data_8CJQ # _entry.id 8CJQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.373 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8CJQ pdb_00008cjq 10.2210/pdb8cjq/pdb WWPDB D_1292128574 ? ? BMRB 34792 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Wild type' 8CIQ unspecified BMRB 'JzTx-34 toxin peptide' 34792 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8CJQ _pdbx_database_status.recvd_initial_deposition_date 2023-02-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Landon, C.' 1 0000-0002-0248-1990 'Meudal, H.' 2 0000-0002-9642-3643 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country FR _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biomed Pharmacother' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1950-6007 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 165 _citation.language ? _citation.page_first 115173 _citation.page_last 115173 _citation.title 'Structure-function relationship of new peptides activating human Na v 1.1.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.biopha.2023.115173 _citation.pdbx_database_id_PubMed 37453200 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lopez, L.' 1 ? primary 'De Waard, S.' 2 ? primary 'Meudal, H.' 3 ? primary 'Caumes, C.' 4 ? primary 'Khakh, K.' 5 ? primary 'Peigneur, S.' 6 ? primary 'Oliveira-Mendes, B.' 7 ? primary 'Lin, S.' 8 ? primary 'De Waele, J.' 9 ? primary 'Montnach, J.' 10 ? primary 'Cestele, S.' 11 ? primary 'Tessier, A.' 12 ? primary 'Johnson, J.P.' 13 ? primary 'Mantegazza, M.' 14 ? primary 'Tytgat, J.' 15 ? primary 'Cohen, C.' 16 ? primary 'Beroud, R.' 17 ? primary 'Bosmans, F.' 18 ? primary 'Landon, C.' 19 ? primary 'De Waard, M.' 20 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description Mu-theraphotoxin-Cg1a _entity.formula_weight 4105.772 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation E20A _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Mu-TRTX-Cg1a,Jingzhaotoxin-34,JZTX-34,Peptide F6-25.51' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ACREWLGGCSKDADCCAHLACRKKWPYHCVWDWTV _entity_poly.pdbx_seq_one_letter_code_can ACREWLGGCSKDADCCAHLACRKKWPYHCVWDWTV _entity_poly.pdbx_strand_id D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 CYS n 1 3 ARG n 1 4 GLU n 1 5 TRP n 1 6 LEU n 1 7 GLY n 1 8 GLY n 1 9 CYS n 1 10 SER n 1 11 LYS n 1 12 ASP n 1 13 ALA n 1 14 ASP n 1 15 CYS n 1 16 CYS n 1 17 ALA n 1 18 HIS n 1 19 LEU n 1 20 ALA n 1 21 CYS n 1 22 ARG n 1 23 LYS n 1 24 LYS n 1 25 TRP n 1 26 PRO n 1 27 TYR n 1 28 HIS n 1 29 CYS n 1 30 VAL n 1 31 TRP n 1 32 ASP n 1 33 TRP n 1 34 THR n 1 35 VAL n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 35 _pdbx_entity_src_syn.organism_scientific Chilobrachys _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 278059 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code JZT34_CHIGU _struct_ref.pdbx_db_accession B1P1F7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ACREWLGGCSKDADCCAHLECRKKWPYHCVWDWTV _struct_ref.pdbx_align_begin 51 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8CJQ _struct_ref_seq.pdbx_strand_id D _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B1P1F7 _struct_ref_seq.db_align_beg 51 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 85 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 35 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8CJQ _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id D _struct_ref_seq_dif.seq_num 20 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code B1P1F7 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 70 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 20 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 anisotropic 2 1 1 '2D 1H-1H NOESY' 1 anisotropic 3 1 1 '2D 1H-1H COSY' 1 anisotropic 4 1 1 '2D 1H-15N HSQC' 1 anisotropic 5 1 1 '2D 1H-13C HSQC' 1 anisotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label unlabelled _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.1 mM unlabelled JzTx-34 E20A mutant (Jingzhaotoxin-34), 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label unlabelled _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details cryoprobe # _pdbx_nmr_refine.entry_id 8CJQ _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 8CJQ _pdbx_nmr_ensemble.conformers_calculated_total_number 250 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8CJQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement ARIA 2.3 ;Linge, O'Donoghue and Nilges ; 2 'structure calculation' ARIA 2.3 ;Linge, O'Donoghue and Nilges ; 3 'chemical shift assignment' 'CcpNmr Analysis' 2.1 CCPN 4 'peak picking' 'CcpNmr Analysis' 2.1 CCPN # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8CJQ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8CJQ _struct.title 'JzTx-34 toxin peptide E20A mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8CJQ _struct_keywords.text 'JZTX-34 PEPTIDE TOXIN, hNav1.1 channel sodium channel, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 16 SG ? ? D CYS 2 D CYS 16 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 21 SG ? ? D CYS 9 D CYS 21 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf3 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 29 SG ? ? D CYS 15 D CYS 29 1_555 ? ? ? ? ? ? ? 2.031 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TRP 25 A . ? TRP 25 D PRO 26 A ? PRO 26 D 1 -7.73 2 TRP 25 A . ? TRP 25 D PRO 26 A ? PRO 26 D 2 -8.70 3 TRP 25 A . ? TRP 25 D PRO 26 A ? PRO 26 D 3 -14.41 4 TRP 25 A . ? TRP 25 D PRO 26 A ? PRO 26 D 4 -13.31 5 TRP 25 A . ? TRP 25 D PRO 26 A ? PRO 26 D 5 -12.68 6 TRP 25 A . ? TRP 25 D PRO 26 A ? PRO 26 D 6 -7.10 7 TRP 25 A . ? TRP 25 D PRO 26 A ? PRO 26 D 7 -9.67 8 TRP 25 A . ? TRP 25 D PRO 26 A ? PRO 26 D 8 -12.84 9 TRP 25 A . ? TRP 25 D PRO 26 A ? PRO 26 D 9 -13.40 10 TRP 25 A . ? TRP 25 D PRO 26 A ? PRO 26 D 10 -7.93 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 19 ? ALA A 20 ? LEU D 19 ALA D 20 AA1 2 VAL A 30 ? TRP A 31 ? VAL D 30 TRP D 31 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ALA _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 20 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_1_auth_asym_id D _pdbx_struct_sheet_hbond.range_1_auth_seq_id 20 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 30 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id D _pdbx_struct_sheet_hbond.range_2_auth_seq_id 30 # _atom_sites.entry_id 8CJQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA D . n A 1 2 CYS 2 2 2 CYS CYS D . n A 1 3 ARG 3 3 3 ARG ARG D . n A 1 4 GLU 4 4 4 GLU GLU D . n A 1 5 TRP 5 5 5 TRP TRP D . n A 1 6 LEU 6 6 6 LEU LEU D . n A 1 7 GLY 7 7 7 GLY GLY D . n A 1 8 GLY 8 8 8 GLY GLY D . n A 1 9 CYS 9 9 9 CYS CYS D . n A 1 10 SER 10 10 10 SER SER D . n A 1 11 LYS 11 11 11 LYS LYS D . n A 1 12 ASP 12 12 12 ASP ASP D . n A 1 13 ALA 13 13 13 ALA ALA D . n A 1 14 ASP 14 14 14 ASP ASP D . n A 1 15 CYS 15 15 15 CYS CYS D . n A 1 16 CYS 16 16 16 CYS CYS D . n A 1 17 ALA 17 17 17 ALA ALA D . n A 1 18 HIS 18 18 18 HIS HIS D . n A 1 19 LEU 19 19 19 LEU LEU D . n A 1 20 ALA 20 20 20 ALA ALA D . n A 1 21 CYS 21 21 21 CYS CYS D . n A 1 22 ARG 22 22 22 ARG ARG D . n A 1 23 LYS 23 23 23 LYS LYS D . n A 1 24 LYS 24 24 24 LYS LYS D . n A 1 25 TRP 25 25 25 TRP TRP D . n A 1 26 PRO 26 26 26 PRO PRO D . n A 1 27 TYR 27 27 27 TYR TYR D . n A 1 28 HIS 28 28 28 HIS HIS D . n A 1 29 CYS 29 29 29 CYS CYS D . n A 1 30 VAL 30 30 30 VAL VAL D . n A 1 31 TRP 31 31 31 TRP TRP D . n A 1 32 ASP 32 32 32 ASP ASP D . n A 1 33 TRP 33 33 33 TRP TRP D . n A 1 34 THR 34 34 34 THR THR D . n A 1 35 VAL 35 35 35 VAL VAL D . n # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 celine.landon@cnrs-orleans.fr Celine Landon ? 'principal investigator/group leader' 0000-0002-0248-1990 3 herve.meudal@cnrs-orleans.fr Herve Meudal ? 'principal investigator/group leader' 0000-0002-9642-3643 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-07-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'JzTx-34 E20A mutant (Jingzhaotoxin-34)' _pdbx_nmr_exptl_sample.concentration 0.1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling unlabelled # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP D 14 ? ? 41.60 29.95 2 1 CYS D 15 ? ? 43.97 -84.03 3 1 CYS D 16 ? ? -84.53 -78.15 4 1 TRP D 25 ? ? 69.28 141.99 5 1 HIS D 28 ? ? -152.80 36.67 6 1 CYS D 29 ? ? 57.95 117.73 7 2 LYS D 11 ? ? -176.96 148.72 8 2 ALA D 13 ? ? -77.02 47.74 9 2 CYS D 15 ? ? 44.66 -85.18 10 2 CYS D 16 ? ? -86.88 -87.49 11 2 LEU D 19 ? ? -122.04 -156.18 12 2 ALA D 20 ? ? 174.75 132.57 13 2 TRP D 25 ? ? 69.86 139.63 14 2 HIS D 28 ? ? -159.31 50.83 15 2 CYS D 29 ? ? 53.15 108.62 16 3 LYS D 11 ? ? -173.21 149.57 17 3 ASP D 14 ? ? 44.75 23.36 18 3 CYS D 15 ? ? 41.48 -86.40 19 3 CYS D 16 ? ? -86.29 -76.37 20 3 ALA D 20 ? ? -170.47 140.64 21 3 ARG D 22 ? ? -55.15 104.42 22 3 LYS D 23 ? ? -96.50 52.49 23 3 LYS D 24 ? ? -150.11 -70.72 24 3 TRP D 25 ? ? 175.96 133.58 25 3 HIS D 28 ? ? -142.63 35.15 26 3 CYS D 29 ? ? 61.45 126.82 27 4 ASP D 14 ? ? 43.56 27.81 28 4 CYS D 15 ? ? 40.05 -88.78 29 4 CYS D 16 ? ? -80.85 -76.88 30 4 ALA D 17 ? ? -170.06 145.84 31 4 CYS D 21 ? ? -64.39 96.36 32 4 ARG D 22 ? ? -31.38 103.77 33 4 LYS D 23 ? ? -84.52 45.83 34 4 HIS D 28 ? ? -154.38 42.72 35 4 CYS D 29 ? ? 54.48 113.10 36 5 ASP D 14 ? ? 44.57 23.60 37 5 CYS D 15 ? ? 43.83 -81.42 38 5 CYS D 16 ? ? -84.85 -75.15 39 5 ARG D 22 ? ? -56.24 106.05 40 5 TRP D 25 ? ? 70.55 143.54 41 5 HIS D 28 ? ? -151.98 30.88 42 5 CYS D 29 ? ? 60.40 130.41 43 6 ASP D 14 ? ? 45.29 22.05 44 6 CYS D 15 ? ? 40.24 -86.42 45 6 CYS D 16 ? ? -81.19 -77.75 46 6 ALA D 17 ? ? -172.25 147.03 47 6 TRP D 25 ? ? 68.74 138.81 48 6 HIS D 28 ? ? -152.49 41.76 49 6 CYS D 29 ? ? 58.14 122.62 50 7 ASP D 14 ? ? 46.01 20.10 51 7 CYS D 15 ? ? 42.38 -82.73 52 7 CYS D 16 ? ? -84.98 -79.62 53 7 ALA D 20 ? ? -173.68 134.24 54 7 ARG D 22 ? ? -57.67 97.03 55 7 LYS D 23 ? ? -99.39 34.36 56 7 LYS D 24 ? ? -141.27 11.78 57 7 TRP D 25 ? ? 70.78 142.45 58 7 HIS D 28 ? ? -154.21 35.48 59 7 CYS D 29 ? ? 58.93 125.24 60 8 ALA D 13 ? ? -105.88 53.45 61 8 ASP D 14 ? ? 44.65 27.33 62 8 CYS D 15 ? ? 42.56 -85.26 63 8 CYS D 16 ? ? -83.04 -77.89 64 8 ALA D 17 ? ? -171.24 146.37 65 8 CYS D 21 ? ? -63.37 98.42 66 8 ARG D 22 ? ? -51.17 107.85 67 8 LYS D 24 ? ? -107.07 -71.87 68 8 TRP D 25 ? ? 167.00 135.33 69 8 HIS D 28 ? ? -157.13 42.77 70 8 CYS D 29 ? ? 54.18 111.44 71 9 ASP D 14 ? ? 47.51 16.79 72 9 CYS D 15 ? ? 44.25 -82.86 73 9 CYS D 16 ? ? -84.46 -76.66 74 9 ALA D 17 ? ? -173.14 148.90 75 9 ARG D 22 ? ? -56.73 102.26 76 9 LYS D 23 ? ? -95.47 47.72 77 9 LYS D 24 ? ? -142.40 -71.53 78 9 TRP D 25 ? ? 166.50 134.14 79 9 HIS D 28 ? ? -152.01 36.04 80 9 CYS D 29 ? ? 60.56 133.19 81 10 ASP D 14 ? ? 45.14 24.21 82 10 CYS D 15 ? ? 42.19 -85.85 83 10 CYS D 16 ? ? -79.72 -75.76 84 10 ALA D 17 ? ? -178.39 149.88 85 10 ALA D 20 ? ? -173.62 133.71 86 10 ARG D 22 ? ? -56.61 103.78 87 10 TRP D 25 ? ? 68.44 138.53 88 10 CYS D 29 ? ? 60.79 126.59 # _pdbx_audit_support.funding_organization 'Centre National de la Recherche Scientifique (CNRS)' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #