data_8C7K # _entry.id 8C7K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.367 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8C7K pdb_00008c7k 10.2210/pdb8c7k/pdb WWPDB D_1292127867 ? ? BMRB 27917 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 27917 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8C7K _pdbx_database_status.recvd_initial_deposition_date 2023-01-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Prolic-Kalinsek, M.' 1 0000-0003-4175-1858 'Volkov, A.N.' 2 0000-0002-0103-059X 'Loris, R.' 3 0000-0002-8862-3338 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? ? ? ? primary 'Acta Crystallogr D Struct Biol' ? ? 2059-7983 ? ? 79 ? 245 258 ;Structural basis of DNA binding by YdaT, a functional equivalent of the CII repressor in the cryptic prophage CP-933P from Escherichia coli O157:H7. ; 2023 ? 10.1107/S2059798323001249 36876434 ? ? ? ? ? ? ? ? ? NE ? ? 1 'Biomolecular NMR Assignments' ? ? 1874-2718 ? ? 14 ? 25 30 '1H, 13C, and 15N backbone and side chain chemical shift assignment of YdaS, a monomeric member of the HigA family' 2020 ? 10.1007/s12104-019-09915-9 31625047 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Prolic-Kalinsek, M.' 1 0000-0003-4175-1858 primary 'Volkov, A.N.' 2 0000-0002-0103-059X primary 'Hadzi, S.' 3 ? primary 'Van Dyck, J.' 4 0000-0003-2233-0687 primary 'Bervoets, I.' 5 0000-0002-1402-7517 primary 'Charlier, D.' 6 0000-0002-6844-376X primary 'Loris, R.' 7 0000-0002-8862-3338 1 'Prolic-Kalinsek, M.' 8 0000-0003-4175-1858 1 'De Bruyn, P.' 9 0000-0001-7126-6103 1 'Jurenas, D.' 10 0000-0003-1660-1524 1 'Van Melderen, L.' 11 0000-0002-7778-1736 1 'Loris, R.' 12 0000-0002-8862-3338 1 'Volkov, A.' 13 0000-0002-0103-059X # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Phage antirepressor protein Cro' _entity.formula_weight 11922.402 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTLKEFIKSLRVGDAKKFAARLGVSPSYLSQMASGRTAISPTRALMIESATEGQVSRAELRPHDWELIWPEYASGIRLGQ THVVHAEGDCSACLSDGVDSGSSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MTLKEFIKSLRVGDAKKFAARLGVSPSYLSQMASGRTAISPTRALMIESATEGQVSRAELRPHDWELIWPEYASGIRLGQ THVVHAEGDCSACLSDGVDSGSSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 LEU n 1 4 LYS n 1 5 GLU n 1 6 PHE n 1 7 ILE n 1 8 LYS n 1 9 SER n 1 10 LEU n 1 11 ARG n 1 12 VAL n 1 13 GLY n 1 14 ASP n 1 15 ALA n 1 16 LYS n 1 17 LYS n 1 18 PHE n 1 19 ALA n 1 20 ALA n 1 21 ARG n 1 22 LEU n 1 23 GLY n 1 24 VAL n 1 25 SER n 1 26 PRO n 1 27 SER n 1 28 TYR n 1 29 LEU n 1 30 SER n 1 31 GLN n 1 32 MET n 1 33 ALA n 1 34 SER n 1 35 GLY n 1 36 ARG n 1 37 THR n 1 38 ALA n 1 39 ILE n 1 40 SER n 1 41 PRO n 1 42 THR n 1 43 ARG n 1 44 ALA n 1 45 LEU n 1 46 MET n 1 47 ILE n 1 48 GLU n 1 49 SER n 1 50 ALA n 1 51 THR n 1 52 GLU n 1 53 GLY n 1 54 GLN n 1 55 VAL n 1 56 SER n 1 57 ARG n 1 58 ALA n 1 59 GLU n 1 60 LEU n 1 61 ARG n 1 62 PRO n 1 63 HIS n 1 64 ASP n 1 65 TRP n 1 66 GLU n 1 67 LEU n 1 68 ILE n 1 69 TRP n 1 70 PRO n 1 71 GLU n 1 72 TYR n 1 73 ALA n 1 74 SER n 1 75 GLY n 1 76 ILE n 1 77 ARG n 1 78 LEU n 1 79 GLY n 1 80 GLN n 1 81 THR n 1 82 HIS n 1 83 VAL n 1 84 VAL n 1 85 HIS n 1 86 ALA n 1 87 GLU n 1 88 GLY n 1 89 ASP n 1 90 CYS n 1 91 SER n 1 92 ALA n 1 93 CYS n 1 94 LEU n 1 95 SER n 1 96 ASP n 1 97 GLY n 1 98 VAL n 1 99 ASP n 1 100 SER n 1 101 GLY n 1 102 SER n 1 103 SER n 1 104 HIS n 1 105 HIS n 1 106 HIS n 1 107 HIS n 1 108 HIS n 1 109 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 109 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ECs_2278 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli O157:H7' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83334 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8XAD7_ECO57 _struct_ref.pdbx_db_accession Q8XAD7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTLKEFIKSLRVGDAKKFAARLGVSPSYLSQMASGRTAISPTRALMIESATEGQVSRAELRPHDWELIWPEYASGIRLGQ THVVHAEGDCSACLSDGVDS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8C7K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 100 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8XAD7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 100 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 100 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8C7K GLY A 101 ? UNP Q8XAD7 ? ? 'expression tag' 101 1 1 8C7K SER A 102 ? UNP Q8XAD7 ? ? 'expression tag' 102 2 1 8C7K SER A 103 ? UNP Q8XAD7 ? ? 'expression tag' 103 3 1 8C7K HIS A 104 ? UNP Q8XAD7 ? ? 'expression tag' 104 4 1 8C7K HIS A 105 ? UNP Q8XAD7 ? ? 'expression tag' 105 5 1 8C7K HIS A 106 ? UNP Q8XAD7 ? ? 'expression tag' 106 6 1 8C7K HIS A 107 ? UNP Q8XAD7 ? ? 'expression tag' 107 7 1 8C7K HIS A 108 ? UNP Q8XAD7 ? ? 'expression tag' 108 8 1 8C7K HIS A 109 ? UNP Q8XAD7 ? ? 'expression tag' 109 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCACB' 1 isotropic 3 1 1 '3D HN(COCA)CB' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HN(CA)CO' 1 isotropic 6 1 1 '3D HBHA(CO)NH' 1 isotropic 7 1 1 '3D HCCH-TOCSY' 1 isotropic 8 1 1 '3D HCCH-TOCSY' 1 isotropic 9 1 1 '2D 1H-13C HSQC' 1 isotropic 10 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 11 1 1 '3D 1H-15N NOESY' 1 isotropic 12 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 13 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic 14 1 1 '2D (HB)CB(CGCD)HD' 1 isotropic 15 1 1 '2D (HB)CB(CGCDCE)HE' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 165 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'condition 1' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM [U-100% 13C; U-100% 15N] YdaS, 20 mM sodium phosphate, 150 mM sodium chloride, 10 % [U-100% 2H] D2O, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 'sample 1' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 8C7K 'simulated annealing' ? 8 8C7K 'torsion angle dynamics' ? 10 # _pdbx_nmr_ensemble.entry_id 8C7K _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8C7K _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing TopSpin ? 'Bruker Biospin' 3 processing MddNMR ? 'Orekhov et al.' 4 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 5 'data analysis' 'CcpNmr Analysis' ? CCPN 6 'peak picking' 'CcpNmr Analysis' ? CCPN 7 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 8 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 9 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 10 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8C7K _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8C7K _struct.title 'YdaS from E. coli O157:H7 cryptic prophage CP-933P' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8C7K _struct_keywords.text 'Cro repressor, Helix-Turn-helix, Prophage, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 2 ? LEU A 10 ? THR A 2 LEU A 10 1 ? 9 HELX_P HELX_P2 AA2 ARG A 11 ? GLY A 23 ? ARG A 11 GLY A 23 1 ? 13 HELX_P HELX_P3 AA3 SER A 25 ? GLY A 35 ? SER A 25 GLY A 35 1 ? 11 HELX_P HELX_P4 AA4 SER A 40 ? GLU A 52 ? SER A 40 GLU A 52 1 ? 13 HELX_P HELX_P5 AA5 SER A 56 ? ARG A 61 ? SER A 56 ARG A 61 1 ? 6 HELX_P HELX_P6 AA6 ASP A 64 ? TRP A 69 ? ASP A 64 TRP A 69 1 ? 6 HELX_P HELX_P7 AA7 TRP A 69 ? LEU A 78 ? TRP A 69 LEU A 78 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 8C7K _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 TRP 65 65 65 TRP TRP A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 TRP 69 69 69 TRP TRP A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 CYS 93 93 93 CYS CYS A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 HIS 109 109 109 HIS HIS A . n # _pdbx_contact_author.id 3 _pdbx_contact_author.email remy.loris@vub.be _pdbx_contact_author.name_first Remy _pdbx_contact_author.name_last Loris _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8862-3338 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-01-25 2 'Structure model' 1 1 2023-03-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 YdaS 1 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 150 ? mM 'natural abundance' 1 D2O 10 ? % '[U-100% 2H]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 52 ? ? 53.91 9.11 2 2 GLU A 52 ? ? 52.29 12.62 3 3 GLU A 52 ? ? 53.94 9.90 4 3 GLN A 54 ? ? -109.82 -64.97 5 3 THR A 81 ? ? -84.77 30.88 6 3 ASP A 89 ? ? -135.41 -141.43 7 4 GLU A 52 ? ? 53.07 11.15 8 4 GLN A 54 ? ? -112.20 -74.46 9 4 CYS A 93 ? ? 57.94 9.72 10 4 LEU A 94 ? ? 35.88 41.76 11 5 GLU A 52 ? ? 57.76 0.92 12 5 GLN A 54 ? ? -108.60 -66.09 13 5 LEU A 94 ? ? -157.31 32.00 14 6 GLU A 52 ? ? 53.68 11.34 15 7 GLU A 52 ? ? 54.05 9.35 16 7 GLN A 54 ? ? -113.93 -72.08 17 8 ARG A 36 ? ? -96.52 30.10 18 8 GLU A 52 ? ? 52.91 13.57 19 9 ARG A 36 ? ? -96.83 32.80 20 9 GLU A 52 ? ? 54.98 6.84 21 10 GLU A 52 ? ? 54.84 5.91 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Research Foundation - Flanders (FWO)' Belgium G.0033.20N 1 'Research Foundation - Flanders (FWO)' Belgium G.0226.17N 2 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #