data_8CMN # _entry.id 8CMN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8CMN pdb_00008cmn 10.2210/pdb8cmn/pdb WWPDB D_1292128726 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8CMN _pdbx_database_status.recvd_initial_deposition_date 2023-02-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Deepak, D.' 1 0000-0002-0412-2502 'Corvaglia, V.' 2 0000-0002-6180-5975 'Wu, J.' 3 ? 'Huc, I.' 4 0000-0001-7036-9696 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title '18mer DNA mimic Foldamer with an aliphatic linker in complex with Sac7d wild protein' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Deepak, D.' 1 0000-0002-0412-2502 primary 'Corvaglia, V.' 2 0000-0002-6180-5975 primary 'Wu, J.' 3 ? primary 'Huc, I.' 4 0000-0001-7036-9696 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8CMN _cell.details ? _cell.formula_units_Z ? _cell.length_a 71.410 _cell.length_a_esd ? _cell.length_b 71.410 _cell.length_b_esd ? _cell.length_c 116.170 _cell.length_c_esd ? _cell.volume 513029.912 _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8CMN _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall 'P 64 2 (x,y,z+1/6)' _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA-binding protein 7d' 7626.914 1 ? ? ? ? 2 polymer syn 'N-[2-(2-methyl-1,3-dioxolan-2-yl)phenyl]-2-{[5-(trifluoromethyl)pyridin-2-yl]amino}pyridine-4-carboxamide' 2536.719 2 ? ? ? ? 3 water nat water 18.015 7 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '7 kDa DNA-binding protein d,Sac7d' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK AA ? 2 'polypeptide(L)' no yes '(GOA)(V4F)(V53)(V4F)(V53)(V5F)(V4F)(V53)(V4F)(V53)' XXXXXXXXXX B,C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 LYS n 1 4 VAL n 1 5 LYS n 1 6 PHE n 1 7 LYS n 1 8 TYR n 1 9 LYS n 1 10 GLY n 1 11 GLU n 1 12 GLU n 1 13 LYS n 1 14 GLU n 1 15 VAL n 1 16 ASP n 1 17 THR n 1 18 SER n 1 19 LYS n 1 20 ILE n 1 21 LYS n 1 22 LYS n 1 23 VAL n 1 24 TRP n 1 25 ARG n 1 26 VAL n 1 27 GLY n 1 28 LYS n 1 29 MET n 1 30 VAL n 1 31 SER n 1 32 PHE n 1 33 THR n 1 34 TYR n 1 35 ASP n 1 36 ASP n 1 37 ASN n 1 38 GLY n 1 39 LYS n 1 40 THR n 1 41 GLY n 1 42 ARG n 1 43 GLY n 1 44 ALA n 1 45 VAL n 1 46 SER n 1 47 GLU n 1 48 LYS n 1 49 ASP n 1 50 ALA n 1 51 PRO n 1 52 LYS n 1 53 GLU n 1 54 LEU n 1 55 LEU n 1 56 ASP n 1 57 MET n 1 58 LEU n 1 59 ALA n 1 60 ARG n 1 61 ALA n 1 62 GLU n 1 63 ARG n 1 64 GLU n 1 65 LYS n 1 66 LYS n 2 1 GOA n 2 2 V4F n 2 3 V53 n 2 4 V4F n 2 5 V53 n 2 6 V5F n 2 7 V4F n 2 8 V53 n 2 9 V4F n 2 10 V53 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 66 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Saci_0064 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sulfolobus acidocaldarius DSM 639' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 330779 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'plys S' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 10 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP DN7D_SULAC P13123 ? 1 MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK 1 2 PDB 8CMN 8CMN ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8CMN AA 1 ? 66 ? P13123 1 ? 66 ? 1 66 2 2 8CMN B 1 ? 10 ? 8CMN 1 ? 10 ? 1 10 3 2 8CMN C 1 ? 10 ? 8CMN 1 ? 10 ? 1 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOA non-polymer . 'GLYCOLIC ACID' 'HYDROXYACETIC ACID; HYDROXYETHANOIC ACID' 'C2 H4 O3' 76.051 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 V4F 'peptide linking' n '8-(aminomethyl)-4-(phosphonomethoxy)quinoline-2-carboxylic acid' ? 'C12 H13 N2 O6 P' 312.215 V53 'peptide linking' n '8-azanyl-4-(phosphonomethoxy)quinoline-2-carboxylic acid' ? 'C11 H11 N2 O6 P' 298.189 V5F 'peptide linking' . '(2R)-2-(2-azanylphenoxy)propanoic acid' ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8CMN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.88 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 79.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '10% PEG 400, 0.1 M MES pH 6.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 77.36 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 S 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-11-24 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8856 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.8856 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 74.99 _reflns.entry_id 8CMN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.65 _reflns.d_resolution_low 42.34 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5508 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.62 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.81 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.65 _reflns_shell.d_res_low 2.75 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 531 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.81 _reflns_shell.pdbx_CC_star 0.946 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 66.50 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8CMN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.65 _refine.ls_d_res_low 42.34 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5502 _refine.ls_number_reflns_R_free 547 _refine.ls_number_reflns_R_work 4955 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.66 _refine.ls_percent_reflns_R_free 9.94 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2651 _refine.ls_R_factor_R_free 0.2974 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2614 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.39 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.1161 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4450 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.65 _refine_hist.d_res_low 42.34 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 848 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 495 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 346 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0078 ? 877 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 2.6861 ? 1230 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.2531 ? 89 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0132 ? 122 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.0023 ? 182 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.65 2.92 . . 130 1194 99.77 . . . . 0.3585 . . . . . . . . . . . 0.4309 'X-RAY DIFFRACTION' 2.92 3.34 . . 134 1205 99.78 . . . . 0.2904 . . . . . . . . . . . 0.3432 'X-RAY DIFFRACTION' 3.34 4.20 . . 136 1226 99.56 . . . . 0.2420 . . . . . . . . . . . 0.2912 'X-RAY DIFFRACTION' 4.21 42.34 . . 147 1330 99.53 . . . . 0.2531 . . . . . . . . . . . 0.2723 # _struct.entry_id 8CMN _struct.title '18mer DNA mimic Foldamer with an aliphatic linker in complex with Sac7d wild protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8CMN _struct_keywords.text 'Foldamer, DNA mimic, DNA binding protein, histone' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 51 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 62 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id AA _struct_conf.beg_auth_seq_id 51 _struct_conf.end_auth_comp_id GLU _struct_conf.end_auth_asym_id AA _struct_conf.end_auth_seq_id 62 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B GOA 1 C ? ? ? 1_555 B V4F 2 N ? ? B GOA 1 B V4F 2 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale2 covale both ? B V4F 2 C ? ? ? 1_555 B V53 3 N ? ? B V4F 2 B V53 3 1_555 ? ? ? ? ? ? ? 1.352 ? ? covale3 covale both ? B V53 3 C ? ? ? 1_555 B V4F 4 N ? ? B V53 3 B V4F 4 1_555 ? ? ? ? ? ? ? 1.351 ? ? covale4 covale both ? B V4F 4 C ? ? ? 1_555 B V53 5 N ? ? B V4F 4 B V53 5 1_555 ? ? ? ? ? ? ? 1.353 ? ? covale5 covale both ? B V53 5 C ? ? ? 1_555 B V5F 6 N ? ? B V53 5 B V5F 6 1_555 ? ? ? ? ? ? ? 1.359 ? ? covale6 covale both ? B V5F 6 C ? ? ? 1_555 B V4F 7 N ? ? B V5F 6 B V4F 7 1_555 ? ? ? ? ? ? ? 1.343 ? ? covale7 covale both ? B V4F 7 C ? ? ? 1_555 B V53 8 N ? ? B V4F 7 B V53 8 1_555 ? ? ? ? ? ? ? 1.349 ? ? covale8 covale both ? B V53 8 C ? ? ? 1_555 B V4F 9 N ? ? B V53 8 B V4F 9 1_555 ? ? ? ? ? ? ? 1.353 ? ? covale9 covale both ? B V4F 9 C ? ? ? 1_555 B V53 10 N ? ? B V4F 9 B V53 10 1_555 ? ? ? ? ? ? ? 1.350 ? ? covale10 covale both ? C GOA 1 C ? ? ? 1_555 C V4F 2 N ? ? C GOA 1 C V4F 2 1_555 ? ? ? ? ? ? ? 1.349 ? ? covale11 covale both ? C V4F 2 C ? ? ? 1_555 C V53 3 N ? ? C V4F 2 C V53 3 1_555 ? ? ? ? ? ? ? 1.350 ? ? covale12 covale both ? C V53 3 C ? ? ? 1_555 C V4F 4 N ? ? C V53 3 C V4F 4 1_555 ? ? ? ? ? ? ? 1.351 ? ? covale13 covale both ? C V4F 4 C ? ? ? 1_555 C V53 5 N ? ? C V4F 4 C V53 5 1_555 ? ? ? ? ? ? ? 1.350 ? ? covale14 covale both ? C V53 5 C ? ? ? 1_555 C V5F 6 N ? ? C V53 5 C V5F 6 1_555 ? ? ? ? ? ? ? 1.359 ? ? covale15 covale both ? C V5F 6 C ? ? ? 1_555 C V4F 7 N ? ? C V5F 6 C V4F 7 1_555 ? ? ? ? ? ? ? 1.346 ? ? covale16 covale both ? C V4F 7 C ? ? ? 1_555 C V53 8 N ? ? C V4F 7 C V53 8 1_555 ? ? ? ? ? ? ? 1.351 ? ? covale17 covale both ? C V53 8 C ? ? ? 1_555 C V4F 9 N ? ? C V53 8 C V4F 9 1_555 ? ? ? ? ? ? ? 1.348 ? ? covale18 covale both ? C V4F 9 C ? ? ? 1_555 C V53 10 N ? ? C V4F 9 C V53 10 1_555 ? ? ? ? ? ? ? 1.358 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 V4F 2 B . ? V4F 2 B V53 3 B ? V53 3 B 1 -27.27 2 V53 3 B . ? V53 3 B V4F 4 B ? V4F 4 B 1 -26.39 3 V53 5 B . ? V53 5 B V5F 6 B ? V5F 6 B 1 -23.15 4 V53 8 B . ? V53 8 B V4F 9 B ? V4F 9 B 1 -21.04 5 V4F 9 B . ? V4F 9 B V53 10 B ? V53 10 B 1 -29.78 6 V53 3 C . ? V53 3 C V4F 4 C ? V4F 4 C 1 -29.58 7 V53 5 C . ? V53 5 C V5F 6 C ? V5F 6 C 1 -17.24 8 V5F 6 C . ? V5F 6 C V4F 7 C ? V4F 7 C 1 -22.71 9 V4F 7 C . ? V4F 7 C V53 8 C ? V53 8 C 1 -29.73 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 3 ? TYR A 8 ? LYS AA 3 TYR AA 8 AA1 2 GLU A 11 ? ASP A 16 ? GLU AA 11 ASP AA 16 AA2 1 ILE A 20 ? VAL A 26 ? ILE AA 20 VAL AA 26 AA2 2 MET A 29 ? ASP A 36 ? MET AA 29 ASP AA 36 AA2 3 LYS A 39 ? SER A 46 ? LYS AA 39 SER AA 46 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 4 ? N VAL AA 4 O VAL A 15 ? O VAL AA 15 AA2 1 2 N LYS A 21 ? N LYS AA 21 O THR A 33 ? O THR AA 33 AA2 2 3 N VAL A 30 ? N VAL AA 30 O VAL A 45 ? O VAL AA 45 # _atom_sites.entry_id 8CMN _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014004 _atom_sites.fract_transf_matrix[1][2] 0.008085 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016170 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008608 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET AA . n A 1 2 VAL 2 2 2 VAL VAL AA . n A 1 3 LYS 3 3 3 LYS LYS AA . n A 1 4 VAL 4 4 4 VAL VAL AA . n A 1 5 LYS 5 5 5 LYS LYS AA . n A 1 6 PHE 6 6 6 PHE PHE AA . n A 1 7 LYS 7 7 7 LYS LYS AA . n A 1 8 TYR 8 8 8 TYR TYR AA . n A 1 9 LYS 9 9 9 LYS LYS AA . n A 1 10 GLY 10 10 10 GLY GLY AA . n A 1 11 GLU 11 11 11 GLU GLU AA . n A 1 12 GLU 12 12 12 GLU GLU AA . n A 1 13 LYS 13 13 13 LYS LYS AA . n A 1 14 GLU 14 14 14 GLU GLU AA . n A 1 15 VAL 15 15 15 VAL VAL AA . n A 1 16 ASP 16 16 16 ASP ASP AA . n A 1 17 THR 17 17 17 THR THR AA . n A 1 18 SER 18 18 18 SER SER AA . n A 1 19 LYS 19 19 19 LYS LYS AA . n A 1 20 ILE 20 20 20 ILE ILE AA . n A 1 21 LYS 21 21 21 LYS LYS AA . n A 1 22 LYS 22 22 22 LYS LYS AA . n A 1 23 VAL 23 23 23 VAL VAL AA . n A 1 24 TRP 24 24 24 TRP TRP AA . n A 1 25 ARG 25 25 25 ARG ARG AA . n A 1 26 VAL 26 26 26 VAL VAL AA . n A 1 27 GLY 27 27 27 GLY GLY AA . n A 1 28 LYS 28 28 28 LYS LYS AA . n A 1 29 MET 29 29 29 MET MET AA . n A 1 30 VAL 30 30 30 VAL VAL AA . n A 1 31 SER 31 31 31 SER SER AA . n A 1 32 PHE 32 32 32 PHE PHE AA . n A 1 33 THR 33 33 33 THR THR AA . n A 1 34 TYR 34 34 34 TYR TYR AA . n A 1 35 ASP 35 35 35 ASP ASP AA . n A 1 36 ASP 36 36 36 ASP ASP AA . n A 1 37 ASN 37 37 37 ASN ASN AA . n A 1 38 GLY 38 38 38 GLY GLY AA . n A 1 39 LYS 39 39 39 LYS LYS AA . n A 1 40 THR 40 40 40 THR THR AA . n A 1 41 GLY 41 41 41 GLY GLY AA . n A 1 42 ARG 42 42 42 ARG ARG AA . n A 1 43 GLY 43 43 43 GLY GLY AA . n A 1 44 ALA 44 44 44 ALA ALA AA . n A 1 45 VAL 45 45 45 VAL VAL AA . n A 1 46 SER 46 46 46 SER SER AA . n A 1 47 GLU 47 47 47 GLU GLU AA . n A 1 48 LYS 48 48 48 LYS LYS AA . n A 1 49 ASP 49 49 49 ASP ASP AA . n A 1 50 ALA 50 50 50 ALA ALA AA . n A 1 51 PRO 51 51 51 PRO PRO AA . n A 1 52 LYS 52 52 52 LYS LYS AA . n A 1 53 GLU 53 53 53 GLU GLU AA . n A 1 54 LEU 54 54 54 LEU LEU AA . n A 1 55 LEU 55 55 55 LEU LEU AA . n A 1 56 ASP 56 56 56 ASP ASP AA . n A 1 57 MET 57 57 57 MET MET AA . n A 1 58 LEU 58 58 58 LEU LEU AA . n A 1 59 ALA 59 59 59 ALA ALA AA . n A 1 60 ARG 60 60 60 ARG ARG AA . n A 1 61 ALA 61 61 61 ALA ALA AA . n A 1 62 GLU 62 62 62 GLU GLU AA . n A 1 63 ARG 63 63 63 ARG ARG AA . n A 1 64 GLU 64 64 ? ? ? AA . n A 1 65 LYS 65 65 ? ? ? AA . n A 1 66 LYS 66 66 ? ? ? AA . n B 2 1 GOA 1 1 1 GOA XUW B . n B 2 2 V4F 2 2 1 V4F XUW B . n B 2 3 V53 3 3 1 V53 XUW B . n B 2 4 V4F 4 4 1 V4F XUW B . n B 2 5 V53 5 5 1 V53 XUW B . n B 2 6 V5F 6 6 1 V5F XUW B . n B 2 7 V4F 7 7 1 V4F XUW B . n B 2 8 V53 8 8 1 V53 XUW B . n B 2 9 V4F 9 9 1 V4F XUW B . n B 2 10 V53 10 10 1 V53 XUW B . n C 2 1 GOA 1 1 1 GOA XUW C . n C 2 2 V4F 2 2 1 V4F XUW C . n C 2 3 V53 3 3 1 V53 XUW C . n C 2 4 V4F 4 4 1 V4F XUW C . n C 2 5 V53 5 5 1 V53 XUW C . n C 2 6 V5F 6 6 1 V5F XUW C . n C 2 7 V4F 7 7 1 V4F XUW C . n C 2 8 V53 8 8 1 V53 XUW C . n C 2 9 V4F 9 9 1 V4F XUW C . n C 2 10 V53 10 10 1 V53 XUW C . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email ivan.huc@cup.lmu.de _pdbx_contact_author.name_first Ivan _pdbx_contact_author.name_last Huc _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7036-9696 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 3 HOH 1 101 2 HOH HOH AA . D 3 HOH 2 102 3 HOH HOH AA . D 3 HOH 3 103 1 HOH HOH AA . D 3 HOH 4 104 8 HOH HOH AA . E 3 HOH 1 101 7 HOH HOH C . E 3 HOH 2 102 9 HOH HOH C . E 3 HOH 3 103 10 HOH HOH C . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 B GOA 1 ? B GOA 1 2 1 C GOA 1 ? C GOA 1 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-07-19 2 'Structure model' 1 1 2023-08-16 3 'Structure model' 1 2 2023-09-27 4 'Structure model' 2 0 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' Other 3 4 'Structure model' Advisory 4 4 'Structure model' 'Atomic model' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp 2 2 'Structure model' chem_comp_atom 3 2 'Structure model' chem_comp_bond 4 3 'Structure model' pdbx_database_status 5 4 'Structure model' atom_site 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_validate_peptide_omega 9 4 'Structure model' pdbx_validate_rmsd_angle 10 4 'Structure model' pdbx_validate_symm_contact 11 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_chem_comp.type' 2 3 'Structure model' '_pdbx_database_status.process_site' 3 3 'Structure model' '_pdbx_database_status.status_code_sf' 4 4 'Structure model' '_atom_site.auth_atom_id' 5 4 'Structure model' '_atom_site.label_atom_id' 6 4 'Structure model' '_chem_comp_atom.atom_id' 7 4 'Structure model' '_chem_comp_bond.atom_id_1' 8 4 'Structure model' '_chem_comp_bond.atom_id_2' 9 4 'Structure model' '_pdbx_validate_rmsd_angle.angle_deviation' 10 4 'Structure model' '_pdbx_validate_rmsd_angle.angle_standard_deviation' 11 4 'Structure model' '_pdbx_validate_rmsd_angle.angle_target_value' 12 4 'Structure model' '_pdbx_validate_rmsd_angle.angle_value' 13 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_atom_id_1' 14 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_atom_id_2' 15 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_atom_id_3' 16 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_comp_id_2' 17 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_seq_id_2' 18 4 'Structure model' '_pdbx_validate_symm_contact.auth_atom_id_1' 19 4 'Structure model' '_pdbx_validate_symm_contact.auth_atom_id_2' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+2/3 3 y,-x+y,z+1/3 4 -y,x-y,z+1/3 5 -x+y,-x,z+2/3 6 x-y,-y,-z 7 -x,-x+y,-z+2/3 8 -x,-y,z 9 y,x,-z+1/3 10 -y,-x,-z+1/3 11 -x+y,y,-z 12 x,x-y,-z+2/3 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -5.42331665203 -20.1404329241 2.28437364025 0.558643811693 ? 0.0126414678229 ? -0.0496381315361 ? 0.569484637222 ? -0.174090723789 ? 0.342914358816 ? -0.0424056302552 ? -0.205987222238 ? 0.246529559024 ? -0.110422082288 ? 0.046955026081 ? 0.0587720375018 ? 0.956909912816 ? 1.198182249 ? -0.780640486158 ? 0.00144018454652 ? 0.799982618686 ? 1.85670808126 ? 1.16654715617 ? 1.3308704038 ? -5.17438182501e-06 ? 2 'X-RAY DIFFRACTION' ? refined -8.94627918238 -20.3802320884 0.465146021811 0.645831996952 ? -0.00346075580414 ? -0.0230473577762 ? 0.683393722336 ? -0.111342488999 ? 0.689142976971 ? 0.304552087288 ? 0.0912578012191 ? -0.0896027132925 ? 0.0146525221496 ? -0.0846476474632 ? 0.0153391545654 ? 0.383909535635 ? 0.620420165336 ? -0.459753728102 ? -1.17707534916 ? -0.123527279258 ? 0.03278884252 ? 0.88496394343 ? -0.807948074851 ? -3.224496567e-07 ? 3 'X-RAY DIFFRACTION' ? refined -10.7589106924 -13.8384902811 9.21116909842 0.401299772836 ? 0.0512460556373 ? 0.0443284876365 ? 0.378192899319 ? -0.0227804885295 ? 0.422222899283 ? 0.362026555296 ? 0.101960621882 ? -0.314024087506 ? 0.445873493271 ? -0.352701709434 ? 0.540773137119 ? -0.353126908008 ? -0.409249929859 ? -0.716930647327 ? -0.131628720753 ? 0.615533016753 ? -0.0647135103956 ? -0.844503067902 ? -0.455080116657 ? 2.0743353958e-07 ? 4 'X-RAY DIFFRACTION' ? refined -8.59808970831 -10.1193517052 5.63823093927 0.465131630203 ? 0.0545017828137 ? 0.116603879896 ? 0.319093185022 ? 0.0591101074302 ? 0.410890728621 ? 0.0280411737748 ? 0.10249316997 ? -0.892764044435 ? 0.207926172989 ? 0.172008570018 ? 1.14826197421 ? 0.611042794006 ? -0.0176205372805 ? 0.186565522787 ? -0.1223919247 ? -0.249880303362 ? 0.206892617699 ? -0.124351439913 ? 0.12114665945 ? -2.83697467139e-07 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 B 1 AA 1 ? B 10 AA 10 ? ? ;chain 'A' and (resid 1 through 10 ) ; 2 'X-RAY DIFFRACTION' 2 B 11 AA 11 ? B 19 AA 19 ? ? ;chain 'A' and (resid 11 through 19 ) ; 3 'X-RAY DIFFRACTION' 3 B 20 AA 20 ? B 36 AA 36 ? ? ;chain 'A' and (resid 20 through 36 ) ; 4 'X-RAY DIFFRACTION' 4 B 37 AA 37 ? B 63 AA 63 ? ? ;chain 'A' and (resid 37 through 63 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 1.20.1_4487 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 8CMN _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OH _pdbx_validate_close_contact.auth_asym_id_1 AA _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 8 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O1 _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 V4F _pdbx_validate_close_contact.auth_seq_id_2 4 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.15 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 CA B GOA 1 ? ? 1_555 O2 B GOA 1 ? ? 7_555 1.43 2 1 CA C GOA 1 ? ? 1_555 O2 C GOA 1 ? ? 4_545 1.43 3 1 CA B GOA 1 ? ? 1_555 CA B GOA 1 ? ? 7_555 2.12 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA B V4F 2 ? ? C B V4F 2 ? ? N B V53 3 ? ? 66.23 117.20 -50.97 2.20 Y 2 1 CA B V53 3 ? ? C B V53 3 ? ? N B V4F 4 ? ? 81.58 117.20 -35.62 2.20 Y 3 1 CA B V4F 4 ? ? C B V4F 4 ? ? N B V53 5 ? ? 67.67 117.20 -49.53 2.20 Y 4 1 CA B V53 5 ? ? C B V53 5 ? ? N B V5F 6 ? ? 82.41 117.20 -34.79 2.20 Y 5 1 CA B V5F 6 ? ? C B V5F 6 ? ? N B V4F 7 ? ? 84.25 117.20 -32.95 2.20 Y 6 1 CA B V4F 7 ? ? C B V4F 7 ? ? N B V53 8 ? ? 65.30 117.20 -51.90 2.20 Y 7 1 CA B V53 8 ? ? C B V53 8 ? ? N B V4F 9 ? ? 83.81 117.20 -33.39 2.20 Y 8 1 CA B V4F 9 ? ? C B V4F 9 ? ? N B V53 10 ? ? 67.79 117.20 -49.41 2.20 Y 9 1 CA C V4F 2 ? ? C C V4F 2 ? ? N C V53 3 ? ? 61.34 117.20 -55.86 2.20 Y 10 1 CA C V53 3 ? ? C C V53 3 ? ? N C V4F 4 ? ? 79.93 117.20 -37.27 2.20 Y 11 1 CA C V4F 4 ? ? C C V4F 4 ? ? N C V53 5 ? ? 66.26 117.20 -50.94 2.20 Y 12 1 CA C V53 5 ? ? C C V53 5 ? ? N C V5F 6 ? ? 79.83 117.20 -37.37 2.20 Y 13 1 CA C V5F 6 ? ? C C V5F 6 ? ? N C V4F 7 ? ? 79.42 117.20 -37.78 2.20 Y 14 1 CA C V4F 7 ? ? C C V4F 7 ? ? N C V53 8 ? ? 64.66 117.20 -52.54 2.20 Y 15 1 CA C V53 8 ? ? C C V53 8 ? ? N C V4F 9 ? ? 85.04 117.20 -32.16 2.20 Y 16 1 CA C V4F 9 ? ? C C V4F 9 ? ? N C V53 10 ? ? 70.16 117.20 -47.04 2.20 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS AA 21 ? ? -105.65 -63.25 2 1 ASN AA 37 ? ? 51.56 -129.56 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 AA LYS 9 ? CG ? A LYS 9 CG 2 1 Y 1 AA LYS 9 ? CD ? A LYS 9 CD 3 1 Y 1 AA LYS 9 ? CE ? A LYS 9 CE 4 1 Y 1 AA LYS 9 ? NZ ? A LYS 9 NZ 5 1 Y 1 AA LYS 39 ? CG ? A LYS 39 CG 6 1 Y 1 AA LYS 39 ? CD ? A LYS 39 CD 7 1 Y 1 AA LYS 39 ? CE ? A LYS 39 CE 8 1 Y 1 AA LYS 39 ? NZ ? A LYS 39 NZ 9 1 Y 1 AA THR 40 ? OG1 ? A THR 40 OG1 10 1 Y 1 AA THR 40 ? CG2 ? A THR 40 CG2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AA GLU 64 ? A GLU 64 2 1 Y 1 AA LYS 65 ? A LYS 65 3 1 Y 1 AA LYS 66 ? A LYS 66 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLU N N N N 74 GLU CA C N S 75 GLU C C N N 76 GLU O O N N 77 GLU CB C N N 78 GLU CG C N N 79 GLU CD C N N 80 GLU OE1 O N N 81 GLU OE2 O N N 82 GLU OXT O N N 83 GLU H H N N 84 GLU H2 H N N 85 GLU HA H N N 86 GLU HB2 H N N 87 GLU HB3 H N N 88 GLU HG2 H N N 89 GLU HG3 H N N 90 GLU HE2 H N N 91 GLU HXT H N N 92 GLY N N N N 93 GLY CA C N N 94 GLY C C N N 95 GLY O O N N 96 GLY OXT O N N 97 GLY H H N N 98 GLY H2 H N N 99 GLY HA2 H N N 100 GLY HA3 H N N 101 GLY HXT H N N 102 GOA C C N N 103 GOA CA C N N 104 GOA O O N N 105 GOA OXT O N N 106 GOA O2 O N N 107 GOA H22 H N N 108 GOA H21 H N N 109 GOA HXT H N N 110 GOA H20 H N N 111 HOH O O N N 112 HOH H1 H N N 113 HOH H2 H N N 114 ILE N N N N 115 ILE CA C N S 116 ILE C C N N 117 ILE O O N N 118 ILE CB C N S 119 ILE CG1 C N N 120 ILE CG2 C N N 121 ILE CD1 C N N 122 ILE OXT O N N 123 ILE H H N N 124 ILE H2 H N N 125 ILE HA H N N 126 ILE HB H N N 127 ILE HG12 H N N 128 ILE HG13 H N N 129 ILE HG21 H N N 130 ILE HG22 H N N 131 ILE HG23 H N N 132 ILE HD11 H N N 133 ILE HD12 H N N 134 ILE HD13 H N N 135 ILE HXT H N N 136 LEU N N N N 137 LEU CA C N S 138 LEU C C N N 139 LEU O O N N 140 LEU CB C N N 141 LEU CG C N N 142 LEU CD1 C N N 143 LEU CD2 C N N 144 LEU OXT O N N 145 LEU H H N N 146 LEU H2 H N N 147 LEU HA H N N 148 LEU HB2 H N N 149 LEU HB3 H N N 150 LEU HG H N N 151 LEU HD11 H N N 152 LEU HD12 H N N 153 LEU HD13 H N N 154 LEU HD21 H N N 155 LEU HD22 H N N 156 LEU HD23 H N N 157 LEU HXT H N N 158 LYS N N N N 159 LYS CA C N S 160 LYS C C N N 161 LYS O O N N 162 LYS CB C N N 163 LYS CG C N N 164 LYS CD C N N 165 LYS CE C N N 166 LYS NZ N N N 167 LYS OXT O N N 168 LYS H H N N 169 LYS H2 H N N 170 LYS HA H N N 171 LYS HB2 H N N 172 LYS HB3 H N N 173 LYS HG2 H N N 174 LYS HG3 H N N 175 LYS HD2 H N N 176 LYS HD3 H N N 177 LYS HE2 H N N 178 LYS HE3 H N N 179 LYS HZ1 H N N 180 LYS HZ2 H N N 181 LYS HZ3 H N N 182 LYS HXT H N N 183 MET N N N N 184 MET CA C N S 185 MET C C N N 186 MET O O N N 187 MET CB C N N 188 MET CG C N N 189 MET SD S N N 190 MET CE C N N 191 MET OXT O N N 192 MET H H N N 193 MET H2 H N N 194 MET HA H N N 195 MET HB2 H N N 196 MET HB3 H N N 197 MET HG2 H N N 198 MET HG3 H N N 199 MET HE1 H N N 200 MET HE2 H N N 201 MET HE3 H N N 202 MET HXT H N N 203 PHE N N N N 204 PHE CA C N S 205 PHE C C N N 206 PHE O O N N 207 PHE CB C N N 208 PHE CG C Y N 209 PHE CD1 C Y N 210 PHE CD2 C Y N 211 PHE CE1 C Y N 212 PHE CE2 C Y N 213 PHE CZ C Y N 214 PHE OXT O N N 215 PHE H H N N 216 PHE H2 H N N 217 PHE HA H N N 218 PHE HB2 H N N 219 PHE HB3 H N N 220 PHE HD1 H N N 221 PHE HD2 H N N 222 PHE HE1 H N N 223 PHE HE2 H N N 224 PHE HZ H N N 225 PHE HXT H N N 226 PRO N N N N 227 PRO CA C N S 228 PRO C C N N 229 PRO O O N N 230 PRO CB C N N 231 PRO CG C N N 232 PRO CD C N N 233 PRO OXT O N N 234 PRO H H N N 235 PRO HA H N N 236 PRO HB2 H N N 237 PRO HB3 H N N 238 PRO HG2 H N N 239 PRO HG3 H N N 240 PRO HD2 H N N 241 PRO HD3 H N N 242 PRO HXT H N N 243 SER N N N N 244 SER CA C N S 245 SER C C N N 246 SER O O N N 247 SER CB C N N 248 SER OG O N N 249 SER OXT O N N 250 SER H H N N 251 SER H2 H N N 252 SER HA H N N 253 SER HB2 H N N 254 SER HB3 H N N 255 SER HG H N N 256 SER HXT H N N 257 THR N N N N 258 THR CA C N S 259 THR C C N N 260 THR O O N N 261 THR CB C N R 262 THR OG1 O N N 263 THR CG2 C N N 264 THR OXT O N N 265 THR H H N N 266 THR H2 H N N 267 THR HA H N N 268 THR HB H N N 269 THR HG1 H N N 270 THR HG21 H N N 271 THR HG22 H N N 272 THR HG23 H N N 273 THR HXT H N N 274 TRP N N N N 275 TRP CA C N S 276 TRP C C N N 277 TRP O O N N 278 TRP CB C N N 279 TRP CG C Y N 280 TRP CD1 C Y N 281 TRP CD2 C Y N 282 TRP NE1 N Y N 283 TRP CE2 C Y N 284 TRP CE3 C Y N 285 TRP CZ2 C Y N 286 TRP CZ3 C Y N 287 TRP CH2 C Y N 288 TRP OXT O N N 289 TRP H H N N 290 TRP H2 H N N 291 TRP HA H N N 292 TRP HB2 H N N 293 TRP HB3 H N N 294 TRP HD1 H N N 295 TRP HE1 H N N 296 TRP HE3 H N N 297 TRP HZ2 H N N 298 TRP HZ3 H N N 299 TRP HH2 H N N 300 TRP HXT H N N 301 TYR N N N N 302 TYR CA C N S 303 TYR C C N N 304 TYR O O N N 305 TYR CB C N N 306 TYR CG C Y N 307 TYR CD1 C Y N 308 TYR CD2 C Y N 309 TYR CE1 C Y N 310 TYR CE2 C Y N 311 TYR CZ C Y N 312 TYR OH O N N 313 TYR OXT O N N 314 TYR H H N N 315 TYR H2 H N N 316 TYR HA H N N 317 TYR HB2 H N N 318 TYR HB3 H N N 319 TYR HD1 H N N 320 TYR HD2 H N N 321 TYR HE1 H N N 322 TYR HE2 H N N 323 TYR HH H N N 324 TYR HXT H N N 325 V4F C C N N 326 V4F CAF C Y N 327 V4F CAD C Y N 328 V4F CAE C Y N 329 V4F CAL C Y N 330 V4F CAM C Y N 331 V4F CAJ C Y N 332 V4F CAK C Y N 333 V4F CAG C Y N 334 V4F CAI C Y N 335 V4F C01 C N N 336 V4F CA C N N 337 V4F NAH N Y N 338 V4F N N N N 339 V4F O O N N 340 V4F O01 O N N 341 V4F O3 O N N 342 V4F O2 O N N 343 V4F O1 O N N 344 V4F P P N N 345 V4F HAD H N N 346 V4F HAK H N N 347 V4F HAG H N N 348 V4F HAI H N N 349 V4F H3 H N N 350 V4F HA1 H N N 351 V4F HA2 H N N 352 V4F H H N N 353 V4F H2 H N N 354 V4F HPO3 H N N 355 V4F HPO2 H N N 356 V4F OXT O N N 357 V4F H1 H N N 358 V4F HXT H N N 359 V53 C C N N 360 V53 CAF C Y N 361 V53 CAD C Y N 362 V53 CAJ C Y N 363 V53 CAL C Y N 364 V53 CAM C Y N 365 V53 CA C Y N 366 V53 CAK C Y N 367 V53 CAG C Y N 368 V53 CAI C Y N 369 V53 C01 C N N 370 V53 NAH N Y N 371 V53 N N N N 372 V53 O O N N 373 V53 O01 O N N 374 V53 O1 O N N 375 V53 O2 O N N 376 V53 O3 O N N 377 V53 P P N N 378 V53 HAK H N N 379 V53 HAG H N N 380 V53 HAI H N N 381 V53 H H N N 382 V53 H2 H N N 383 V53 OXT O N N 384 V53 HXT H N N 385 V53 HAD H N N 386 V53 HPO2 H N N 387 V53 HPO3 H N N 388 V53 H1 H N N 389 V53 H3 H N N 390 V5F C C N N 391 V5F C6 C N R 392 V5F C2 C Y N 393 V5F C1 C Y N 394 V5F CA C Y N 395 V5F C5 C Y N 396 V5F C4 C Y N 397 V5F C3 C Y N 398 V5F CB C N N 399 V5F N N N N 400 V5F O O N N 401 V5F O1 O N N 402 V5F H6 H N N 403 V5F H5 H N N 404 V5F H4 H N N 405 V5F H1 H N N 406 V5F H3 H N N 407 V5F HB1 H N N 408 V5F HB2 H N N 409 V5F HB3 H N N 410 V5F H H N N 411 V5F OXT O N N 412 V5F HXT H N N 413 V5F H2 H N N 414 VAL N N N N 415 VAL CA C N S 416 VAL C C N N 417 VAL O O N N 418 VAL CB C N N 419 VAL CG1 C N N 420 VAL CG2 C N N 421 VAL OXT O N N 422 VAL H H N N 423 VAL H2 H N N 424 VAL HA H N N 425 VAL HB H N N 426 VAL HG11 H N N 427 VAL HG12 H N N 428 VAL HG13 H N N 429 VAL HG21 H N N 430 VAL HG22 H N N 431 VAL HG23 H N N 432 VAL HXT H N N 433 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLU N CA sing N N 70 GLU N H sing N N 71 GLU N H2 sing N N 72 GLU CA C sing N N 73 GLU CA CB sing N N 74 GLU CA HA sing N N 75 GLU C O doub N N 76 GLU C OXT sing N N 77 GLU CB CG sing N N 78 GLU CB HB2 sing N N 79 GLU CB HB3 sing N N 80 GLU CG CD sing N N 81 GLU CG HG2 sing N N 82 GLU CG HG3 sing N N 83 GLU CD OE1 doub N N 84 GLU CD OE2 sing N N 85 GLU OE2 HE2 sing N N 86 GLU OXT HXT sing N N 87 GLY N CA sing N N 88 GLY N H sing N N 89 GLY N H2 sing N N 90 GLY CA C sing N N 91 GLY CA HA2 sing N N 92 GLY CA HA3 sing N N 93 GLY C O doub N N 94 GLY C OXT sing N N 95 GLY OXT HXT sing N N 96 GOA C CA sing N N 97 GOA C O doub N N 98 GOA C OXT sing N N 99 GOA CA O2 sing N N 100 GOA CA H22 sing N N 101 GOA CA H21 sing N N 102 GOA OXT HXT sing N N 103 GOA O2 H20 sing N N 104 HOH O H1 sing N N 105 HOH O H2 sing N N 106 ILE N CA sing N N 107 ILE N H sing N N 108 ILE N H2 sing N N 109 ILE CA C sing N N 110 ILE CA CB sing N N 111 ILE CA HA sing N N 112 ILE C O doub N N 113 ILE C OXT sing N N 114 ILE CB CG1 sing N N 115 ILE CB CG2 sing N N 116 ILE CB HB sing N N 117 ILE CG1 CD1 sing N N 118 ILE CG1 HG12 sing N N 119 ILE CG1 HG13 sing N N 120 ILE CG2 HG21 sing N N 121 ILE CG2 HG22 sing N N 122 ILE CG2 HG23 sing N N 123 ILE CD1 HD11 sing N N 124 ILE CD1 HD12 sing N N 125 ILE CD1 HD13 sing N N 126 ILE OXT HXT sing N N 127 LEU N CA sing N N 128 LEU N H sing N N 129 LEU N H2 sing N N 130 LEU CA C sing N N 131 LEU CA CB sing N N 132 LEU CA HA sing N N 133 LEU C O doub N N 134 LEU C OXT sing N N 135 LEU CB CG sing N N 136 LEU CB HB2 sing N N 137 LEU CB HB3 sing N N 138 LEU CG CD1 sing N N 139 LEU CG CD2 sing N N 140 LEU CG HG sing N N 141 LEU CD1 HD11 sing N N 142 LEU CD1 HD12 sing N N 143 LEU CD1 HD13 sing N N 144 LEU CD2 HD21 sing N N 145 LEU CD2 HD22 sing N N 146 LEU CD2 HD23 sing N N 147 LEU OXT HXT sing N N 148 LYS N CA sing N N 149 LYS N H sing N N 150 LYS N H2 sing N N 151 LYS CA C sing N N 152 LYS CA CB sing N N 153 LYS CA HA sing N N 154 LYS C O doub N N 155 LYS C OXT sing N N 156 LYS CB CG sing N N 157 LYS CB HB2 sing N N 158 LYS CB HB3 sing N N 159 LYS CG CD sing N N 160 LYS CG HG2 sing N N 161 LYS CG HG3 sing N N 162 LYS CD CE sing N N 163 LYS CD HD2 sing N N 164 LYS CD HD3 sing N N 165 LYS CE NZ sing N N 166 LYS CE HE2 sing N N 167 LYS CE HE3 sing N N 168 LYS NZ HZ1 sing N N 169 LYS NZ HZ2 sing N N 170 LYS NZ HZ3 sing N N 171 LYS OXT HXT sing N N 172 MET N CA sing N N 173 MET N H sing N N 174 MET N H2 sing N N 175 MET CA C sing N N 176 MET CA CB sing N N 177 MET CA HA sing N N 178 MET C O doub N N 179 MET C OXT sing N N 180 MET CB CG sing N N 181 MET CB HB2 sing N N 182 MET CB HB3 sing N N 183 MET CG SD sing N N 184 MET CG HG2 sing N N 185 MET CG HG3 sing N N 186 MET SD CE sing N N 187 MET CE HE1 sing N N 188 MET CE HE2 sing N N 189 MET CE HE3 sing N N 190 MET OXT HXT sing N N 191 PHE N CA sing N N 192 PHE N H sing N N 193 PHE N H2 sing N N 194 PHE CA C sing N N 195 PHE CA CB sing N N 196 PHE CA HA sing N N 197 PHE C O doub N N 198 PHE C OXT sing N N 199 PHE CB CG sing N N 200 PHE CB HB2 sing N N 201 PHE CB HB3 sing N N 202 PHE CG CD1 doub Y N 203 PHE CG CD2 sing Y N 204 PHE CD1 CE1 sing Y N 205 PHE CD1 HD1 sing N N 206 PHE CD2 CE2 doub Y N 207 PHE CD2 HD2 sing N N 208 PHE CE1 CZ doub Y N 209 PHE CE1 HE1 sing N N 210 PHE CE2 CZ sing Y N 211 PHE CE2 HE2 sing N N 212 PHE CZ HZ sing N N 213 PHE OXT HXT sing N N 214 PRO N CA sing N N 215 PRO N CD sing N N 216 PRO N H sing N N 217 PRO CA C sing N N 218 PRO CA CB sing N N 219 PRO CA HA sing N N 220 PRO C O doub N N 221 PRO C OXT sing N N 222 PRO CB CG sing N N 223 PRO CB HB2 sing N N 224 PRO CB HB3 sing N N 225 PRO CG CD sing N N 226 PRO CG HG2 sing N N 227 PRO CG HG3 sing N N 228 PRO CD HD2 sing N N 229 PRO CD HD3 sing N N 230 PRO OXT HXT sing N N 231 SER N CA sing N N 232 SER N H sing N N 233 SER N H2 sing N N 234 SER CA C sing N N 235 SER CA CB sing N N 236 SER CA HA sing N N 237 SER C O doub N N 238 SER C OXT sing N N 239 SER CB OG sing N N 240 SER CB HB2 sing N N 241 SER CB HB3 sing N N 242 SER OG HG sing N N 243 SER OXT HXT sing N N 244 THR N CA sing N N 245 THR N H sing N N 246 THR N H2 sing N N 247 THR CA C sing N N 248 THR CA CB sing N N 249 THR CA HA sing N N 250 THR C O doub N N 251 THR C OXT sing N N 252 THR CB OG1 sing N N 253 THR CB CG2 sing N N 254 THR CB HB sing N N 255 THR OG1 HG1 sing N N 256 THR CG2 HG21 sing N N 257 THR CG2 HG22 sing N N 258 THR CG2 HG23 sing N N 259 THR OXT HXT sing N N 260 TRP N CA sing N N 261 TRP N H sing N N 262 TRP N H2 sing N N 263 TRP CA C sing N N 264 TRP CA CB sing N N 265 TRP CA HA sing N N 266 TRP C O doub N N 267 TRP C OXT sing N N 268 TRP CB CG sing N N 269 TRP CB HB2 sing N N 270 TRP CB HB3 sing N N 271 TRP CG CD1 doub Y N 272 TRP CG CD2 sing Y N 273 TRP CD1 NE1 sing Y N 274 TRP CD1 HD1 sing N N 275 TRP CD2 CE2 doub Y N 276 TRP CD2 CE3 sing Y N 277 TRP NE1 CE2 sing Y N 278 TRP NE1 HE1 sing N N 279 TRP CE2 CZ2 sing Y N 280 TRP CE3 CZ3 doub Y N 281 TRP CE3 HE3 sing N N 282 TRP CZ2 CH2 doub Y N 283 TRP CZ2 HZ2 sing N N 284 TRP CZ3 CH2 sing Y N 285 TRP CZ3 HZ3 sing N N 286 TRP CH2 HH2 sing N N 287 TRP OXT HXT sing N N 288 TYR N CA sing N N 289 TYR N H sing N N 290 TYR N H2 sing N N 291 TYR CA C sing N N 292 TYR CA CB sing N N 293 TYR CA HA sing N N 294 TYR C O doub N N 295 TYR C OXT sing N N 296 TYR CB CG sing N N 297 TYR CB HB2 sing N N 298 TYR CB HB3 sing N N 299 TYR CG CD1 doub Y N 300 TYR CG CD2 sing Y N 301 TYR CD1 CE1 sing Y N 302 TYR CD1 HD1 sing N N 303 TYR CD2 CE2 doub Y N 304 TYR CD2 HD2 sing N N 305 TYR CE1 CZ doub Y N 306 TYR CE1 HE1 sing N N 307 TYR CE2 CZ sing Y N 308 TYR CE2 HE2 sing N N 309 TYR CZ OH sing N N 310 TYR OH HH sing N N 311 TYR OXT HXT sing N N 312 V4F CAK CAG doub Y N 313 V4F CAK CAJ sing Y N 314 V4F CA CAJ sing N N 315 V4F CA N sing N N 316 V4F CAG CAI sing Y N 317 V4F CAJ CAM doub Y N 318 V4F CAI CAL doub Y N 319 V4F CAM CAL sing Y N 320 V4F CAM NAH sing Y N 321 V4F CAL CAF sing Y N 322 V4F NAH CAE doub Y N 323 V4F CAF O01 sing N N 324 V4F CAF CAD doub Y N 325 V4F O1 P doub N N 326 V4F O01 C01 sing N N 327 V4F CAE CAD sing Y N 328 V4F CAE C sing N N 329 V4F C O doub N N 330 V4F P C01 sing N N 331 V4F P O3 sing N N 332 V4F P O2 sing N N 333 V4F CAD HAD sing N N 334 V4F CAK HAK sing N N 335 V4F CAG HAG sing N N 336 V4F CAI HAI sing N N 337 V4F C01 H3 sing N N 338 V4F CA HA1 sing N N 339 V4F CA HA2 sing N N 340 V4F N H sing N N 341 V4F N H2 sing N N 342 V4F O3 HPO3 sing N N 343 V4F O2 HPO2 sing N N 344 V4F C OXT sing N N 345 V4F C01 H1 sing N N 346 V4F OXT HXT sing N N 347 V53 O C doub N N 348 V53 C CAJ sing N N 349 V53 CAJ CAD doub Y N 350 V53 CAJ NAH sing Y N 351 V53 O1 P doub N N 352 V53 CAD CAF sing Y N 353 V53 C01 P sing N N 354 V53 C01 O01 sing N N 355 V53 NAH CAM doub Y N 356 V53 P O3 sing N N 357 V53 P O2 sing N N 358 V53 CAF O01 sing N N 359 V53 CAF CAL doub Y N 360 V53 CAM CAL sing Y N 361 V53 CAM CA sing Y N 362 V53 CAL CAI sing Y N 363 V53 N CA sing N N 364 V53 CA CAK doub Y N 365 V53 CAI CAG doub Y N 366 V53 CAK CAG sing Y N 367 V53 CAK HAK sing N N 368 V53 CAG HAG sing N N 369 V53 CAI HAI sing N N 370 V53 N H sing N N 371 V53 C OXT sing N N 372 V53 OXT HXT sing N N 373 V53 H2 N sing N N 374 V53 CAD HAD sing N N 375 V53 O2 HPO2 sing N N 376 V53 O3 HPO3 sing N N 377 V53 C01 H1 sing N N 378 V53 C01 H3 sing N N 379 V5F C3 C2 doub Y N 380 V5F C3 C4 sing Y N 381 V5F C2 C1 sing Y N 382 V5F C4 C5 doub Y N 383 V5F CB C6 sing N N 384 V5F C6 O1 sing N N 385 V5F C6 C sing N N 386 V5F C1 CA doub Y N 387 V5F C1 O1 sing N N 388 V5F C5 CA sing Y N 389 V5F O C doub N N 390 V5F CA N sing N N 391 V5F C6 H6 sing N N 392 V5F C2 H5 sing N N 393 V5F C5 H4 sing N N 394 V5F C4 H1 sing N N 395 V5F C3 H3 sing N N 396 V5F CB HB1 sing N N 397 V5F CB HB2 sing N N 398 V5F CB HB3 sing N N 399 V5F N H sing N N 400 V5F C OXT sing N N 401 V5F OXT HXT sing N N 402 V5F N H2 sing N N 403 VAL N CA sing N N 404 VAL N H sing N N 405 VAL N H2 sing N N 406 VAL CA C sing N N 407 VAL CA CB sing N N 408 VAL CA HA sing N N 409 VAL C O doub N N 410 VAL C OXT sing N N 411 VAL CB CG1 sing N N 412 VAL CB CG2 sing N N 413 VAL CB HB sing N N 414 VAL CG1 HG11 sing N N 415 VAL CG1 HG12 sing N N 416 VAL CG1 HG13 sing N N 417 VAL CG2 HG21 sing N N 418 VAL CG2 HG22 sing N N 419 VAL CG2 HG23 sing N N 420 VAL OXT HXT sing N N 421 # _pdbx_audit_support.funding_organization 'European Research Council (ERC)' _pdbx_audit_support.country 'European Union' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 V4F ? ? V4F ? ? 'SUBJECT OF INVESTIGATION' ? 2 V53 ? ? V53 ? ? 'SUBJECT OF INVESTIGATION' ? 3 V5F ? ? V5F ? ? 'SUBJECT OF INVESTIGATION' ? 4 V4F ? ? V4F ? ? 'SUBJECT OF INVESTIGATION' ? 5 V53 ? ? V53 ? ? 'SUBJECT OF INVESTIGATION' ? 6 V4F ? ? V4F ? ? 'SUBJECT OF INVESTIGATION' ? 7 V53 ? ? V53 ? ? 'SUBJECT OF INVESTIGATION' ? 8 V4F ? ? V4F ? ? 'SUBJECT OF INVESTIGATION' ? 9 GOA ? ? GOA ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1azq _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 64 2 2' _space_group.name_Hall 'P 64 2 (x,y,z+1/6)' _space_group.IT_number 181 _space_group.crystal_system hexagonal _space_group.id 1 #