data_8CJP # _entry.id 8CJP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8CJP pdb_00008cjp 10.2210/pdb8cjp/pdb WWPDB D_1292128511 ? ? BMRB 34791 ? 10.13018/BMR34791 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-07-26 2 'Structure model' 1 1 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_entry_details 5 2 'Structure model' pdbx_modification_feature # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8CJP _pdbx_database_status.recvd_initial_deposition_date 2023-02-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Wild type' 8CIQ unspecified BMRB 'JzTx-34 toxin peptide' 34791 unspecified # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 celine.landon@cnrs-orleans.fr Celine Landon ? 'principal investigator/group leader' 0000-0002-0248-1990 3 herve.meudal@cnrs-orleans.fr Herve Meudal ? 'principal investigator/group leader' 0000-0002-9642-3643 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Landon, C.' 1 0000-0002-0248-1990 'Meudal, H.' 2 0000-0002-9642-3643 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country FR _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biomed Pharmacother' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1950-6007 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 165 _citation.language ? _citation.page_first 115173 _citation.page_last 115173 _citation.title 'Structure-function relationship of new peptides activating human Na v 1.1.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.biopha.2023.115173 _citation.pdbx_database_id_PubMed 37453200 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lopez, L.' 1 ? primary 'De Waard, S.' 2 ? primary 'Meudal, H.' 3 ? primary 'Caumes, C.' 4 ? primary 'Khakh, K.' 5 ? primary 'Peigneur, S.' 6 ? primary 'Oliveira-Mendes, B.' 7 ? primary 'Lin, S.' 8 ? primary 'De Waele, J.' 9 ? primary 'Montnach, J.' 10 ? primary 'Cestele, S.' 11 ? primary 'Tessier, A.' 12 ? primary 'Johnson, J.P.' 13 ? primary 'Mantegazza, M.' 14 ? primary 'Tytgat, J.' 15 ? primary 'Cohen, C.' 16 ? primary 'Beroud, R.' 17 ? primary 'Bosmans, F.' 18 ? primary 'Landon, C.' 19 ? primary 'De Waard, M.' 20 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description Mu-theraphotoxin-Cg1a _entity.formula_weight 4096.739 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation H18A _entity.pdbx_fragment ? _entity.details 'JzTx-34 toxin peptide H18A mutant' # _entity_name_com.entity_id 1 _entity_name_com.name 'Mu-TRTX-Cg1a,Jingzhaotoxin-34,JZTX-34,Peptide F6-25.51, JzTx-34 toxin peptide' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ACREWLGGCSKDADCCAALECRKKWPYHCVWDWTV _entity_poly.pdbx_seq_one_letter_code_can ACREWLGGCSKDADCCAALECRKKWPYHCVWDWTV _entity_poly.pdbx_strand_id B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 CYS n 1 3 ARG n 1 4 GLU n 1 5 TRP n 1 6 LEU n 1 7 GLY n 1 8 GLY n 1 9 CYS n 1 10 SER n 1 11 LYS n 1 12 ASP n 1 13 ALA n 1 14 ASP n 1 15 CYS n 1 16 CYS n 1 17 ALA n 1 18 ALA n 1 19 LEU n 1 20 GLU n 1 21 CYS n 1 22 ARG n 1 23 LYS n 1 24 LYS n 1 25 TRP n 1 26 PRO n 1 27 TYR n 1 28 HIS n 1 29 CYS n 1 30 VAL n 1 31 TRP n 1 32 ASP n 1 33 TRP n 1 34 THR n 1 35 VAL n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 35 _pdbx_entity_src_syn.organism_scientific Chilobrachys _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 278059 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA B . n A 1 2 CYS 2 2 2 CYS CYS B . n A 1 3 ARG 3 3 3 ARG ARG B . n A 1 4 GLU 4 4 4 GLU GLU B . n A 1 5 TRP 5 5 5 TRP TRP B . n A 1 6 LEU 6 6 6 LEU LEU B . n A 1 7 GLY 7 7 7 GLY GLY B . n A 1 8 GLY 8 8 8 GLY GLY B . n A 1 9 CYS 9 9 9 CYS CYS B . n A 1 10 SER 10 10 10 SER SER B . n A 1 11 LYS 11 11 11 LYS LYS B . n A 1 12 ASP 12 12 12 ASP ASP B . n A 1 13 ALA 13 13 13 ALA ALA B . n A 1 14 ASP 14 14 14 ASP ASP B . n A 1 15 CYS 15 15 15 CYS CYS B . n A 1 16 CYS 16 16 16 CYS CYS B . n A 1 17 ALA 17 17 17 ALA ALA B . n A 1 18 ALA 18 18 18 ALA ALA B . n A 1 19 LEU 19 19 19 LEU LEU B . n A 1 20 GLU 20 20 20 GLU GLU B . n A 1 21 CYS 21 21 21 CYS CYS B . n A 1 22 ARG 22 22 22 ARG ARG B . n A 1 23 LYS 23 23 23 LYS LYS B . n A 1 24 LYS 24 24 24 LYS LYS B . n A 1 25 TRP 25 25 25 TRP TRP B . n A 1 26 PRO 26 26 26 PRO PRO B . n A 1 27 TYR 27 27 27 TYR TYR B . n A 1 28 HIS 28 28 28 HIS HIS B . n A 1 29 CYS 29 29 29 CYS CYS B . n A 1 30 VAL 30 30 30 VAL VAL B . n A 1 31 TRP 31 31 31 TRP TRP B . n A 1 32 ASP 32 32 32 ASP ASP B . n A 1 33 TRP 33 33 33 TRP TRP B . n A 1 34 THR 34 34 34 THR THR B . n A 1 35 VAL 35 35 35 VAL VAL B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8CJP _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8CJP _struct.title 'JzTx-34 toxin peptide H18A mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8CJP _struct_keywords.text 'TOXIN JZTX-34 WILD TYPE PEPTIDE TOXIN hNav1.1 channel sodium channel, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code JZT34_CHIGU _struct_ref.pdbx_db_accession B1P1F7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ACREWLGGCSKDADCCAHLECRKKWPYHCVWDWTV _struct_ref.pdbx_align_begin 51 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8CJP _struct_ref_seq.pdbx_strand_id B _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B1P1F7 _struct_ref_seq.db_align_beg 51 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 85 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 35 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8CJP _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id B _struct_ref_seq_dif.seq_num 18 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code B1P1F7 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 68 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 18 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 16 SG ? ? B CYS 2 B CYS 16 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 21 SG ? ? B CYS 9 B CYS 21 1_555 ? ? ? ? ? ? ? 2.023 ? ? disulf3 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 29 SG ? ? B CYS 15 B CYS 29 1_555 ? ? ? ? ? ? ? 2.026 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 2 ? CYS A 16 ? CYS B 2 ? 1_555 CYS B 16 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 9 ? CYS A 21 ? CYS B 9 ? 1_555 CYS B 21 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 15 ? CYS A 29 ? CYS B 15 ? 1_555 CYS B 29 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TRP 25 A . ? TRP 25 B PRO 26 A ? PRO 26 B 1 -0.31 2 TRP 25 A . ? TRP 25 B PRO 26 A ? PRO 26 B 2 -7.18 3 TRP 25 A . ? TRP 25 B PRO 26 A ? PRO 26 B 3 -5.25 4 TRP 25 A . ? TRP 25 B PRO 26 A ? PRO 26 B 4 -7.18 5 TRP 25 A . ? TRP 25 B PRO 26 A ? PRO 26 B 5 -6.89 6 TRP 25 A . ? TRP 25 B PRO 26 A ? PRO 26 B 6 -5.07 7 TRP 25 A . ? TRP 25 B PRO 26 A ? PRO 26 B 7 -7.08 8 TRP 25 A . ? TRP 25 B PRO 26 A ? PRO 26 B 8 -4.03 9 TRP 25 A . ? TRP 25 B PRO 26 A ? PRO 26 B 9 0.59 10 TRP 25 A . ? TRP 25 B PRO 26 A ? PRO 26 B 10 -6.87 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 19 ? CYS A 21 ? LEU B 19 CYS B 21 AA1 2 CYS A 29 ? TRP A 31 ? CYS B 29 TRP B 31 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 20 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLU _pdbx_struct_sheet_hbond.range_1_auth_asym_id B _pdbx_struct_sheet_hbond.range_1_auth_seq_id 20 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 30 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id B _pdbx_struct_sheet_hbond.range_2_auth_seq_id 30 # _pdbx_entry_details.entry_id 8CJP _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA B 13 ? ? -81.43 47.18 2 1 ASP B 14 ? ? 83.03 -27.43 3 1 CYS B 15 ? ? 67.31 -43.47 4 1 CYS B 16 ? ? -122.06 -75.99 5 2 GLU B 4 ? ? -90.17 -159.07 6 2 CYS B 9 ? ? -61.90 94.79 7 2 ALA B 13 ? ? -83.40 45.15 8 2 ASP B 14 ? ? 83.91 -26.01 9 2 CYS B 15 ? ? 68.29 -36.12 10 2 CYS B 16 ? ? -134.10 -71.94 11 2 ALA B 17 ? ? -172.15 134.85 12 3 ASP B 14 ? ? 171.07 -21.70 13 3 CYS B 15 ? ? 69.93 -34.19 14 3 CYS B 16 ? ? -141.31 -74.61 15 4 ASP B 14 ? ? 174.25 -19.35 16 4 CYS B 15 ? ? 67.43 -28.38 17 4 CYS B 16 ? ? -145.83 -67.83 18 4 ALA B 17 ? ? -175.69 133.90 19 5 GLU B 4 ? ? -79.11 -168.01 20 5 CYS B 9 ? ? -57.35 107.18 21 5 ALA B 13 ? ? -83.51 47.31 22 5 ASP B 14 ? ? 78.81 -20.43 23 5 CYS B 15 ? ? 67.57 -30.22 24 5 CYS B 16 ? ? -144.99 -64.69 25 5 ALA B 17 ? ? -133.98 -80.70 26 6 GLU B 4 ? ? -84.85 -159.97 27 6 ASP B 12 ? ? -84.00 33.27 28 6 ASP B 14 ? ? 170.53 -26.16 29 6 CYS B 15 ? ? 65.75 -31.80 30 6 CYS B 16 ? ? -134.80 -80.63 31 6 ALA B 18 ? ? 59.81 15.79 32 7 CYS B 9 ? ? -59.95 109.12 33 7 ASP B 14 ? ? 171.67 -20.80 34 7 CYS B 15 ? ? 68.79 -31.69 35 7 CYS B 16 ? ? -145.11 -68.24 36 7 ALA B 17 ? ? -171.23 132.29 37 8 ASP B 14 ? ? 82.32 -25.61 38 8 CYS B 15 ? ? 68.32 -34.31 39 8 CYS B 16 ? ? -137.07 -70.31 40 8 ALA B 17 ? ? -174.00 136.03 41 9 GLU B 4 ? ? -78.79 -164.39 42 9 ASP B 14 ? ? 79.41 -22.52 43 9 CYS B 15 ? ? 69.96 -43.92 44 9 CYS B 16 ? ? -128.74 -81.92 45 9 ARG B 22 ? ? -57.78 103.70 46 9 LYS B 23 ? ? -75.96 29.18 47 10 GLU B 4 ? ? -69.75 -169.81 48 10 ASP B 14 ? ? 171.13 -26.78 49 10 CYS B 15 ? ? 65.37 -29.33 50 10 CYS B 16 ? ? -138.46 -70.55 51 10 ALA B 17 ? ? -172.36 132.43 52 10 LYS B 23 ? ? -78.24 39.06 # _pdbx_nmr_ensemble.entry_id 8CJP _pdbx_nmr_ensemble.conformers_calculated_total_number 250 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8CJP _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.1 mM unlabelled JzTx-34 H18A mutant (Jingzhaotoxin-34), 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label unlabelled _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'JzTx-34 H18A mutant (Jingzhaotoxin-34)' _pdbx_nmr_exptl_sample.concentration 0.1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling unlabelled # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label unlabelled _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 anisotropic 2 1 1 '2D 1H-1H NOESY' 1 anisotropic 3 1 1 '2D 1H-1H COSY' 1 anisotropic 4 1 1 '2D 1H-15N HSQC' 1 anisotropic 5 1 1 '2D 1H-13C HSQC' 1 anisotropic # _pdbx_nmr_refine.entry_id 8CJP _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement ARIA 2.3 ;Linge, O'Donoghue and Nilges ; 2 'structure calculation' ARIA 2.3 ;Linge, O'Donoghue and Nilges ; 3 'chemical shift assignment' 'CcpNmr Analysis' 2.1 CCPN 4 'peak picking' 'CcpNmr Analysis' 2.1 CCPN # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLU N N N N 71 GLU CA C N S 72 GLU C C N N 73 GLU O O N N 74 GLU CB C N N 75 GLU CG C N N 76 GLU CD C N N 77 GLU OE1 O N N 78 GLU OE2 O N N 79 GLU OXT O N N 80 GLU H H N N 81 GLU H2 H N N 82 GLU HA H N N 83 GLU HB2 H N N 84 GLU HB3 H N N 85 GLU HG2 H N N 86 GLU HG3 H N N 87 GLU HE2 H N N 88 GLU HXT H N N 89 GLY N N N N 90 GLY CA C N N 91 GLY C C N N 92 GLY O O N N 93 GLY OXT O N N 94 GLY H H N N 95 GLY H2 H N N 96 GLY HA2 H N N 97 GLY HA3 H N N 98 GLY HXT H N N 99 HIS N N N N 100 HIS CA C N S 101 HIS C C N N 102 HIS O O N N 103 HIS CB C N N 104 HIS CG C Y N 105 HIS ND1 N Y N 106 HIS CD2 C Y N 107 HIS CE1 C Y N 108 HIS NE2 N Y N 109 HIS OXT O N N 110 HIS H H N N 111 HIS H2 H N N 112 HIS HA H N N 113 HIS HB2 H N N 114 HIS HB3 H N N 115 HIS HD1 H N N 116 HIS HD2 H N N 117 HIS HE1 H N N 118 HIS HE2 H N N 119 HIS HXT H N N 120 LEU N N N N 121 LEU CA C N S 122 LEU C C N N 123 LEU O O N N 124 LEU CB C N N 125 LEU CG C N N 126 LEU CD1 C N N 127 LEU CD2 C N N 128 LEU OXT O N N 129 LEU H H N N 130 LEU H2 H N N 131 LEU HA H N N 132 LEU HB2 H N N 133 LEU HB3 H N N 134 LEU HG H N N 135 LEU HD11 H N N 136 LEU HD12 H N N 137 LEU HD13 H N N 138 LEU HD21 H N N 139 LEU HD22 H N N 140 LEU HD23 H N N 141 LEU HXT H N N 142 LYS N N N N 143 LYS CA C N S 144 LYS C C N N 145 LYS O O N N 146 LYS CB C N N 147 LYS CG C N N 148 LYS CD C N N 149 LYS CE C N N 150 LYS NZ N N N 151 LYS OXT O N N 152 LYS H H N N 153 LYS H2 H N N 154 LYS HA H N N 155 LYS HB2 H N N 156 LYS HB3 H N N 157 LYS HG2 H N N 158 LYS HG3 H N N 159 LYS HD2 H N N 160 LYS HD3 H N N 161 LYS HE2 H N N 162 LYS HE3 H N N 163 LYS HZ1 H N N 164 LYS HZ2 H N N 165 LYS HZ3 H N N 166 LYS HXT H N N 167 PRO N N N N 168 PRO CA C N S 169 PRO C C N N 170 PRO O O N N 171 PRO CB C N N 172 PRO CG C N N 173 PRO CD C N N 174 PRO OXT O N N 175 PRO H H N N 176 PRO HA H N N 177 PRO HB2 H N N 178 PRO HB3 H N N 179 PRO HG2 H N N 180 PRO HG3 H N N 181 PRO HD2 H N N 182 PRO HD3 H N N 183 PRO HXT H N N 184 SER N N N N 185 SER CA C N S 186 SER C C N N 187 SER O O N N 188 SER CB C N N 189 SER OG O N N 190 SER OXT O N N 191 SER H H N N 192 SER H2 H N N 193 SER HA H N N 194 SER HB2 H N N 195 SER HB3 H N N 196 SER HG H N N 197 SER HXT H N N 198 THR N N N N 199 THR CA C N S 200 THR C C N N 201 THR O O N N 202 THR CB C N R 203 THR OG1 O N N 204 THR CG2 C N N 205 THR OXT O N N 206 THR H H N N 207 THR H2 H N N 208 THR HA H N N 209 THR HB H N N 210 THR HG1 H N N 211 THR HG21 H N N 212 THR HG22 H N N 213 THR HG23 H N N 214 THR HXT H N N 215 TRP N N N N 216 TRP CA C N S 217 TRP C C N N 218 TRP O O N N 219 TRP CB C N N 220 TRP CG C Y N 221 TRP CD1 C Y N 222 TRP CD2 C Y N 223 TRP NE1 N Y N 224 TRP CE2 C Y N 225 TRP CE3 C Y N 226 TRP CZ2 C Y N 227 TRP CZ3 C Y N 228 TRP CH2 C Y N 229 TRP OXT O N N 230 TRP H H N N 231 TRP H2 H N N 232 TRP HA H N N 233 TRP HB2 H N N 234 TRP HB3 H N N 235 TRP HD1 H N N 236 TRP HE1 H N N 237 TRP HE3 H N N 238 TRP HZ2 H N N 239 TRP HZ3 H N N 240 TRP HH2 H N N 241 TRP HXT H N N 242 TYR N N N N 243 TYR CA C N S 244 TYR C C N N 245 TYR O O N N 246 TYR CB C N N 247 TYR CG C Y N 248 TYR CD1 C Y N 249 TYR CD2 C Y N 250 TYR CE1 C Y N 251 TYR CE2 C Y N 252 TYR CZ C Y N 253 TYR OH O N N 254 TYR OXT O N N 255 TYR H H N N 256 TYR H2 H N N 257 TYR HA H N N 258 TYR HB2 H N N 259 TYR HB3 H N N 260 TYR HD1 H N N 261 TYR HD2 H N N 262 TYR HE1 H N N 263 TYR HE2 H N N 264 TYR HH H N N 265 TYR HXT H N N 266 VAL N N N N 267 VAL CA C N S 268 VAL C C N N 269 VAL O O N N 270 VAL CB C N N 271 VAL CG1 C N N 272 VAL CG2 C N N 273 VAL OXT O N N 274 VAL H H N N 275 VAL H2 H N N 276 VAL HA H N N 277 VAL HB H N N 278 VAL HG11 H N N 279 VAL HG12 H N N 280 VAL HG13 H N N 281 VAL HG21 H N N 282 VAL HG22 H N N 283 VAL HG23 H N N 284 VAL HXT H N N 285 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLU N CA sing N N 67 GLU N H sing N N 68 GLU N H2 sing N N 69 GLU CA C sing N N 70 GLU CA CB sing N N 71 GLU CA HA sing N N 72 GLU C O doub N N 73 GLU C OXT sing N N 74 GLU CB CG sing N N 75 GLU CB HB2 sing N N 76 GLU CB HB3 sing N N 77 GLU CG CD sing N N 78 GLU CG HG2 sing N N 79 GLU CG HG3 sing N N 80 GLU CD OE1 doub N N 81 GLU CD OE2 sing N N 82 GLU OE2 HE2 sing N N 83 GLU OXT HXT sing N N 84 GLY N CA sing N N 85 GLY N H sing N N 86 GLY N H2 sing N N 87 GLY CA C sing N N 88 GLY CA HA2 sing N N 89 GLY CA HA3 sing N N 90 GLY C O doub N N 91 GLY C OXT sing N N 92 GLY OXT HXT sing N N 93 HIS N CA sing N N 94 HIS N H sing N N 95 HIS N H2 sing N N 96 HIS CA C sing N N 97 HIS CA CB sing N N 98 HIS CA HA sing N N 99 HIS C O doub N N 100 HIS C OXT sing N N 101 HIS CB CG sing N N 102 HIS CB HB2 sing N N 103 HIS CB HB3 sing N N 104 HIS CG ND1 sing Y N 105 HIS CG CD2 doub Y N 106 HIS ND1 CE1 doub Y N 107 HIS ND1 HD1 sing N N 108 HIS CD2 NE2 sing Y N 109 HIS CD2 HD2 sing N N 110 HIS CE1 NE2 sing Y N 111 HIS CE1 HE1 sing N N 112 HIS NE2 HE2 sing N N 113 HIS OXT HXT sing N N 114 LEU N CA sing N N 115 LEU N H sing N N 116 LEU N H2 sing N N 117 LEU CA C sing N N 118 LEU CA CB sing N N 119 LEU CA HA sing N N 120 LEU C O doub N N 121 LEU C OXT sing N N 122 LEU CB CG sing N N 123 LEU CB HB2 sing N N 124 LEU CB HB3 sing N N 125 LEU CG CD1 sing N N 126 LEU CG CD2 sing N N 127 LEU CG HG sing N N 128 LEU CD1 HD11 sing N N 129 LEU CD1 HD12 sing N N 130 LEU CD1 HD13 sing N N 131 LEU CD2 HD21 sing N N 132 LEU CD2 HD22 sing N N 133 LEU CD2 HD23 sing N N 134 LEU OXT HXT sing N N 135 LYS N CA sing N N 136 LYS N H sing N N 137 LYS N H2 sing N N 138 LYS CA C sing N N 139 LYS CA CB sing N N 140 LYS CA HA sing N N 141 LYS C O doub N N 142 LYS C OXT sing N N 143 LYS CB CG sing N N 144 LYS CB HB2 sing N N 145 LYS CB HB3 sing N N 146 LYS CG CD sing N N 147 LYS CG HG2 sing N N 148 LYS CG HG3 sing N N 149 LYS CD CE sing N N 150 LYS CD HD2 sing N N 151 LYS CD HD3 sing N N 152 LYS CE NZ sing N N 153 LYS CE HE2 sing N N 154 LYS CE HE3 sing N N 155 LYS NZ HZ1 sing N N 156 LYS NZ HZ2 sing N N 157 LYS NZ HZ3 sing N N 158 LYS OXT HXT sing N N 159 PRO N CA sing N N 160 PRO N CD sing N N 161 PRO N H sing N N 162 PRO CA C sing N N 163 PRO CA CB sing N N 164 PRO CA HA sing N N 165 PRO C O doub N N 166 PRO C OXT sing N N 167 PRO CB CG sing N N 168 PRO CB HB2 sing N N 169 PRO CB HB3 sing N N 170 PRO CG CD sing N N 171 PRO CG HG2 sing N N 172 PRO CG HG3 sing N N 173 PRO CD HD2 sing N N 174 PRO CD HD3 sing N N 175 PRO OXT HXT sing N N 176 SER N CA sing N N 177 SER N H sing N N 178 SER N H2 sing N N 179 SER CA C sing N N 180 SER CA CB sing N N 181 SER CA HA sing N N 182 SER C O doub N N 183 SER C OXT sing N N 184 SER CB OG sing N N 185 SER CB HB2 sing N N 186 SER CB HB3 sing N N 187 SER OG HG sing N N 188 SER OXT HXT sing N N 189 THR N CA sing N N 190 THR N H sing N N 191 THR N H2 sing N N 192 THR CA C sing N N 193 THR CA CB sing N N 194 THR CA HA sing N N 195 THR C O doub N N 196 THR C OXT sing N N 197 THR CB OG1 sing N N 198 THR CB CG2 sing N N 199 THR CB HB sing N N 200 THR OG1 HG1 sing N N 201 THR CG2 HG21 sing N N 202 THR CG2 HG22 sing N N 203 THR CG2 HG23 sing N N 204 THR OXT HXT sing N N 205 TRP N CA sing N N 206 TRP N H sing N N 207 TRP N H2 sing N N 208 TRP CA C sing N N 209 TRP CA CB sing N N 210 TRP CA HA sing N N 211 TRP C O doub N N 212 TRP C OXT sing N N 213 TRP CB CG sing N N 214 TRP CB HB2 sing N N 215 TRP CB HB3 sing N N 216 TRP CG CD1 doub Y N 217 TRP CG CD2 sing Y N 218 TRP CD1 NE1 sing Y N 219 TRP CD1 HD1 sing N N 220 TRP CD2 CE2 doub Y N 221 TRP CD2 CE3 sing Y N 222 TRP NE1 CE2 sing Y N 223 TRP NE1 HE1 sing N N 224 TRP CE2 CZ2 sing Y N 225 TRP CE3 CZ3 doub Y N 226 TRP CE3 HE3 sing N N 227 TRP CZ2 CH2 doub Y N 228 TRP CZ2 HZ2 sing N N 229 TRP CZ3 CH2 sing Y N 230 TRP CZ3 HZ3 sing N N 231 TRP CH2 HH2 sing N N 232 TRP OXT HXT sing N N 233 TYR N CA sing N N 234 TYR N H sing N N 235 TYR N H2 sing N N 236 TYR CA C sing N N 237 TYR CA CB sing N N 238 TYR CA HA sing N N 239 TYR C O doub N N 240 TYR C OXT sing N N 241 TYR CB CG sing N N 242 TYR CB HB2 sing N N 243 TYR CB HB3 sing N N 244 TYR CG CD1 doub Y N 245 TYR CG CD2 sing Y N 246 TYR CD1 CE1 sing Y N 247 TYR CD1 HD1 sing N N 248 TYR CD2 CE2 doub Y N 249 TYR CD2 HD2 sing N N 250 TYR CE1 CZ doub Y N 251 TYR CE1 HE1 sing N N 252 TYR CE2 CZ sing Y N 253 TYR CE2 HE2 sing N N 254 TYR CZ OH sing N N 255 TYR OH HH sing N N 256 TYR OXT HXT sing N N 257 VAL N CA sing N N 258 VAL N H sing N N 259 VAL N H2 sing N N 260 VAL CA C sing N N 261 VAL CA CB sing N N 262 VAL CA HA sing N N 263 VAL C O doub N N 264 VAL C OXT sing N N 265 VAL CB CG1 sing N N 266 VAL CB CG2 sing N N 267 VAL CB HB sing N N 268 VAL CG1 HG11 sing N N 269 VAL CG1 HG12 sing N N 270 VAL CG1 HG13 sing N N 271 VAL CG2 HG21 sing N N 272 VAL CG2 HG22 sing N N 273 VAL CG2 HG23 sing N N 274 VAL OXT HXT sing N N 275 # _pdbx_audit_support.funding_organization 'Centre National de la Recherche Scientifique (CNRS)' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details cryoprobe # _atom_sites.entry_id 8CJP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #