data_8CJ3 # _entry.id 8CJ3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8CJ3 pdb_00008cj3 10.2210/pdb8cj3/pdb WWPDB D_1292127602 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8CJ3 _pdbx_database_status.recvd_initial_deposition_date 2023-02-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Perrin, M.E.' 1 0000-0002-5917-5177 'Li, B.' 2 0000-0003-4615-6898 'Mbianda, J.' 3 0000-0003-2855-573X 'Ropars, V.' 4 0000-0002-3372-6030 'Legrand, P.' 5 0000-0003-2431-2255 'Douat, C.' 6 0000-0003-2678-1047 'Ochsenbein, F.' 7 0000-0002-9027-4384 'Guichard, G.' 8 0000-0002-2584-7502 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem.Commun.(Camb.)' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1364-548X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 59 _citation.language ? _citation.page_first 8696 _citation.page_last 8699 _citation.title 'Unexpected binding modes of inhibitors to the histone chaperone ASF1 revealed by a foldamer scanning approach.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/d3cc01891a _citation.pdbx_database_id_PubMed 37347155 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Perrin, M.E.' 1 ? primary 'Li, B.' 2 ? primary 'Mbianda, J.' 3 ? primary 'Bakail, M.' 4 ? primary 'Andre, C.' 5 ? primary 'Moal, G.' 6 ? primary 'Legrand, P.' 7 ? primary 'Ropars, V.' 8 ? primary 'Douat, C.' 9 ? primary 'Ochsenbein, F.' 10 ? primary 'Guichard, G.' 11 ? # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 120 _cell.angle_gamma_esd ? _cell.entry_id 8CJ3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 133.906 _cell.length_a_esd ? _cell.length_b 133.906 _cell.length_b_esd ? _cell.length_c 63.429 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8CJ3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 172 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histone chaperone ASF1A' 17927.998 1 ? ? ? 'Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly' 2 polymer syn 'c3u_7 chimera inhibitor of histone chaperone ASF1' 1379.699 1 ? ? ? 'Sequence of a short peptide-oligourea chimera known to bind ASF1' 3 water nat water 18.015 16 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Anti-silencing function protein 1 homolog A,hAsf1a,CCG1-interacting factor A,hCIA' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GAMAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADA PNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDN ; ;GAMAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADA PNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDN ; A ? 2 'polypeptide(L)' no yes '(ACE)EK(ALN)ARL(QQ8)(OUR)(OUI)A(NH2)' XEKAARLQXXAX B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 ALA n 1 5 LYS n 1 6 VAL n 1 7 GLN n 1 8 VAL n 1 9 ASN n 1 10 ASN n 1 11 VAL n 1 12 VAL n 1 13 VAL n 1 14 LEU n 1 15 ASP n 1 16 ASN n 1 17 PRO n 1 18 SER n 1 19 PRO n 1 20 PHE n 1 21 TYR n 1 22 ASN n 1 23 PRO n 1 24 PHE n 1 25 GLN n 1 26 PHE n 1 27 GLU n 1 28 ILE n 1 29 THR n 1 30 PHE n 1 31 GLU n 1 32 CYS n 1 33 ILE n 1 34 GLU n 1 35 ASP n 1 36 LEU n 1 37 SER n 1 38 GLU n 1 39 ASP n 1 40 LEU n 1 41 GLU n 1 42 TRP n 1 43 LYS n 1 44 ILE n 1 45 ILE n 1 46 TYR n 1 47 VAL n 1 48 GLY n 1 49 SER n 1 50 ALA n 1 51 GLU n 1 52 SER n 1 53 GLU n 1 54 GLU n 1 55 TYR n 1 56 ASP n 1 57 GLN n 1 58 VAL n 1 59 LEU n 1 60 ASP n 1 61 SER n 1 62 VAL n 1 63 LEU n 1 64 VAL n 1 65 GLY n 1 66 PRO n 1 67 VAL n 1 68 PRO n 1 69 ALA n 1 70 GLY n 1 71 ARG n 1 72 HIS n 1 73 MET n 1 74 PHE n 1 75 VAL n 1 76 PHE n 1 77 GLN n 1 78 ALA n 1 79 ASP n 1 80 ALA n 1 81 PRO n 1 82 ASN n 1 83 PRO n 1 84 GLY n 1 85 LEU n 1 86 ILE n 1 87 PRO n 1 88 ASP n 1 89 ALA n 1 90 ASP n 1 91 ALA n 1 92 VAL n 1 93 GLY n 1 94 VAL n 1 95 THR n 1 96 VAL n 1 97 VAL n 1 98 LEU n 1 99 ILE n 1 100 THR n 1 101 CYS n 1 102 THR n 1 103 TYR n 1 104 ARG n 1 105 GLY n 1 106 GLN n 1 107 GLU n 1 108 PHE n 1 109 ILE n 1 110 ARG n 1 111 VAL n 1 112 GLY n 1 113 TYR n 1 114 TYR n 1 115 VAL n 1 116 ASN n 1 117 ASN n 1 118 GLU n 1 119 TYR n 1 120 THR n 1 121 GLU n 1 122 THR n 1 123 GLU n 1 124 LEU n 1 125 ARG n 1 126 GLU n 1 127 ASN n 1 128 PRO n 1 129 PRO n 1 130 VAL n 1 131 LYS n 1 132 PRO n 1 133 ASP n 1 134 PHE n 1 135 SER n 1 136 LYS n 1 137 LEU n 1 138 GLN n 1 139 ARG n 1 140 ASN n 1 141 ILE n 1 142 LEU n 1 143 ALA n 1 144 SER n 1 145 ASN n 1 146 PRO n 1 147 ARG n 1 148 VAL n 1 149 THR n 1 150 ARG n 1 151 PHE n 1 152 HIS n 1 153 ILE n 1 154 ASN n 1 155 TRP n 1 156 GLU n 1 157 ASP n 1 158 ASN n 2 1 ACE n 2 2 GLU n 2 3 LYS n 2 4 ALN n 2 5 ALA n 2 6 ARG n 2 7 LEU n 2 8 QQ8 n 2 9 OUR n 2 10 OUI n 2 11 ALA n 2 12 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 158 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ASF1A, CGI-98, HSPC146' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant Gold _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pETM30 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 12 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP ASF1A_HUMAN Q9Y294 ? 1 ;MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPN PGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDN ; 1 2 PDB 8CJ3 8CJ3 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8CJ3 A 3 ? 158 ? Q9Y294 1 ? 156 ? 1 156 2 2 8CJ3 B 1 ? 12 ? 8CJ3 0 ? 11 ? 0 11 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8CJ3 GLY A 1 ? UNP Q9Y294 ? ? 'expression tag' -1 1 1 8CJ3 ALA A 2 ? UNP Q9Y294 ? ? 'expression tag' 0 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALN 'L-peptide linking' n NAPHTHALEN-2-YL-3-ALANINE ? 'C13 H13 N O2' 215.248 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 OUI non-polymer . '[(2~{S},3~{S})-2-azanyl-3-methyl-pentyl]carbamic acid' ? 'C7 H16 N2 O2' 160.214 OUR non-polymer . '[azanyl-[[(4~{S})-4-azanyl-5-(carboxyamino)pentyl]amino]methylidene]azanium' ? 'C7 H18 N5 O2 1' 204.250 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 QQ8 'L-peptide linking' n '(4~{S})-4-azanyl-5-formamido-pentanamide' ? 'C6 H13 N3 O2' 159.186 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8CJ3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 8.50 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 85.53 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M potassium fluoride 20% (w/v) PEG 3350 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 290.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-06-03 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 0.97857 _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97857 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97857 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 1' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8CJ3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.000 _reflns.d_resolution_low 46.047 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10565 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 80.08 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.42 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.083 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.184 _reflns.pdbx_Rpim_I_all 0.041 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.9990 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.180 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.000 _reflns_shell.d_res_low 3.078 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.132 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 238 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 21.88 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.661 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.5692 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 24.59 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 3.2985 _refine.aniso_B[1][2] 0 _refine.aniso_B[1][3] 0 _refine.aniso_B[2][2] 3.2985 _refine.aniso_B[2][3] 0 _refine.aniso_B[3][3] -6.597 _refine.B_iso_max ? _refine.B_iso_mean 74.51 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.926 _refine.correlation_coeff_Fo_to_Fc_free 0.925 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8CJ3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3 _refine.ls_d_res_low 29.61 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10553 _refine.ls_number_reflns_R_free 545 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 80.1 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2034 _refine.ls_R_factor_R_free 0.2169 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2027 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.251 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.243 _refine.pdbx_overall_SU_R_Blow_DPI 0.322 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.336 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 8CJ3 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.39 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3 _refine_hist.d_res_low 29.61 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 1356 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1340 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1374 ? t_bond_d 2 HARMONIC 'X-RAY DIFFRACTION' ? 0.92 ? 1868 ? t_angle_deg 2 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 488 ? t_dihedral_angle_d 2 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 253 ? t_gen_planes 5 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1374 ? t_it 10 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 172 ? t_chiral_improper_torsion 5 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? 928 ? t_ideal_dist_contact 4 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 3.13 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 15.76 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3 _refine_ls_shell.d_res_low 3.13 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 391 _refine_ls_shell.number_reflns_R_free 28 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.percent_reflns_obs 25.59 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs 0.3122 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3069 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.387 # _struct.entry_id 8CJ3 _struct.title 'Urea-based foldamer inhibitor c3u_7 chimera in complex with ASF1 histone chaperone' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8CJ3 _struct_keywords.text 'Inhibitor, ASF1, Histone, protein-protein interaction, CHAPERONE' _struct_keywords.pdbx_keywords CHAPERONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 52 ? GLU A 54 ? SER A 50 GLU A 52 5 ? 3 HELX_P HELX_P2 AA2 ASN A 82 ? ILE A 86 ? ASN A 80 ILE A 84 5 ? 5 HELX_P HELX_P3 AA3 PRO A 87 ? VAL A 92 ? PRO A 85 VAL A 90 1 ? 6 HELX_P HELX_P4 AA4 GLU A 121 ? ASN A 127 ? GLU A 119 ASN A 125 1 ? 7 HELX_P HELX_P5 AA5 ASP A 133 ? SER A 135 ? ASP A 131 SER A 133 5 ? 3 HELX_P HELX_P6 AA6 GLU B 2 ? ARG B 6 ? GLU B 1 ARG B 5 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ACE 1 C ? ? ? 1_555 B GLU 2 N ? ? B ACE 0 B GLU 1 1_555 ? ? ? ? ? ? ? 1.345 ? ? covale2 covale both ? B LYS 3 C ? ? ? 1_555 B ALN 4 N ? ? B LYS 2 B ALN 3 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale3 covale both ? B ALN 4 C ? ? ? 1_555 B ALA 5 N ? ? B ALN 3 B ALA 4 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale4 covale both ? B LEU 7 C ? ? ? 1_555 B QQ8 8 N ? ? B LEU 6 B QQ8 7 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale5 covale one ? B QQ8 8 C ? ? ? 1_555 B OUR 9 N ? ? B QQ8 7 B OUR 8 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale6 covale both ? B OUR 9 C ? ? ? 1_555 B OUI 10 N ? ? B OUR 8 B OUI 9 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale7 covale both ? B OUI 10 C ? ? ? 1_555 B ALA 11 N ? ? B OUI 9 B ALA 10 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale8 covale both ? B ALA 11 C ? ? ? 1_555 B NH2 12 N ? ? B ALA 10 B NH2 11 1_555 ? ? ? ? ? ? ? 1.325 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 16 A . ? ASN 14 A PRO 17 A ? PRO 15 A 1 -4.10 2 GLY 65 A . ? GLY 63 A PRO 66 A ? PRO 64 A 1 -6.40 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 6 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 6 ? LEU A 14 ? VAL A 4 LEU A 12 AA1 2 PHE A 24 ? CYS A 32 ? PHE A 22 CYS A 30 AA1 3 GLY A 70 ? ALA A 78 ? GLY A 68 ALA A 76 AA2 1 SER A 18 ? PRO A 19 ? SER A 16 PRO A 17 AA2 2 LEU A 137 ? ILE A 141 ? LEU A 135 ILE A 139 AA2 3 GLN A 106 ? TYR A 119 ? GLN A 104 TYR A 117 AA2 4 GLY A 93 ? TYR A 103 ? GLY A 91 TYR A 101 AA2 5 LEU A 40 ? VAL A 47 ? LEU A 38 VAL A 45 AA2 6 ASP A 56 ? VAL A 64 ? ASP A 54 VAL A 62 AA3 1 SER A 18 ? PRO A 19 ? SER A 16 PRO A 17 AA3 2 LEU A 137 ? ILE A 141 ? LEU A 135 ILE A 139 AA3 3 GLN A 106 ? TYR A 119 ? GLN A 104 TYR A 117 AA3 4 ARG A 147 ? ARG A 150 ? ARG A 145 ARG A 148 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 7 ? N GLN A 5 O GLU A 31 ? O GLU A 29 AA1 2 3 N PHE A 30 ? N PHE A 28 O HIS A 72 ? O HIS A 70 AA2 1 2 N SER A 18 ? N SER A 16 O ARG A 139 ? O ARG A 137 AA2 2 3 O GLN A 138 ? O GLN A 136 N GLU A 118 ? N GLU A 116 AA2 3 4 O VAL A 111 ? O VAL A 109 N ILE A 99 ? N ILE A 97 AA2 4 5 O LEU A 98 ? O LEU A 96 N ILE A 45 ? N ILE A 43 AA2 5 6 N LEU A 40 ? N LEU A 38 O VAL A 64 ? O VAL A 62 AA3 1 2 N SER A 18 ? N SER A 16 O ARG A 139 ? O ARG A 137 AA3 2 3 O GLN A 138 ? O GLN A 136 N GLU A 118 ? N GLU A 116 AA3 3 4 N GLY A 112 ? N GLY A 110 O ARG A 147 ? O ARG A 145 # _atom_sites.entry_id 8CJ3 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.007468 _atom_sites.fract_transf_matrix[1][2] 0.004312 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008623 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015766 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 ALA 2 0 ? ? ? A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 ALA 4 2 2 ALA ALA A . n A 1 5 LYS 5 3 3 LYS LYS A . n A 1 6 VAL 6 4 4 VAL VAL A . n A 1 7 GLN 7 5 5 GLN GLN A . n A 1 8 VAL 8 6 6 VAL VAL A . n A 1 9 ASN 9 7 7 ASN ASN A . n A 1 10 ASN 10 8 8 ASN ASN A . n A 1 11 VAL 11 9 9 VAL VAL A . n A 1 12 VAL 12 10 10 VAL VAL A . n A 1 13 VAL 13 11 11 VAL VAL A . n A 1 14 LEU 14 12 12 LEU LEU A . n A 1 15 ASP 15 13 13 ASP ASP A . n A 1 16 ASN 16 14 14 ASN ASN A . n A 1 17 PRO 17 15 15 PRO PRO A . n A 1 18 SER 18 16 16 SER SER A . n A 1 19 PRO 19 17 17 PRO PRO A . n A 1 20 PHE 20 18 18 PHE PHE A . n A 1 21 TYR 21 19 19 TYR TYR A . n A 1 22 ASN 22 20 20 ASN ASN A . n A 1 23 PRO 23 21 21 PRO PRO A . n A 1 24 PHE 24 22 22 PHE PHE A . n A 1 25 GLN 25 23 23 GLN GLN A . n A 1 26 PHE 26 24 24 PHE PHE A . n A 1 27 GLU 27 25 25 GLU GLU A . n A 1 28 ILE 28 26 26 ILE ILE A . n A 1 29 THR 29 27 27 THR THR A . n A 1 30 PHE 30 28 28 PHE PHE A . n A 1 31 GLU 31 29 29 GLU GLU A . n A 1 32 CYS 32 30 30 CYS CYS A . n A 1 33 ILE 33 31 31 ILE ILE A . n A 1 34 GLU 34 32 32 GLU GLU A . n A 1 35 ASP 35 33 33 ASP ASP A . n A 1 36 LEU 36 34 34 LEU LEU A . n A 1 37 SER 37 35 35 SER SER A . n A 1 38 GLU 38 36 36 GLU GLU A . n A 1 39 ASP 39 37 37 ASP ASP A . n A 1 40 LEU 40 38 38 LEU LEU A . n A 1 41 GLU 41 39 39 GLU GLU A . n A 1 42 TRP 42 40 40 TRP TRP A . n A 1 43 LYS 43 41 41 LYS LYS A . n A 1 44 ILE 44 42 42 ILE ILE A . n A 1 45 ILE 45 43 43 ILE ILE A . n A 1 46 TYR 46 44 44 TYR TYR A . n A 1 47 VAL 47 45 45 VAL VAL A . n A 1 48 GLY 48 46 46 GLY GLY A . n A 1 49 SER 49 47 47 SER SER A . n A 1 50 ALA 50 48 48 ALA ALA A . n A 1 51 GLU 51 49 49 GLU GLU A . n A 1 52 SER 52 50 50 SER SER A . n A 1 53 GLU 53 51 51 GLU GLU A . n A 1 54 GLU 54 52 52 GLU GLU A . n A 1 55 TYR 55 53 53 TYR TYR A . n A 1 56 ASP 56 54 54 ASP ASP A . n A 1 57 GLN 57 55 55 GLN GLN A . n A 1 58 VAL 58 56 56 VAL VAL A . n A 1 59 LEU 59 57 57 LEU LEU A . n A 1 60 ASP 60 58 58 ASP ASP A . n A 1 61 SER 61 59 59 SER SER A . n A 1 62 VAL 62 60 60 VAL VAL A . n A 1 63 LEU 63 61 61 LEU LEU A . n A 1 64 VAL 64 62 62 VAL VAL A . n A 1 65 GLY 65 63 63 GLY GLY A . n A 1 66 PRO 66 64 64 PRO PRO A . n A 1 67 VAL 67 65 65 VAL VAL A . n A 1 68 PRO 68 66 66 PRO PRO A . n A 1 69 ALA 69 67 67 ALA ALA A . n A 1 70 GLY 70 68 68 GLY GLY A . n A 1 71 ARG 71 69 69 ARG ARG A . n A 1 72 HIS 72 70 70 HIS HIS A . n A 1 73 MET 73 71 71 MET MET A . n A 1 74 PHE 74 72 72 PHE PHE A . n A 1 75 VAL 75 73 73 VAL VAL A . n A 1 76 PHE 76 74 74 PHE PHE A . n A 1 77 GLN 77 75 75 GLN GLN A . n A 1 78 ALA 78 76 76 ALA ALA A . n A 1 79 ASP 79 77 77 ASP ASP A . n A 1 80 ALA 80 78 78 ALA ALA A . n A 1 81 PRO 81 79 79 PRO PRO A . n A 1 82 ASN 82 80 80 ASN ASN A . n A 1 83 PRO 83 81 81 PRO PRO A . n A 1 84 GLY 84 82 82 GLY GLY A . n A 1 85 LEU 85 83 83 LEU LEU A . n A 1 86 ILE 86 84 84 ILE ILE A . n A 1 87 PRO 87 85 85 PRO PRO A . n A 1 88 ASP 88 86 86 ASP ASP A . n A 1 89 ALA 89 87 87 ALA ALA A . n A 1 90 ASP 90 88 88 ASP ASP A . n A 1 91 ALA 91 89 89 ALA ALA A . n A 1 92 VAL 92 90 90 VAL VAL A . n A 1 93 GLY 93 91 91 GLY GLY A . n A 1 94 VAL 94 92 92 VAL VAL A . n A 1 95 THR 95 93 93 THR THR A . n A 1 96 VAL 96 94 94 VAL VAL A . n A 1 97 VAL 97 95 95 VAL VAL A . n A 1 98 LEU 98 96 96 LEU LEU A . n A 1 99 ILE 99 97 97 ILE ILE A . n A 1 100 THR 100 98 98 THR THR A . n A 1 101 CYS 101 99 99 CYS CYS A . n A 1 102 THR 102 100 100 THR THR A . n A 1 103 TYR 103 101 101 TYR TYR A . n A 1 104 ARG 104 102 102 ARG ARG A . n A 1 105 GLY 105 103 103 GLY GLY A . n A 1 106 GLN 106 104 104 GLN GLN A . n A 1 107 GLU 107 105 105 GLU GLU A . n A 1 108 PHE 108 106 106 PHE PHE A . n A 1 109 ILE 109 107 107 ILE ILE A . n A 1 110 ARG 110 108 108 ARG ARG A . n A 1 111 VAL 111 109 109 VAL VAL A . n A 1 112 GLY 112 110 110 GLY GLY A . n A 1 113 TYR 113 111 111 TYR TYR A . n A 1 114 TYR 114 112 112 TYR TYR A . n A 1 115 VAL 115 113 113 VAL VAL A . n A 1 116 ASN 116 114 114 ASN ASN A . n A 1 117 ASN 117 115 115 ASN ASN A . n A 1 118 GLU 118 116 116 GLU GLU A . n A 1 119 TYR 119 117 117 TYR TYR A . n A 1 120 THR 120 118 118 THR THR A . n A 1 121 GLU 121 119 119 GLU GLU A . n A 1 122 THR 122 120 120 THR THR A . n A 1 123 GLU 123 121 121 GLU GLU A . n A 1 124 LEU 124 122 122 LEU LEU A . n A 1 125 ARG 125 123 123 ARG ARG A . n A 1 126 GLU 126 124 124 GLU GLU A . n A 1 127 ASN 127 125 125 ASN ASN A . n A 1 128 PRO 128 126 126 PRO PRO A . n A 1 129 PRO 129 127 127 PRO PRO A . n A 1 130 VAL 130 128 128 VAL VAL A . n A 1 131 LYS 131 129 129 LYS LYS A . n A 1 132 PRO 132 130 130 PRO PRO A . n A 1 133 ASP 133 131 131 ASP ASP A . n A 1 134 PHE 134 132 132 PHE PHE A . n A 1 135 SER 135 133 133 SER SER A . n A 1 136 LYS 136 134 134 LYS LYS A . n A 1 137 LEU 137 135 135 LEU LEU A . n A 1 138 GLN 138 136 136 GLN GLN A . n A 1 139 ARG 139 137 137 ARG ARG A . n A 1 140 ASN 140 138 138 ASN ASN A . n A 1 141 ILE 141 139 139 ILE ILE A . n A 1 142 LEU 142 140 140 LEU LEU A . n A 1 143 ALA 143 141 141 ALA ALA A . n A 1 144 SER 144 142 142 SER SER A . n A 1 145 ASN 145 143 143 ASN ASN A . n A 1 146 PRO 146 144 144 PRO PRO A . n A 1 147 ARG 147 145 145 ARG ARG A . n A 1 148 VAL 148 146 146 VAL VAL A . n A 1 149 THR 149 147 147 THR THR A . n A 1 150 ARG 150 148 148 ARG ARG A . n A 1 151 PHE 151 149 149 PHE PHE A . n A 1 152 HIS 152 150 150 HIS HIS A . n A 1 153 ILE 153 151 151 ILE ILE A . n A 1 154 ASN 154 152 152 ASN ASN A . n A 1 155 TRP 155 153 153 TRP TRP A . n A 1 156 GLU 156 154 154 GLU GLU A . n A 1 157 ASP 157 155 ? ? ? A . n A 1 158 ASN 158 156 ? ? ? A . n B 2 1 ACE 1 0 0 ACE ACE B . n B 2 2 GLU 2 1 1 GLU GLU B . n B 2 3 LYS 3 2 2 LYS LYS B . n B 2 4 ALN 4 3 3 ALN ALN B . n B 2 5 ALA 5 4 4 ALA ALA B . n B 2 6 ARG 6 5 5 ARG ARG B . n B 2 7 LEU 7 6 6 LEU LEU B . n B 2 8 QQ8 8 7 7 QQ8 QQ8 B . n B 2 9 OUR 9 8 8 OUR OUR B . n B 2 10 OUI 10 9 9 OUI OUI B . n B 2 11 ALA 11 10 10 ALA 66N B . n B 2 12 NH2 12 11 10 NH2 66N B . n # _pdbx_contact_author.id 3 _pdbx_contact_author.email francoise.ochsenbein@cea.fr _pdbx_contact_author.name_first Francoise _pdbx_contact_author.name_last Ochsenbein _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9027-4384 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 201 25 HOH HOH A . C 3 HOH 2 202 47 HOH HOH A . C 3 HOH 3 203 69 HOH HOH A . C 3 HOH 4 204 36 HOH HOH A . C 3 HOH 5 205 9 HOH HOH A . C 3 HOH 6 206 8 HOH HOH A . C 3 HOH 7 207 56 HOH HOH A . C 3 HOH 8 208 17 HOH HOH A . C 3 HOH 9 209 18 HOH HOH A . C 3 HOH 10 210 66 HOH HOH A . C 3 HOH 11 211 4 HOH HOH A . C 3 HOH 12 212 54 HOH HOH A . C 3 HOH 13 213 19 HOH HOH A . C 3 HOH 14 214 70 HOH HOH A . C 3 HOH 15 215 15 HOH HOH A . C 3 HOH 16 216 3 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1500 ? 1 MORE -4 ? 1 'SSA (A^2)' 8760 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-07-05 2 'Structure model' 1 1 2023-07-19 3 'Structure model' 2 0 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' atom_site 4 3 'Structure model' atom_site_anisotrop 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' pdbx_validate_main_chain_plane 8 3 'Structure model' pdbx_validate_peptide_omega 9 3 'Structure model' pdbx_validate_rmsd_angle 10 3 'Structure model' pdbx_validate_torsion 11 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_atom_site.auth_atom_id' 6 3 'Structure model' '_atom_site.label_atom_id' 7 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 8 3 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' 9 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 10 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 11 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method ? _pdbx_refine_tls.origin_x 51.2968 _pdbx_refine_tls.origin_y -45.3674 _pdbx_refine_tls.origin_z -19.7781 _pdbx_refine_tls.T[1][1] 0.0241 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0073 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0457 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] -0.1917 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.1358 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] -0.2926 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 9.7366 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 2.026 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -2.5568 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 4.3047 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.5187 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 4.3055 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.1159 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0602 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.124 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0602 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.2774 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.3604 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.124 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.3604 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.1614 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 1 ? ? ? A 154 ? ? '{A|* B|*}' 2 'X-RAY DIFFRACTION' 1 ? ? B 0 ? ? ? B 0 ? ? '{A|* B|*}' 3 'X-RAY DIFFRACTION' 1 ? ? B 1 ? ? ? B 2 ? ? '{A|* B|*}' 4 'X-RAY DIFFRACTION' 1 ? ? B 3 ? ? ? B 3 ? ? '{A|* B|*}' 5 'X-RAY DIFFRACTION' 1 ? ? B 4 ? ? ? B 6 ? ? '{A|* B|*}' 6 'X-RAY DIFFRACTION' 1 ? ? B 7 ? ? ? B 10 ? ? '{A|* B|*}' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.4 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? STARANISO ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 7 # _pdbx_entry_details.entry_id 8CJ3 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA B QQ8 7 ? ? C B QQ8 7 ? ? N B OUR 8 ? ? 144.58 117.20 27.38 2.20 Y 2 1 CA B OUR 8 ? ? C B OUR 8 ? ? N B OUI 9 ? ? 143.75 117.20 26.55 2.20 Y 3 1 CA B OUI 9 ? ? C B OUI 9 ? ? N B ALA 10 ? ? 131.87 117.20 14.67 2.20 Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id QQ8 _pdbx_validate_torsion.auth_asym_id B _pdbx_validate_torsion.auth_seq_id 7 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -52.99 _pdbx_validate_torsion.psi 15.28 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 QQ8 B 7 ? ? OUR B 8 ? ? 120.90 2 1 OUR B 8 ? ? OUI B 9 ? ? 129.73 3 1 OUI B 9 ? ? ALA B 10 ? ? 148.24 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 QQ8 B 7 ? ? -32.83 2 1 OUR B 8 ? ? -28.37 3 1 OUI B 9 ? ? -14.92 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A ALA 0 ? A ALA 2 3 1 Y 1 A ASP 155 ? A ASP 157 4 1 Y 1 A ASN 156 ? A ASN 158 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ALN N N N N 21 ALN CA C N S 22 ALN C C N N 23 ALN O O N N 24 ALN CB C N N 25 ALN CG1 C Y N 26 ALN CD1 C Y N 27 ALN CE1 C Y N 28 ALN CD2 C Y N 29 ALN CE2 C Y N 30 ALN CZ1 C Y N 31 ALN CG2 C Y N 32 ALN CD3 C Y N 33 ALN CE3 C Y N 34 ALN CZ2 C Y N 35 ALN OXT O N N 36 ALN H H N N 37 ALN H2 H N N 38 ALN HA H N N 39 ALN HB2 H N N 40 ALN HB3 H N N 41 ALN HD1 H N N 42 ALN HE1 H N N 43 ALN HZ1 H N N 44 ALN HG2 H N N 45 ALN HD3 H N N 46 ALN HE3 H N N 47 ALN HZ2 H N N 48 ALN HXT H N N 49 ARG N N N N 50 ARG CA C N S 51 ARG C C N N 52 ARG O O N N 53 ARG CB C N N 54 ARG CG C N N 55 ARG CD C N N 56 ARG NE N N N 57 ARG CZ C N N 58 ARG NH1 N N N 59 ARG NH2 N N N 60 ARG OXT O N N 61 ARG H H N N 62 ARG H2 H N N 63 ARG HA H N N 64 ARG HB2 H N N 65 ARG HB3 H N N 66 ARG HG2 H N N 67 ARG HG3 H N N 68 ARG HD2 H N N 69 ARG HD3 H N N 70 ARG HE H N N 71 ARG HH11 H N N 72 ARG HH12 H N N 73 ARG HH21 H N N 74 ARG HH22 H N N 75 ARG HXT H N N 76 ASN N N N N 77 ASN CA C N S 78 ASN C C N N 79 ASN O O N N 80 ASN CB C N N 81 ASN CG C N N 82 ASN OD1 O N N 83 ASN ND2 N N N 84 ASN OXT O N N 85 ASN H H N N 86 ASN H2 H N N 87 ASN HA H N N 88 ASN HB2 H N N 89 ASN HB3 H N N 90 ASN HD21 H N N 91 ASN HD22 H N N 92 ASN HXT H N N 93 ASP N N N N 94 ASP CA C N S 95 ASP C C N N 96 ASP O O N N 97 ASP CB C N N 98 ASP CG C N N 99 ASP OD1 O N N 100 ASP OD2 O N N 101 ASP OXT O N N 102 ASP H H N N 103 ASP H2 H N N 104 ASP HA H N N 105 ASP HB2 H N N 106 ASP HB3 H N N 107 ASP HD2 H N N 108 ASP HXT H N N 109 CYS N N N N 110 CYS CA C N R 111 CYS C C N N 112 CYS O O N N 113 CYS CB C N N 114 CYS SG S N N 115 CYS OXT O N N 116 CYS H H N N 117 CYS H2 H N N 118 CYS HA H N N 119 CYS HB2 H N N 120 CYS HB3 H N N 121 CYS HG H N N 122 CYS HXT H N N 123 GLN N N N N 124 GLN CA C N S 125 GLN C C N N 126 GLN O O N N 127 GLN CB C N N 128 GLN CG C N N 129 GLN CD C N N 130 GLN OE1 O N N 131 GLN NE2 N N N 132 GLN OXT O N N 133 GLN H H N N 134 GLN H2 H N N 135 GLN HA H N N 136 GLN HB2 H N N 137 GLN HB3 H N N 138 GLN HG2 H N N 139 GLN HG3 H N N 140 GLN HE21 H N N 141 GLN HE22 H N N 142 GLN HXT H N N 143 GLU N N N N 144 GLU CA C N S 145 GLU C C N N 146 GLU O O N N 147 GLU CB C N N 148 GLU CG C N N 149 GLU CD C N N 150 GLU OE1 O N N 151 GLU OE2 O N N 152 GLU OXT O N N 153 GLU H H N N 154 GLU H2 H N N 155 GLU HA H N N 156 GLU HB2 H N N 157 GLU HB3 H N N 158 GLU HG2 H N N 159 GLU HG3 H N N 160 GLU HE2 H N N 161 GLU HXT H N N 162 GLY N N N N 163 GLY CA C N N 164 GLY C C N N 165 GLY O O N N 166 GLY OXT O N N 167 GLY H H N N 168 GLY H2 H N N 169 GLY HA2 H N N 170 GLY HA3 H N N 171 GLY HXT H N N 172 HIS N N N N 173 HIS CA C N S 174 HIS C C N N 175 HIS O O N N 176 HIS CB C N N 177 HIS CG C Y N 178 HIS ND1 N Y N 179 HIS CD2 C Y N 180 HIS CE1 C Y N 181 HIS NE2 N Y N 182 HIS OXT O N N 183 HIS H H N N 184 HIS H2 H N N 185 HIS HA H N N 186 HIS HB2 H N N 187 HIS HB3 H N N 188 HIS HD1 H N N 189 HIS HD2 H N N 190 HIS HE1 H N N 191 HIS HE2 H N N 192 HIS HXT H N N 193 HOH O O N N 194 HOH H1 H N N 195 HOH H2 H N N 196 ILE N N N N 197 ILE CA C N S 198 ILE C C N N 199 ILE O O N N 200 ILE CB C N S 201 ILE CG1 C N N 202 ILE CG2 C N N 203 ILE CD1 C N N 204 ILE OXT O N N 205 ILE H H N N 206 ILE H2 H N N 207 ILE HA H N N 208 ILE HB H N N 209 ILE HG12 H N N 210 ILE HG13 H N N 211 ILE HG21 H N N 212 ILE HG22 H N N 213 ILE HG23 H N N 214 ILE HD11 H N N 215 ILE HD12 H N N 216 ILE HD13 H N N 217 ILE HXT H N N 218 LEU N N N N 219 LEU CA C N S 220 LEU C C N N 221 LEU O O N N 222 LEU CB C N N 223 LEU CG C N N 224 LEU CD1 C N N 225 LEU CD2 C N N 226 LEU OXT O N N 227 LEU H H N N 228 LEU H2 H N N 229 LEU HA H N N 230 LEU HB2 H N N 231 LEU HB3 H N N 232 LEU HG H N N 233 LEU HD11 H N N 234 LEU HD12 H N N 235 LEU HD13 H N N 236 LEU HD21 H N N 237 LEU HD22 H N N 238 LEU HD23 H N N 239 LEU HXT H N N 240 LYS N N N N 241 LYS CA C N S 242 LYS C C N N 243 LYS O O N N 244 LYS CB C N N 245 LYS CG C N N 246 LYS CD C N N 247 LYS CE C N N 248 LYS NZ N N N 249 LYS OXT O N N 250 LYS H H N N 251 LYS H2 H N N 252 LYS HA H N N 253 LYS HB2 H N N 254 LYS HB3 H N N 255 LYS HG2 H N N 256 LYS HG3 H N N 257 LYS HD2 H N N 258 LYS HD3 H N N 259 LYS HE2 H N N 260 LYS HE3 H N N 261 LYS HZ1 H N N 262 LYS HZ2 H N N 263 LYS HZ3 H N N 264 LYS HXT H N N 265 MET N N N N 266 MET CA C N S 267 MET C C N N 268 MET O O N N 269 MET CB C N N 270 MET CG C N N 271 MET SD S N N 272 MET CE C N N 273 MET OXT O N N 274 MET H H N N 275 MET H2 H N N 276 MET HA H N N 277 MET HB2 H N N 278 MET HB3 H N N 279 MET HG2 H N N 280 MET HG3 H N N 281 MET HE1 H N N 282 MET HE2 H N N 283 MET HE3 H N N 284 MET HXT H N N 285 NH2 N N N N 286 NH2 HN1 H N N 287 NH2 HN2 H N N 288 OUI N N N N 289 OUI CA C N S 290 OUI C C N N 291 OUI O O N N 292 OUI CB C N S 293 OUI CG1 C N N 294 OUI CG2 C N N 295 OUI CD1 C N N 296 OUI CM C N N 297 OUI N2 N N N 298 OUI H2 H N N 299 OUI H H N N 300 OUI HA H N N 301 OUI HB H N N 302 OUI HG13 H N N 303 OUI HG12 H N N 304 OUI HG21 H N N 305 OUI HG22 H N N 306 OUI HG23 H N N 307 OUI HD12 H N N 308 OUI HD13 H N N 309 OUI HD11 H N N 310 OUI HM2 H N N 311 OUI HM3 H N N 312 OUI HN2 H N N 313 OUI OXT O N N 314 OUI HXT H N N 315 OUR N N N N 316 OUR CA C N S 317 OUR C C N N 318 OUR O O N N 319 OUR CB C N N 320 OUR CG C N N 321 OUR CD C N N 322 OUR NE N N N 323 OUR CZ C N N 324 OUR NH1 N N N 325 OUR NH2 N N N 326 OUR CM C N N 327 OUR N2 N N N 328 OUR OXT O N N 329 OUR H H N N 330 OUR H2 H N N 331 OUR HA H N N 332 OUR HB3 H N N 333 OUR HB2 H N N 334 OUR HG3 H N N 335 OUR HG2 H N N 336 OUR HD3 H N N 337 OUR HD2 H N N 338 OUR HE H N N 339 OUR HH12 H N N 340 OUR HH11 H N N 341 OUR HH22 H N N 342 OUR HM2 H N N 343 OUR HM3 H N N 344 OUR HN2 H N N 345 OUR HXT H N N 346 OUR HH21 H N N 347 PHE N N N N 348 PHE CA C N S 349 PHE C C N N 350 PHE O O N N 351 PHE CB C N N 352 PHE CG C Y N 353 PHE CD1 C Y N 354 PHE CD2 C Y N 355 PHE CE1 C Y N 356 PHE CE2 C Y N 357 PHE CZ C Y N 358 PHE OXT O N N 359 PHE H H N N 360 PHE H2 H N N 361 PHE HA H N N 362 PHE HB2 H N N 363 PHE HB3 H N N 364 PHE HD1 H N N 365 PHE HD2 H N N 366 PHE HE1 H N N 367 PHE HE2 H N N 368 PHE HZ H N N 369 PHE HXT H N N 370 PRO N N N N 371 PRO CA C N S 372 PRO C C N N 373 PRO O O N N 374 PRO CB C N N 375 PRO CG C N N 376 PRO CD C N N 377 PRO OXT O N N 378 PRO H H N N 379 PRO HA H N N 380 PRO HB2 H N N 381 PRO HB3 H N N 382 PRO HG2 H N N 383 PRO HG3 H N N 384 PRO HD2 H N N 385 PRO HD3 H N N 386 PRO HXT H N N 387 QQ8 O O N N 388 QQ8 C C N N 389 QQ8 NM N N N 390 QQ8 CM C N N 391 QQ8 CA C N S 392 QQ8 N N N N 393 QQ8 CB C N N 394 QQ8 CG C N N 395 QQ8 CD C N N 396 QQ8 OE1 O N N 397 QQ8 NE2 N N N 398 QQ8 H1 H N N 399 QQ8 H6 H N N 400 QQ8 H3 H N N 401 QQ8 H4 H N N 402 QQ8 HA H N N 403 QQ8 H H N N 404 QQ8 H2 H N N 405 QQ8 H9 H N N 406 QQ8 H10 H N N 407 QQ8 H11 H N N 408 QQ8 H12 H N N 409 QQ8 H13 H N N 410 QQ8 H14 H N N 411 SER N N N N 412 SER CA C N S 413 SER C C N N 414 SER O O N N 415 SER CB C N N 416 SER OG O N N 417 SER OXT O N N 418 SER H H N N 419 SER H2 H N N 420 SER HA H N N 421 SER HB2 H N N 422 SER HB3 H N N 423 SER HG H N N 424 SER HXT H N N 425 THR N N N N 426 THR CA C N S 427 THR C C N N 428 THR O O N N 429 THR CB C N R 430 THR OG1 O N N 431 THR CG2 C N N 432 THR OXT O N N 433 THR H H N N 434 THR H2 H N N 435 THR HA H N N 436 THR HB H N N 437 THR HG1 H N N 438 THR HG21 H N N 439 THR HG22 H N N 440 THR HG23 H N N 441 THR HXT H N N 442 TRP N N N N 443 TRP CA C N S 444 TRP C C N N 445 TRP O O N N 446 TRP CB C N N 447 TRP CG C Y N 448 TRP CD1 C Y N 449 TRP CD2 C Y N 450 TRP NE1 N Y N 451 TRP CE2 C Y N 452 TRP CE3 C Y N 453 TRP CZ2 C Y N 454 TRP CZ3 C Y N 455 TRP CH2 C Y N 456 TRP OXT O N N 457 TRP H H N N 458 TRP H2 H N N 459 TRP HA H N N 460 TRP HB2 H N N 461 TRP HB3 H N N 462 TRP HD1 H N N 463 TRP HE1 H N N 464 TRP HE3 H N N 465 TRP HZ2 H N N 466 TRP HZ3 H N N 467 TRP HH2 H N N 468 TRP HXT H N N 469 TYR N N N N 470 TYR CA C N S 471 TYR C C N N 472 TYR O O N N 473 TYR CB C N N 474 TYR CG C Y N 475 TYR CD1 C Y N 476 TYR CD2 C Y N 477 TYR CE1 C Y N 478 TYR CE2 C Y N 479 TYR CZ C Y N 480 TYR OH O N N 481 TYR OXT O N N 482 TYR H H N N 483 TYR H2 H N N 484 TYR HA H N N 485 TYR HB2 H N N 486 TYR HB3 H N N 487 TYR HD1 H N N 488 TYR HD2 H N N 489 TYR HE1 H N N 490 TYR HE2 H N N 491 TYR HH H N N 492 TYR HXT H N N 493 VAL N N N N 494 VAL CA C N S 495 VAL C C N N 496 VAL O O N N 497 VAL CB C N N 498 VAL CG1 C N N 499 VAL CG2 C N N 500 VAL OXT O N N 501 VAL H H N N 502 VAL H2 H N N 503 VAL HA H N N 504 VAL HB H N N 505 VAL HG11 H N N 506 VAL HG12 H N N 507 VAL HG13 H N N 508 VAL HG21 H N N 509 VAL HG22 H N N 510 VAL HG23 H N N 511 VAL HXT H N N 512 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ALN N CA sing N N 19 ALN N H sing N N 20 ALN N H2 sing N N 21 ALN CA C sing N N 22 ALN CA CB sing N N 23 ALN CA HA sing N N 24 ALN C O doub N N 25 ALN C OXT sing N N 26 ALN CB CG1 sing N N 27 ALN CB HB2 sing N N 28 ALN CB HB3 sing N N 29 ALN CG1 CD1 doub Y N 30 ALN CG1 CD2 sing Y N 31 ALN CD1 CE1 sing Y N 32 ALN CD1 HD1 sing N N 33 ALN CE1 CZ1 doub Y N 34 ALN CE1 HE1 sing N N 35 ALN CD2 CE2 doub Y N 36 ALN CD2 CG2 sing Y N 37 ALN CE2 CZ1 sing Y N 38 ALN CE2 CZ2 sing Y N 39 ALN CZ1 HZ1 sing N N 40 ALN CG2 CD3 doub Y N 41 ALN CG2 HG2 sing N N 42 ALN CD3 CE3 sing Y N 43 ALN CD3 HD3 sing N N 44 ALN CE3 CZ2 doub Y N 45 ALN CE3 HE3 sing N N 46 ALN CZ2 HZ2 sing N N 47 ALN OXT HXT sing N N 48 ARG N CA sing N N 49 ARG N H sing N N 50 ARG N H2 sing N N 51 ARG CA C sing N N 52 ARG CA CB sing N N 53 ARG CA HA sing N N 54 ARG C O doub N N 55 ARG C OXT sing N N 56 ARG CB CG sing N N 57 ARG CB HB2 sing N N 58 ARG CB HB3 sing N N 59 ARG CG CD sing N N 60 ARG CG HG2 sing N N 61 ARG CG HG3 sing N N 62 ARG CD NE sing N N 63 ARG CD HD2 sing N N 64 ARG CD HD3 sing N N 65 ARG NE CZ sing N N 66 ARG NE HE sing N N 67 ARG CZ NH1 sing N N 68 ARG CZ NH2 doub N N 69 ARG NH1 HH11 sing N N 70 ARG NH1 HH12 sing N N 71 ARG NH2 HH21 sing N N 72 ARG NH2 HH22 sing N N 73 ARG OXT HXT sing N N 74 ASN N CA sing N N 75 ASN N H sing N N 76 ASN N H2 sing N N 77 ASN CA C sing N N 78 ASN CA CB sing N N 79 ASN CA HA sing N N 80 ASN C O doub N N 81 ASN C OXT sing N N 82 ASN CB CG sing N N 83 ASN CB HB2 sing N N 84 ASN CB HB3 sing N N 85 ASN CG OD1 doub N N 86 ASN CG ND2 sing N N 87 ASN ND2 HD21 sing N N 88 ASN ND2 HD22 sing N N 89 ASN OXT HXT sing N N 90 ASP N CA sing N N 91 ASP N H sing N N 92 ASP N H2 sing N N 93 ASP CA C sing N N 94 ASP CA CB sing N N 95 ASP CA HA sing N N 96 ASP C O doub N N 97 ASP C OXT sing N N 98 ASP CB CG sing N N 99 ASP CB HB2 sing N N 100 ASP CB HB3 sing N N 101 ASP CG OD1 doub N N 102 ASP CG OD2 sing N N 103 ASP OD2 HD2 sing N N 104 ASP OXT HXT sing N N 105 CYS N CA sing N N 106 CYS N H sing N N 107 CYS N H2 sing N N 108 CYS CA C sing N N 109 CYS CA CB sing N N 110 CYS CA HA sing N N 111 CYS C O doub N N 112 CYS C OXT sing N N 113 CYS CB SG sing N N 114 CYS CB HB2 sing N N 115 CYS CB HB3 sing N N 116 CYS SG HG sing N N 117 CYS OXT HXT sing N N 118 GLN N CA sing N N 119 GLN N H sing N N 120 GLN N H2 sing N N 121 GLN CA C sing N N 122 GLN CA CB sing N N 123 GLN CA HA sing N N 124 GLN C O doub N N 125 GLN C OXT sing N N 126 GLN CB CG sing N N 127 GLN CB HB2 sing N N 128 GLN CB HB3 sing N N 129 GLN CG CD sing N N 130 GLN CG HG2 sing N N 131 GLN CG HG3 sing N N 132 GLN CD OE1 doub N N 133 GLN CD NE2 sing N N 134 GLN NE2 HE21 sing N N 135 GLN NE2 HE22 sing N N 136 GLN OXT HXT sing N N 137 GLU N CA sing N N 138 GLU N H sing N N 139 GLU N H2 sing N N 140 GLU CA C sing N N 141 GLU CA CB sing N N 142 GLU CA HA sing N N 143 GLU C O doub N N 144 GLU C OXT sing N N 145 GLU CB CG sing N N 146 GLU CB HB2 sing N N 147 GLU CB HB3 sing N N 148 GLU CG CD sing N N 149 GLU CG HG2 sing N N 150 GLU CG HG3 sing N N 151 GLU CD OE1 doub N N 152 GLU CD OE2 sing N N 153 GLU OE2 HE2 sing N N 154 GLU OXT HXT sing N N 155 GLY N CA sing N N 156 GLY N H sing N N 157 GLY N H2 sing N N 158 GLY CA C sing N N 159 GLY CA HA2 sing N N 160 GLY CA HA3 sing N N 161 GLY C O doub N N 162 GLY C OXT sing N N 163 GLY OXT HXT sing N N 164 HIS N CA sing N N 165 HIS N H sing N N 166 HIS N H2 sing N N 167 HIS CA C sing N N 168 HIS CA CB sing N N 169 HIS CA HA sing N N 170 HIS C O doub N N 171 HIS C OXT sing N N 172 HIS CB CG sing N N 173 HIS CB HB2 sing N N 174 HIS CB HB3 sing N N 175 HIS CG ND1 sing Y N 176 HIS CG CD2 doub Y N 177 HIS ND1 CE1 doub Y N 178 HIS ND1 HD1 sing N N 179 HIS CD2 NE2 sing Y N 180 HIS CD2 HD2 sing N N 181 HIS CE1 NE2 sing Y N 182 HIS CE1 HE1 sing N N 183 HIS NE2 HE2 sing N N 184 HIS OXT HXT sing N N 185 HOH O H1 sing N N 186 HOH O H2 sing N N 187 ILE N CA sing N N 188 ILE N H sing N N 189 ILE N H2 sing N N 190 ILE CA C sing N N 191 ILE CA CB sing N N 192 ILE CA HA sing N N 193 ILE C O doub N N 194 ILE C OXT sing N N 195 ILE CB CG1 sing N N 196 ILE CB CG2 sing N N 197 ILE CB HB sing N N 198 ILE CG1 CD1 sing N N 199 ILE CG1 HG12 sing N N 200 ILE CG1 HG13 sing N N 201 ILE CG2 HG21 sing N N 202 ILE CG2 HG22 sing N N 203 ILE CG2 HG23 sing N N 204 ILE CD1 HD11 sing N N 205 ILE CD1 HD12 sing N N 206 ILE CD1 HD13 sing N N 207 ILE OXT HXT sing N N 208 LEU N CA sing N N 209 LEU N H sing N N 210 LEU N H2 sing N N 211 LEU CA C sing N N 212 LEU CA CB sing N N 213 LEU CA HA sing N N 214 LEU C O doub N N 215 LEU C OXT sing N N 216 LEU CB CG sing N N 217 LEU CB HB2 sing N N 218 LEU CB HB3 sing N N 219 LEU CG CD1 sing N N 220 LEU CG CD2 sing N N 221 LEU CG HG sing N N 222 LEU CD1 HD11 sing N N 223 LEU CD1 HD12 sing N N 224 LEU CD1 HD13 sing N N 225 LEU CD2 HD21 sing N N 226 LEU CD2 HD22 sing N N 227 LEU CD2 HD23 sing N N 228 LEU OXT HXT sing N N 229 LYS N CA sing N N 230 LYS N H sing N N 231 LYS N H2 sing N N 232 LYS CA C sing N N 233 LYS CA CB sing N N 234 LYS CA HA sing N N 235 LYS C O doub N N 236 LYS C OXT sing N N 237 LYS CB CG sing N N 238 LYS CB HB2 sing N N 239 LYS CB HB3 sing N N 240 LYS CG CD sing N N 241 LYS CG HG2 sing N N 242 LYS CG HG3 sing N N 243 LYS CD CE sing N N 244 LYS CD HD2 sing N N 245 LYS CD HD3 sing N N 246 LYS CE NZ sing N N 247 LYS CE HE2 sing N N 248 LYS CE HE3 sing N N 249 LYS NZ HZ1 sing N N 250 LYS NZ HZ2 sing N N 251 LYS NZ HZ3 sing N N 252 LYS OXT HXT sing N N 253 MET N CA sing N N 254 MET N H sing N N 255 MET N H2 sing N N 256 MET CA C sing N N 257 MET CA CB sing N N 258 MET CA HA sing N N 259 MET C O doub N N 260 MET C OXT sing N N 261 MET CB CG sing N N 262 MET CB HB2 sing N N 263 MET CB HB3 sing N N 264 MET CG SD sing N N 265 MET CG HG2 sing N N 266 MET CG HG3 sing N N 267 MET SD CE sing N N 268 MET CE HE1 sing N N 269 MET CE HE2 sing N N 270 MET CE HE3 sing N N 271 MET OXT HXT sing N N 272 NH2 N HN1 sing N N 273 NH2 N HN2 sing N N 274 OUI CD1 CG1 sing N N 275 OUI CG1 CB sing N N 276 OUI CG2 CB sing N N 277 OUI CB CA sing N N 278 OUI N CA sing N N 279 OUI CA CM sing N N 280 OUI CM N2 sing N N 281 OUI N2 C sing N N 282 OUI C O doub N N 283 OUI N H2 sing N N 284 OUI N H sing N N 285 OUI CA HA sing N N 286 OUI CB HB sing N N 287 OUI CG1 HG13 sing N N 288 OUI CG1 HG12 sing N N 289 OUI CG2 HG21 sing N N 290 OUI CG2 HG22 sing N N 291 OUI CG2 HG23 sing N N 292 OUI CD1 HD12 sing N N 293 OUI CD1 HD13 sing N N 294 OUI CD1 HD11 sing N N 295 OUI CM HM2 sing N N 296 OUI CM HM3 sing N N 297 OUI N2 HN2 sing N N 298 OUI C OXT sing N N 299 OUI OXT HXT sing N N 300 OUR NH2 CZ doub N N 301 OUR NH1 CZ sing N N 302 OUR CZ NE sing N N 303 OUR NE CD sing N N 304 OUR CD CG sing N N 305 OUR CG CB sing N N 306 OUR CB CA sing N N 307 OUR N CA sing N N 308 OUR CA CM sing N N 309 OUR CM N2 sing N N 310 OUR N2 C sing N N 311 OUR C O doub N N 312 OUR C OXT sing N N 313 OUR N H sing N N 314 OUR N H2 sing N N 315 OUR CA HA sing N N 316 OUR CB HB3 sing N N 317 OUR CB HB2 sing N N 318 OUR CG HG3 sing N N 319 OUR CG HG2 sing N N 320 OUR CD HD3 sing N N 321 OUR CD HD2 sing N N 322 OUR NE HE sing N N 323 OUR NH1 HH12 sing N N 324 OUR NH1 HH11 sing N N 325 OUR NH2 HH22 sing N N 326 OUR CM HM2 sing N N 327 OUR CM HM3 sing N N 328 OUR N2 HN2 sing N N 329 OUR OXT HXT sing N N 330 OUR NH2 HH21 sing N N 331 PHE N CA sing N N 332 PHE N H sing N N 333 PHE N H2 sing N N 334 PHE CA C sing N N 335 PHE CA CB sing N N 336 PHE CA HA sing N N 337 PHE C O doub N N 338 PHE C OXT sing N N 339 PHE CB CG sing N N 340 PHE CB HB2 sing N N 341 PHE CB HB3 sing N N 342 PHE CG CD1 doub Y N 343 PHE CG CD2 sing Y N 344 PHE CD1 CE1 sing Y N 345 PHE CD1 HD1 sing N N 346 PHE CD2 CE2 doub Y N 347 PHE CD2 HD2 sing N N 348 PHE CE1 CZ doub Y N 349 PHE CE1 HE1 sing N N 350 PHE CE2 CZ sing Y N 351 PHE CE2 HE2 sing N N 352 PHE CZ HZ sing N N 353 PHE OXT HXT sing N N 354 PRO N CA sing N N 355 PRO N CD sing N N 356 PRO N H sing N N 357 PRO CA C sing N N 358 PRO CA CB sing N N 359 PRO CA HA sing N N 360 PRO C O doub N N 361 PRO C OXT sing N N 362 PRO CB CG sing N N 363 PRO CB HB2 sing N N 364 PRO CB HB3 sing N N 365 PRO CG CD sing N N 366 PRO CG HG2 sing N N 367 PRO CG HG3 sing N N 368 PRO CD HD2 sing N N 369 PRO CD HD3 sing N N 370 PRO OXT HXT sing N N 371 QQ8 N CA sing N N 372 QQ8 NM C sing N N 373 QQ8 NM CM sing N N 374 QQ8 C O doub N N 375 QQ8 CM CA sing N N 376 QQ8 CA CB sing N N 377 QQ8 CB CG sing N N 378 QQ8 CG CD sing N N 379 QQ8 OE1 CD doub N N 380 QQ8 CD NE2 sing N N 381 QQ8 C H1 sing N N 382 QQ8 NM H6 sing N N 383 QQ8 CM H3 sing N N 384 QQ8 CM H4 sing N N 385 QQ8 CA HA sing N N 386 QQ8 N H sing N N 387 QQ8 N H2 sing N N 388 QQ8 CB H9 sing N N 389 QQ8 CB H10 sing N N 390 QQ8 CG H11 sing N N 391 QQ8 CG H12 sing N N 392 QQ8 NE2 H13 sing N N 393 QQ8 NE2 H14 sing N N 394 SER N CA sing N N 395 SER N H sing N N 396 SER N H2 sing N N 397 SER CA C sing N N 398 SER CA CB sing N N 399 SER CA HA sing N N 400 SER C O doub N N 401 SER C OXT sing N N 402 SER CB OG sing N N 403 SER CB HB2 sing N N 404 SER CB HB3 sing N N 405 SER OG HG sing N N 406 SER OXT HXT sing N N 407 THR N CA sing N N 408 THR N H sing N N 409 THR N H2 sing N N 410 THR CA C sing N N 411 THR CA CB sing N N 412 THR CA HA sing N N 413 THR C O doub N N 414 THR C OXT sing N N 415 THR CB OG1 sing N N 416 THR CB CG2 sing N N 417 THR CB HB sing N N 418 THR OG1 HG1 sing N N 419 THR CG2 HG21 sing N N 420 THR CG2 HG22 sing N N 421 THR CG2 HG23 sing N N 422 THR OXT HXT sing N N 423 TRP N CA sing N N 424 TRP N H sing N N 425 TRP N H2 sing N N 426 TRP CA C sing N N 427 TRP CA CB sing N N 428 TRP CA HA sing N N 429 TRP C O doub N N 430 TRP C OXT sing N N 431 TRP CB CG sing N N 432 TRP CB HB2 sing N N 433 TRP CB HB3 sing N N 434 TRP CG CD1 doub Y N 435 TRP CG CD2 sing Y N 436 TRP CD1 NE1 sing Y N 437 TRP CD1 HD1 sing N N 438 TRP CD2 CE2 doub Y N 439 TRP CD2 CE3 sing Y N 440 TRP NE1 CE2 sing Y N 441 TRP NE1 HE1 sing N N 442 TRP CE2 CZ2 sing Y N 443 TRP CE3 CZ3 doub Y N 444 TRP CE3 HE3 sing N N 445 TRP CZ2 CH2 doub Y N 446 TRP CZ2 HZ2 sing N N 447 TRP CZ3 CH2 sing Y N 448 TRP CZ3 HZ3 sing N N 449 TRP CH2 HH2 sing N N 450 TRP OXT HXT sing N N 451 TYR N CA sing N N 452 TYR N H sing N N 453 TYR N H2 sing N N 454 TYR CA C sing N N 455 TYR CA CB sing N N 456 TYR CA HA sing N N 457 TYR C O doub N N 458 TYR C OXT sing N N 459 TYR CB CG sing N N 460 TYR CB HB2 sing N N 461 TYR CB HB3 sing N N 462 TYR CG CD1 doub Y N 463 TYR CG CD2 sing Y N 464 TYR CD1 CE1 sing Y N 465 TYR CD1 HD1 sing N N 466 TYR CD2 CE2 doub Y N 467 TYR CD2 HD2 sing N N 468 TYR CE1 CZ doub Y N 469 TYR CE1 HE1 sing N N 470 TYR CE2 CZ sing Y N 471 TYR CE2 HE2 sing N N 472 TYR CZ OH sing N N 473 TYR OH HH sing N N 474 TYR OXT HXT sing N N 475 VAL N CA sing N N 476 VAL N H sing N N 477 VAL N H2 sing N N 478 VAL CA C sing N N 479 VAL CA CB sing N N 480 VAL CA HA sing N N 481 VAL C O doub N N 482 VAL C OXT sing N N 483 VAL CB CG1 sing N N 484 VAL CB CG2 sing N N 485 VAL CB HB sing N N 486 VAL CG1 HG11 sing N N 487 VAL CG1 HG12 sing N N 488 VAL CG1 HG13 sing N N 489 VAL CG2 HG21 sing N N 490 VAL CG2 HG22 sing N N 491 VAL CG2 HG23 sing N N 492 VAL OXT HXT sing N N 493 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Agence Nationale de la Recherche (ANR)' France ANR-20-CE18-0038 1 'Fondation ARC' France PGA1*20160203953 2 'Agence Nationale de la Recherche (ANR)' France ANR-20-CE18-0038 3 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6F0H _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details '1:1 complex' #