA H N N 376 SER HB2 H N N 377 SER HB3 H N N 378 SER HG H N N 379 SER HXT H N N 380 SO4 S S N N 381 SO4 O1 O N N 382 SO4 O2 O N N 383 SO4 O3 O N N 384 SO4 O4 O N N 385 THR N N N N 386 THR CA C N S 387 THR C C N N 388 THR O O N N 389 THR CB C N R 390 THR OG1 O N N 391 THR CG2 C N N 392 THR OXT O N N 393 THR H H N N 394 THR H2 H N N 395 THR HA H N N 396 THR HB H N N 397 THR HG1 H N N 398 THR HG21 H N N 399 THR HG22 H N N 400 THR HG23 H N N 401 THR HXT H N N 402 TRP N N N N 403 TRP CA C N S 404 TRP C C N N 405 TRP O O N N 406 TRP CB C N N 407 TRP CG C Y N 408 TRP CD1 C Y N 409 TRP CD2 C Y N 410 TRP NE1 N Y N 411 TRP CE2 C Y N 412 TRP CE3 C Y N 413 TRP CZ2 C Y N 414 TRP CZ3 C Y N 415 TRP CH2 C Y N 416 TRP OXT O N N 417 TRP H H N N 418 TRP H2 H N N 419 TRP HA H N N 420 TRP HB2 H N N 421 TRP HB3 H N N 422 TRP HD1 H N N 423 TRP HE1 H N N 424 TRP HE3 H N N 425 TRP HZ2 H N N 426 TRP HZ3 H N N 427 TRP HH2 H N N 428 TRP HXT H N N 429 TYR N N N N 430 TYR CA C N S 431 TYR C C N N 432 TYR O O N N 433 TYR CB C N N 434 TYR CG C Y N 435 TYR CD1 C Y N 436 TYR CD2 C Y N 437 TYR CE1 C Y N 438 TYR CE2 C Y N 439 TYR CZ C Y N 440 TYR OH O N N 441 TYR OXT O N N 442 TYR H H N N 443 TYR H2 H N N 444 TYR HA H N N 445 TYR HB2 H N N 446 TYR HB3 H N N 447 TYR HD1 H N N 448 TYR HD2 H N N 449 TYR HE1 H N N 450 TYR HE2 H N N 451 TYR HH H N N 452 TYR HXT H N N 453 VAL N N N N 454 VAL CA C N S 455 VAL C C N N 456 VAL O O N N 457 VAL CB C N N 458 VAL CG1 C N N 459 VAL CG2 C N N 460 VAL OXT O N N 461 VAL H H N N 462 VAL H2 H N N 463 VAL HA H N N 464 VAL HB H N N 465 VAL HG11 H N N 466 VAL HG12 H N N 467 VAL HG13 H N N 468 VAL HG21 H N N 469 VAL HG22 H N N 470 VAL HG23 H N N 471 VAL HXT H N N 472 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 NOF N1 C12 sing Y N 224 NOF N1 IR1 sing N N 225 NOF N1 C18 doub Y N 226 NOF N3 C26 sing N N 227 NOF N3 C29 sing N N 228 NOF C4 C3 sing N N 229 NOF C5 C6 sing N N 230 NOF C5 C7 sing N N 231 NOF C5 C3 sing N N 232 NOF C5 IR1 sing N N 233 NOF C7 C8 sing N N 234 NOF C7 C9 sing N N 235 NOF C7 IR1 sing N N 236 NOF C10 C9 sing N N 237 NOF C13 C15 sing Y N 238 NOF C13 C11 doub Y N 239 NOF C15 C16 doub Y N 240 NOF C17 C14 sing Y N 241 NOF C17 C19 doub Y N 242 NOF C20 C21 sing N N 243 NOF C20 N2 sing N N 244 NOF C20 O1 doub N N 245 NOF C21 C22 sing N N 246 NOF C22 C23 sing N N 247 NOF C24 C23 sing N N 248 NOF C24 C25 sing N N 249 NOF C26 C28 sing N N 250 NOF C26 C25 sing N N 251 NOF C28 C27 sing N N 252 NOF C28 N4 sing N N 253 NOF C1 C2 sing N N 254 NOF C1 C3 sing N N 255 NOF C1 C9 sing N N 256 NOF C1 IR1 sing N N 257 NOF C3 IR1 sing N N 258 NOF C9 IR1 sing N N 259 NOF C11 C12 sing Y N 260 NOF C11 N5 sing N N 261 NOF C12 C14 doub Y N 262 NOF IR1 N5 sing N N 263 NOF C14 C16 sing Y N 264 NOF C16 N2 sing N N 265 NOF C18 C19 sing Y N 266 NOF C25 S1 sing N N 267 NOF S1 C27 sing N N 268 NOF N4 C29 sing N N 269 NOF C29 O2 doub N N 270 NOF N5 C30 sing N N 271 NOF C30 O3 doub N N 272 NOF C30 O4 sing N N 273 NOF O4 C31 sing N N 274 NOF C31 C32 sing N N 275 NOF C31 C33 sing N N 276 NOF C31 C34 sing N N 277 NOF IR1 CL46 sing N N 278 NOF N3 H1 sing N N 279 NOF C4 H2 sing N N 280 NOF C4 H3 sing N N 281 NOF C4 H4 sing N N 282 NOF C6 H5 sing N N 283 NOF C6 H6 sing N N 284 NOF C6 H7 sing N N 285 NOF C8 H8 sing N N 286 NOF C8 H9 sing N N 287 NOF C8 H10 sing N N 288 NOF C10 H11 sing N N 289 NOF C10 H12 sing N N 290 NOF C10 H13 sing N N 291 NOF C13 H14 sing N N 292 NOF C15 H15 sing N N 293 NOF C17 H16 sing N N 294 NOF C21 H17 sing N N 295 NOF C21 H18 sing N N 296 NOF C22 H19 sing N N 297 NOF C22 H20 sing N N 298 NOF C24 H21 sing N N 299 NOF C24 H22 sing N N 300 NOF C26 H23 sing N N 301 NOF C28 H24 sing N N 302 NOF C2 H25 sing N N 303 NOF C2 H26 sing N N 304 NOF C2 H27 sing N N 305 NOF C18 H28 sing N N 306 NOF C19 H29 sing N N 307 NOF N2 H30 sing N N 308 NOF C23 H31 sing N N 309 NOF C23 H32 sing N N 310 NOF C25 H33 sing N N 311 NOF C27 H34 sing N N 312 NOF C27 H35 sing N N 313 NOF N4 H36 sing N N 314 NOF C32 H37 sing N N 315 NOF C32 H38 sing N N 316 NOF C32 H39 sing N N 317 NOF C33 H40 sing N N 318 NOF C33 H41 sing N N 319 NOF C33 H42 sing N N 320 NOF C34 H43 sing N N 321 NOF C34 H44 sing N N 322 NOF C34 H45 sing N N 323 PHE N CA sing N N 324 PHE N H sing N N 325 PHE N H2 sing N N 326 PHE CA C sing N N 327 PHE CA CB sing N N 328 PHE CA HA sing N N 329 PHE C O doub N N 330 PHE C OXT sing N N 331 PHE CB CG sing N N 332 PHE CB HB2 sing N N 333 PHE CB HB3 sing N N 334 PHE CG CD1 doub Y N 335 PHE CG CD2 sing Y N 336 PHE CD1 CE1 sing Y N 337 PHE CD1 HD1 sing N N 338 PHE CD2 CE2 doub Y N 339 PHE CD2 HD2 sing N N 340 PHE CE1 CZ doub Y N 341 PHE CE1 HE1 sing N N 342 PHE CE2 CZ sing Y N 343 PHE CE2 HE2 sing N N 344 PHE CZ HZ sing N N 345 PHE OXT HXT sing N N 346 PRO N CA sing N N 347 PRO N CD sing N N 348 PRO N H sing N N 349 PRO CA C sing N N 350 PRO CA CB sing N N 351 PRO CA HA sing N N 352 PRO C O doub N N 353 PRO C OXT sing N N 354 PRO CB CG sing N N 355 PRO CB HB2 sing N N 356 PRO CB HB3 sing N N 357 PRO CG CD sing N N 358 PRO CG HG2 sing N N 359 PRO CG HG3 sing N N 360 PRO CD HD2 sing N N 361 PRO CD HD3 sing N N 362 PRO OXT HXT sing N N 363 SER N CA sing N N 364 SER N H sing N N 365 SER N H2 sing N N 366 SER CA C sing N N 367 SER CA CB sing N N 368 SER CA HA sing N N 369 SER C O doub N N 370 SER C OXT sing N N 371 SER CB OG sing N N 372 SER CB HB2 sing N N 373 SER CB HB3 sing N N 374 SER OG HG sing N N 375 SER OXT HXT sing N N 376 SO4 S O1 doub N N 377 SO4 S O2 doub N N 378 SO4 S O3 sing N N 379 SO4 S O4 sing N N 380 THR N CA sing N N 381 THR N H sing N N 382 THR N H2 sing N N 383 THR CA C sing N N 384 THR CA CB sing N N 385 THR CA HA sing N N 386 THR C O doub N N 387 THR C OXT sing N N 388 THR CB OG1 sing N N 389 THR CB CG2 sing N N 390 THR CB HB sing N N 391 THR OG1 HG1 sing N N 392 THR CG2 HG21 sing N N 393 THR CG2 HG22 sing N N 394 THR CG2 HG23 sing N N 395 THR OXT HXT sing N N 396 TRP N CA sing N N 397 TRP N H sing N N 398 TRP N H2 sing N N 399 TRP CA C sing N N 400 TRP CA CB sing N N 401 TRP CA HA sing N N 402 TRP C O doub N N 403 TRP C OXT sing N N 404 TRP CB CG sing N N 405 TRP CB HB2 sing N N 406 TRP CB HB3 sing N N 407 TRP CG CD1 doub Y N 408 TRP CG CD2 sing Y N 409 TRP CD1 NE1 sing Y N 410 TRP CD1 HD1 sing N N 411 TRP CD2 CE2 doub Y N 412 TRP CD2 CE3 sing Y N 413 TRP NE1 CE2 sing Y N 414 TRP NE1 HE1 sing N N 415 TRP CE2 CZ2 sing Y N 416 TRP CE3 CZ3 doub Y N 417 TRP CE3 HE3 sing N N 418 TRP CZ2 CH2 doub Y N 419 TRP CZ2 HZ2 sing N N 420 TRP CZ3 CH2 sing Y N 421 TRP CZ3 HZ3 sing N N 422 TRP CH2 HH2 sing N N 423 TRP OXT HXT sing N N 424 TYR N CA sing N N 425 TYR N H sing N N 426 TYR N H2 sing N N 427 TYR CA C sing N N 428 TYR CA CB sing N N 429 TYR CA HA sing N N 430 TYR C O doub N N 431 TYR C OXT sing N N 432 TYR CB CG sing N N 433 TYR CB HB2 sing N N 434 TYR CB HB3 sing N N 435 TYR CG CD1 doub Y N 436 TYR CG CD2 sing Y N 437 TYR CD1 CE1 sing Y N 438 TYR CD1 HD1 sing N N 439 TYR CD2 CE2 doub Y N 440 TYR CD2 HD2 sing N N 441 TYR CE1 CZ doub Y N 442 TYR CE1 HE1 sing N N 443 TYR CE2 CZ sing Y N 444 TYR CE2 HE2 sing N N 445 TYR CZ OH sing N N 446 TYR OH HH sing N N 447 TYR OXT HXT sing N N 448 VAL N CA sing N N 449 VAL N H sing N N 450 VAL N H2 sing N N 451 VAL CA C sing N N 452 VAL CA CB sing N N 453 VAL CA HA sing N N 454 VAL C O doub N N 455 VAL C OXT sing N N 456 VAL CB CG1 sing N N 457 VAL CB CG2 sing N N 458 VAL CB HB sing N N 459 VAL CG1 HG11 sing N N 460 VAL CG1 HG12 sing N N 461 VAL CG1 HG13 sing N N 462 VAL CG2 HG21 sing N N 463 VAL CG2 HG22 sing N N 464 VAL CG2 HG23 sing N N 465 VAL OXT HXT sing N N 466 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NOF _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NOF _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;tert-butyl 7'-[5-[(3aS,4S,6aR)-2-oxidanylidene-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoylamino]-1-chloranyl-2,3,4,5,6-pentamethyl-spiro[1$l^{8}-iridapentacyclo[2.2.0.0^{1,3}.0^{1,5}.0^{2,6}]hexane-1,2'-3-aza-1-azonia-2$l^{8}-iridatricyclo[6.3.1.0^{4,12}]dodeca-1(11),4,6,8(12),9-pentaene]-3'-carboxylate ; NOF 3 'SULFATE ION' SO4 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2bc3 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ? #