data_8COJ # _entry.id 8COJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8COJ pdb_00008coj 10.2210/pdb8coj/pdb WWPDB D_1292128922 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8COJ _pdbx_database_status.recvd_initial_deposition_date 2023-02-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Steegborn, C.' 1 ? 'Fushimi, M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Chem.Inf.Model. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1549-960X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 63 _citation.language ? _citation.page_first 2828 _citation.page_last 2841 _citation.title 'Scaffold Hopping and Optimization of Small Molecule Soluble Adenyl Cyclase Inhibitors Led by Free Energy Perturbation.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jcim.2c01577 _citation.pdbx_database_id_PubMed 37060320 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sun, S.' 1 ? primary 'Fushimi, M.' 2 ? primary 'Rossetti, T.' 3 ? primary 'Kaur, N.' 4 ? primary 'Ferreira, J.' 5 ? primary 'Miller, M.' 6 ? primary 'Quast, J.' 7 ? primary 'van den Heuvel, J.' 8 ? primary 'Steegborn, C.' 9 ? primary 'Levin, L.R.' 10 ? primary 'Buck, J.' 11 ? primary 'Myers, R.W.' 12 ? primary 'Kargman, S.' 13 ? primary 'Liverton, N.' 14 ? primary 'Meinke, P.T.' 15 ? primary 'Huggins, D.J.' 16 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8COJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 98.905 _cell.length_a_esd ? _cell.length_b 98.905 _cell.length_b_esd ? _cell.length_c 99.746 _cell.length_c_esd ? _cell.volume 845011.491 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8COJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall 'P 6c' _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Adenylate cyclase type 10' 54269.664 1 4.6.1.1 ? ? ? 2 non-polymer syn '4-chloranyl-6-[4-[(3-fluorophenyl)methyl]-1-methyl-pyrazol-3-yl]pyrimidin-2-amine' 317.749 1 ? ? ? ? 3 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133 4 ? ? ? ? 4 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 5 non-polymer syn 1,2-ETHANEDIOL 62.068 6 ? ? ? ? 6 water nat water 18.015 120 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AH-related protein,Adenylate cyclase homolog,Germ cell soluble adenylyl cyclase,sAC,Testicular soluble adenylyl cyclase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MNTPKEEFQDWPIVRIAAHLPDLIVYGHFSPERPFMDYFDGVLMFVDISGFTAMTEKFSSAMYMDRGAEQLVEILNYHIS AIVEKVLIFGGDILKFAGDALLALWRVERKQLKNIITVVIKCSLEIHGLFETQEWEEGLDIRVKIGLAAGHISMLVFGDE THSHFLVIGQAVDDVRLAQNMAQMNDVILSPNCWQLCDRSMIEIESVPDQRAVKVNFLKPPPNFNFDEFFTKCTTFMHYY PSGEHKNLLRLA(CME)TLKPDPELEMSLQKYVMESILKQIDNKQLQGYLSELRPVTIVFVNLMFEDQDKAEEIGPAIQD AYMHITSVLKIFQGQINKVFMFDKGCSFLCVFGFPGEKVPDELTHALECAMDIFDFCSQVHKIQTVSIGVASGIVFCGIV GHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKELPKKVMKGVADSGPLYQYWGRTEKVHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MNTPKEEFQDWPIVRIAAHLPDLIVYGHFSPERPFMDYFDGVLMFVDISGFTAMTEKFSSAMYMDRGAEQLVEILNYHIS AIVEKVLIFGGDILKFAGDALLALWRVERKQLKNIITVVIKCSLEIHGLFETQEWEEGLDIRVKIGLAAGHISMLVFGDE THSHFLVIGQAVDDVRLAQNMAQMNDVILSPNCWQLCDRSMIEIESVPDQRAVKVNFLKPPPNFNFDEFFTKCTTFMHYY PSGEHKNLLRLACTLKPDPELEMSLQKYVMESILKQIDNKQLQGYLSELRPVTIVFVNLMFEDQDKAEEIGPAIQDAYMH ITSVLKIFQGQINKVFMFDKGCSFLCVFGFPGEKVPDELTHALECAMDIFDFCSQVHKIQTVSIGVASGIVFCGIVGHTV RHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKELPKKVMKGVADSGPLYQYWGRTEKVHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 THR n 1 4 PRO n 1 5 LYS n 1 6 GLU n 1 7 GLU n 1 8 PHE n 1 9 GLN n 1 10 ASP n 1 11 TRP n 1 12 PRO n 1 13 ILE n 1 14 VAL n 1 15 ARG n 1 16 ILE n 1 17 ALA n 1 18 ALA n 1 19 HIS n 1 20 LEU n 1 21 PRO n 1 22 ASP n 1 23 LEU n 1 24 ILE n 1 25 VAL n 1 26 TYR n 1 27 GLY n 1 28 HIS n 1 29 PHE n 1 30 SER n 1 31 PRO n 1 32 GLU n 1 33 ARG n 1 34 PRO n 1 35 PHE n 1 36 MET n 1 37 ASP n 1 38 TYR n 1 39 PHE n 1 40 ASP n 1 41 GLY n 1 42 VAL n 1 43 LEU n 1 44 MET n 1 45 PHE n 1 46 VAL n 1 47 ASP n 1 48 ILE n 1 49 SER n 1 50 GLY n 1 51 PHE n 1 52 THR n 1 53 ALA n 1 54 MET n 1 55 THR n 1 56 GLU n 1 57 LYS n 1 58 PHE n 1 59 SER n 1 60 SER n 1 61 ALA n 1 62 MET n 1 63 TYR n 1 64 MET n 1 65 ASP n 1 66 ARG n 1 67 GLY n 1 68 ALA n 1 69 GLU n 1 70 GLN n 1 71 LEU n 1 72 VAL n 1 73 GLU n 1 74 ILE n 1 75 LEU n 1 76 ASN n 1 77 TYR n 1 78 HIS n 1 79 ILE n 1 80 SER n 1 81 ALA n 1 82 ILE n 1 83 VAL n 1 84 GLU n 1 85 LYS n 1 86 VAL n 1 87 LEU n 1 88 ILE n 1 89 PHE n 1 90 GLY n 1 91 GLY n 1 92 ASP n 1 93 ILE n 1 94 LEU n 1 95 LYS n 1 96 PHE n 1 97 ALA n 1 98 GLY n 1 99 ASP n 1 100 ALA n 1 101 LEU n 1 102 LEU n 1 103 ALA n 1 104 LEU n 1 105 TRP n 1 106 ARG n 1 107 VAL n 1 108 GLU n 1 109 ARG n 1 110 LYS n 1 111 GLN n 1 112 LEU n 1 113 LYS n 1 114 ASN n 1 115 ILE n 1 116 ILE n 1 117 THR n 1 118 VAL n 1 119 VAL n 1 120 ILE n 1 121 LYS n 1 122 CYS n 1 123 SER n 1 124 LEU n 1 125 GLU n 1 126 ILE n 1 127 HIS n 1 128 GLY n 1 129 LEU n 1 130 PHE n 1 131 GLU n 1 132 THR n 1 133 GLN n 1 134 GLU n 1 135 TRP n 1 136 GLU n 1 137 GLU n 1 138 GLY n 1 139 LEU n 1 140 ASP n 1 141 ILE n 1 142 ARG n 1 143 VAL n 1 144 LYS n 1 145 ILE n 1 146 GLY n 1 147 LEU n 1 148 ALA n 1 149 ALA n 1 150 GLY n 1 151 HIS n 1 152 ILE n 1 153 SER n 1 154 MET n 1 155 LEU n 1 156 VAL n 1 157 PHE n 1 158 GLY n 1 159 ASP n 1 160 GLU n 1 161 THR n 1 162 HIS n 1 163 SER n 1 164 HIS n 1 165 PHE n 1 166 LEU n 1 167 VAL n 1 168 ILE n 1 169 GLY n 1 170 GLN n 1 171 ALA n 1 172 VAL n 1 173 ASP n 1 174 ASP n 1 175 VAL n 1 176 ARG n 1 177 LEU n 1 178 ALA n 1 179 GLN n 1 180 ASN n 1 181 MET n 1 182 ALA n 1 183 GLN n 1 184 MET n 1 185 ASN n 1 186 ASP n 1 187 VAL n 1 188 ILE n 1 189 LEU n 1 190 SER n 1 191 PRO n 1 192 ASN n 1 193 CYS n 1 194 TRP n 1 195 GLN n 1 196 LEU n 1 197 CYS n 1 198 ASP n 1 199 ARG n 1 200 SER n 1 201 MET n 1 202 ILE n 1 203 GLU n 1 204 ILE n 1 205 GLU n 1 206 SER n 1 207 VAL n 1 208 PRO n 1 209 ASP n 1 210 GLN n 1 211 ARG n 1 212 ALA n 1 213 VAL n 1 214 LYS n 1 215 VAL n 1 216 ASN n 1 217 PHE n 1 218 LEU n 1 219 LYS n 1 220 PRO n 1 221 PRO n 1 222 PRO n 1 223 ASN n 1 224 PHE n 1 225 ASN n 1 226 PHE n 1 227 ASP n 1 228 GLU n 1 229 PHE n 1 230 PHE n 1 231 THR n 1 232 LYS n 1 233 CYS n 1 234 THR n 1 235 THR n 1 236 PHE n 1 237 MET n 1 238 HIS n 1 239 TYR n 1 240 TYR n 1 241 PRO n 1 242 SER n 1 243 GLY n 1 244 GLU n 1 245 HIS n 1 246 LYS n 1 247 ASN n 1 248 LEU n 1 249 LEU n 1 250 ARG n 1 251 LEU n 1 252 ALA n 1 253 CME n 1 254 THR n 1 255 LEU n 1 256 LYS n 1 257 PRO n 1 258 ASP n 1 259 PRO n 1 260 GLU n 1 261 LEU n 1 262 GLU n 1 263 MET n 1 264 SER n 1 265 LEU n 1 266 GLN n 1 267 LYS n 1 268 TYR n 1 269 VAL n 1 270 MET n 1 271 GLU n 1 272 SER n 1 273 ILE n 1 274 LEU n 1 275 LYS n 1 276 GLN n 1 277 ILE n 1 278 ASP n 1 279 ASN n 1 280 LYS n 1 281 GLN n 1 282 LEU n 1 283 GLN n 1 284 GLY n 1 285 TYR n 1 286 LEU n 1 287 SER n 1 288 GLU n 1 289 LEU n 1 290 ARG n 1 291 PRO n 1 292 VAL n 1 293 THR n 1 294 ILE n 1 295 VAL n 1 296 PHE n 1 297 VAL n 1 298 ASN n 1 299 LEU n 1 300 MET n 1 301 PHE n 1 302 GLU n 1 303 ASP n 1 304 GLN n 1 305 ASP n 1 306 LYS n 1 307 ALA n 1 308 GLU n 1 309 GLU n 1 310 ILE n 1 311 GLY n 1 312 PRO n 1 313 ALA n 1 314 ILE n 1 315 GLN n 1 316 ASP n 1 317 ALA n 1 318 TYR n 1 319 MET n 1 320 HIS n 1 321 ILE n 1 322 THR n 1 323 SER n 1 324 VAL n 1 325 LEU n 1 326 LYS n 1 327 ILE n 1 328 PHE n 1 329 GLN n 1 330 GLY n 1 331 GLN n 1 332 ILE n 1 333 ASN n 1 334 LYS n 1 335 VAL n 1 336 PHE n 1 337 MET n 1 338 PHE n 1 339 ASP n 1 340 LYS n 1 341 GLY n 1 342 CYS n 1 343 SER n 1 344 PHE n 1 345 LEU n 1 346 CYS n 1 347 VAL n 1 348 PHE n 1 349 GLY n 1 350 PHE n 1 351 PRO n 1 352 GLY n 1 353 GLU n 1 354 LYS n 1 355 VAL n 1 356 PRO n 1 357 ASP n 1 358 GLU n 1 359 LEU n 1 360 THR n 1 361 HIS n 1 362 ALA n 1 363 LEU n 1 364 GLU n 1 365 CYS n 1 366 ALA n 1 367 MET n 1 368 ASP n 1 369 ILE n 1 370 PHE n 1 371 ASP n 1 372 PHE n 1 373 CYS n 1 374 SER n 1 375 GLN n 1 376 VAL n 1 377 HIS n 1 378 LYS n 1 379 ILE n 1 380 GLN n 1 381 THR n 1 382 VAL n 1 383 SER n 1 384 ILE n 1 385 GLY n 1 386 VAL n 1 387 ALA n 1 388 SER n 1 389 GLY n 1 390 ILE n 1 391 VAL n 1 392 PHE n 1 393 CYS n 1 394 GLY n 1 395 ILE n 1 396 VAL n 1 397 GLY n 1 398 HIS n 1 399 THR n 1 400 VAL n 1 401 ARG n 1 402 HIS n 1 403 GLU n 1 404 TYR n 1 405 THR n 1 406 VAL n 1 407 ILE n 1 408 GLY n 1 409 GLN n 1 410 LYS n 1 411 VAL n 1 412 ASN n 1 413 LEU n 1 414 ALA n 1 415 ALA n 1 416 ARG n 1 417 MET n 1 418 MET n 1 419 MET n 1 420 TYR n 1 421 TYR n 1 422 PRO n 1 423 GLY n 1 424 ILE n 1 425 VAL n 1 426 THR n 1 427 CYS n 1 428 ASP n 1 429 SER n 1 430 VAL n 1 431 THR n 1 432 TYR n 1 433 ASN n 1 434 GLY n 1 435 SER n 1 436 ASN n 1 437 LEU n 1 438 PRO n 1 439 ALA n 1 440 TYR n 1 441 PHE n 1 442 PHE n 1 443 LYS n 1 444 GLU n 1 445 LEU n 1 446 PRO n 1 447 LYS n 1 448 LYS n 1 449 VAL n 1 450 MET n 1 451 LYS n 1 452 GLY n 1 453 VAL n 1 454 ALA n 1 455 ASP n 1 456 SER n 1 457 GLY n 1 458 PRO n 1 459 LEU n 1 460 TYR n 1 461 GLN n 1 462 TYR n 1 463 TRP n 1 464 GLY n 1 465 ARG n 1 466 THR n 1 467 GLU n 1 468 LYS n 1 469 VAL n 1 470 HIS n 1 471 HIS n 1 472 HIS n 1 473 HIS n 1 474 HIS n 1 475 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 475 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ADCY10, SAC' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ADCYA_HUMAN _struct_ref.pdbx_db_accession Q96PN6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNTPKEEFQDWPIVRIAAHLPDLIVYGHFSPERPFMDYFDGVLMFVDISGFTAMTEKFSSAMYMDRGAEQLVEILNYHIS AIVEKVLIFGGDILKFAGDALLALWRVERKQLKNIITVVIKCSLEIHGLFETQEWEEGLDIRVKIGLAAGHISMLVFGDE THSHFLVIGQAVDDVRLAQNMAQMNDVILSPNCWQLCDRSMIEIESVPDQRAVKVNFLKPPPNFNFDEFFTKCTTFMHYY PSGEHKNLLRLACTLKPDPELEMSLQKYVMESILKQIDNKQLQGYLSELRPVTIVFVNLMFEDQDKAEEIGPAIQDAYMH ITSVLKIFQGQINKVFMFDKGCSFLCVFGFPGEKVPDELTHALECAMDIFDFCSQVHKIQTVSIGVASGIVFCGIVGHTV RHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKELPKKVMKGVADSGPLYQYWGRTEKV ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8COJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 469 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96PN6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 469 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 469 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8COJ HIS A 470 ? UNP Q96PN6 ? ? 'expression tag' 470 1 1 8COJ HIS A 471 ? UNP Q96PN6 ? ? 'expression tag' 471 2 1 8COJ HIS A 472 ? UNP Q96PN6 ? ? 'expression tag' 472 3 1 8COJ HIS A 473 ? UNP Q96PN6 ? ? 'expression tag' 473 4 1 8COJ HIS A 474 ? UNP Q96PN6 ? ? 'expression tag' 474 5 1 8COJ HIS A 475 ? UNP Q96PN6 ? ? 'expression tag' 475 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CME 'L-peptide linking' n 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' ? 'C5 H11 N O3 S2' 197.276 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DMS non-polymer . 'DIMETHYL SULFOXIDE' ? 'C2 H6 O S' 78.133 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 VE1 non-polymer . '4-chloranyl-6-[4-[(3-fluorophenyl)methyl]-1-methyl-pyrazol-3-yl]pyrimidin-2-amine' ? 'C15 H13 Cl F N5' 317.749 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8COJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.60 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.60 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M tripotassium citrate, 20%(w/v) PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-01-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 39.70 _reflns.entry_id 8COJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 32.4 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 32292 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.18 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3199 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.985 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 53.91 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8COJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.10 _refine.ls_d_res_low 32.4 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 32233 _refine.ls_number_reflns_R_free 1610 _refine.ls_number_reflns_R_work 30623 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.66 _refine.ls_percent_reflns_R_free 4.99 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2020 _refine.ls_R_factor_R_free 0.2254 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2008 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.9002 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3227 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 32.4 _refine_hist.number_atoms_solvent 120 _refine_hist.number_atoms_total 3777 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3591 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 66 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0113 ? 3769 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9238 ? 5092 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0539 ? 560 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0057 ? 649 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 5.9284 ? 3060 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.10 2.17 . . 142 2734 98.32 . . . . 0.3434 . . . . . . . . . . . 0.3765 'X-RAY DIFFRACTION' 2.17 2.25 . . 146 2771 99.86 . . . . 0.3162 . . . . . . . . . . . 0.3369 'X-RAY DIFFRACTION' 2.25 2.34 . . 147 2781 100.00 . . . . 0.2814 . . . . . . . . . . . 0.3031 'X-RAY DIFFRACTION' 2.34 2.44 . . 146 2768 99.97 . . . . 0.2595 . . . . . . . . . . . 0.2950 'X-RAY DIFFRACTION' 2.44 2.57 . . 147 2795 99.90 . . . . 0.2468 . . . . . . . . . . . 0.2796 'X-RAY DIFFRACTION' 2.57 2.73 . . 145 2771 99.97 . . . . 0.2332 . . . . . . . . . . . 0.2858 'X-RAY DIFFRACTION' 2.73 2.94 . . 148 2799 100.00 . . . . 0.2225 . . . . . . . . . . . 0.2662 'X-RAY DIFFRACTION' 2.94 3.24 . . 146 2785 100.00 . . . . 0.2061 . . . . . . . . . . . 0.2207 'X-RAY DIFFRACTION' 3.24 3.71 . . 148 2806 99.97 . . . . 0.1727 . . . . . . . . . . . 0.2082 'X-RAY DIFFRACTION' 3.71 4.67 . . 148 2803 99.73 . . . . 0.1463 . . . . . . . . . . . 0.1830 'X-RAY DIFFRACTION' 4.67 32.4 . . 147 2810 98.67 . . . . 0.1841 . . . . . . . . . . . 0.1825 # _struct.entry_id 8COJ _struct.title 'Crystal structure of human soluble adenylyl cyclase catalytic domain in complex with the inhibitor TDI-10228' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8COJ _struct_keywords.text 'cAMP, sAC, inhibitor complex, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? H N N 5 ? I N N 5 ? J N N 5 ? K N N 5 ? L N N 5 ? M N N 5 ? N N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TRP A 11 ? ALA A 18 ? TRP A 11 ALA A 18 1 ? 8 HELX_P HELX_P2 AA2 PRO A 21 ? TYR A 26 ? PRO A 21 TYR A 26 1 ? 6 HELX_P HELX_P3 AA3 SER A 60 ? MET A 64 ? SER A 60 MET A 64 5 ? 5 HELX_P HELX_P4 AA4 ARG A 66 ? PHE A 89 ? ARG A 66 PHE A 89 1 ? 24 HELX_P HELX_P5 AA5 GLU A 108 ? LYS A 110 ? GLU A 108 LYS A 110 5 ? 3 HELX_P HELX_P6 AA6 GLN A 111 ? LEU A 129 ? GLN A 111 LEU A 129 1 ? 19 HELX_P HELX_P7 AA7 GLY A 169 ? ALA A 182 ? GLY A 169 ALA A 182 1 ? 14 HELX_P HELX_P8 AA8 SER A 190 ? CYS A 197 ? SER A 190 CYS A 197 1 ? 8 HELX_P HELX_P9 AA9 ASN A 225 ? THR A 235 ? ASN A 225 THR A 235 1 ? 11 HELX_P HELX_P10 AB1 SER A 242 ? LYS A 246 ? SER A 242 LYS A 246 5 ? 5 HELX_P HELX_P11 AB2 ARG A 250 ? LEU A 255 ? ARG A 250 LEU A 255 5 ? 6 HELX_P HELX_P12 AB3 ASP A 258 ? LYS A 267 ? ASP A 258 LYS A 267 1 ? 10 HELX_P HELX_P13 AB4 MET A 270 ? ASP A 278 ? MET A 270 ASP A 278 1 ? 9 HELX_P HELX_P14 AB5 LYS A 306 ? GLN A 329 ? LYS A 306 GLN A 329 1 ? 24 HELX_P HELX_P15 AB6 ASP A 357 ? SER A 374 ? ASP A 357 SER A 374 1 ? 18 HELX_P HELX_P16 AB7 GLY A 408 ? TYR A 421 ? GLY A 408 TYR A 421 1 ? 14 HELX_P HELX_P17 AB8 ASP A 428 ? SER A 435 ? ASP A 428 SER A 435 1 ? 8 HELX_P HELX_P18 AB9 PRO A 438 ? TYR A 440 ? PRO A 438 TYR A 440 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 252 C ? ? ? 1_555 A CME 253 N ? ? A ALA 252 A CME 253 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A CME 253 C ? ? ? 1_555 A THR 254 N ? ? A CME 253 A THR 254 1_555 ? ? ? ? ? ? ? 1.320 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 33 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 33 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 34 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 34 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.26 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 7 ? AA3 ? 5 ? AA4 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? parallel AA4 5 6 ? anti-parallel AA4 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 92 ? PHE A 96 ? ASP A 92 PHE A 96 AA1 2 ALA A 100 ? ARG A 106 ? ALA A 100 ARG A 106 AA1 3 PHE A 35 ? ASP A 47 ? PHE A 35 ASP A 47 AA1 4 LYS A 144 ? GLY A 158 ? LYS A 144 GLY A 158 AA1 5 SER A 163 ? ILE A 168 ? SER A 163 ILE A 168 AA2 1 ASP A 92 ? PHE A 96 ? ASP A 92 PHE A 96 AA2 2 ALA A 100 ? ARG A 106 ? ALA A 100 ARG A 106 AA2 3 PHE A 35 ? ASP A 47 ? PHE A 35 ASP A 47 AA2 4 LYS A 144 ? GLY A 158 ? LYS A 144 GLY A 158 AA2 5 VAL A 187 ? LEU A 189 ? VAL A 187 LEU A 189 AA2 6 GLN A 210 ? LEU A 218 ? GLN A 210 LEU A 218 AA2 7 ILE A 202 ? VAL A 207 ? ILE A 202 VAL A 207 AA3 1 GLY A 330 ? PHE A 338 ? GLY A 330 PHE A 338 AA3 2 GLY A 341 ? PHE A 348 ? GLY A 341 PHE A 348 AA3 3 GLU A 288 ? MET A 300 ? GLU A 288 MET A 300 AA3 4 THR A 381 ? HIS A 398 ? THR A 381 HIS A 398 AA3 5 ARG A 401 ? ILE A 407 ? ARG A 401 ILE A 407 AA4 1 GLY A 330 ? PHE A 338 ? GLY A 330 PHE A 338 AA4 2 GLY A 341 ? PHE A 348 ? GLY A 341 PHE A 348 AA4 3 GLU A 288 ? MET A 300 ? GLU A 288 MET A 300 AA4 4 THR A 381 ? HIS A 398 ? THR A 381 HIS A 398 AA4 5 VAL A 425 ? CYS A 427 ? VAL A 425 CYS A 427 AA4 6 TYR A 460 ? TYR A 462 ? TYR A 460 TYR A 462 AA4 7 PHE A 442 ? GLU A 444 ? PHE A 442 GLU A 444 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 94 ? N LEU A 94 O LEU A 102 ? O LEU A 102 AA1 2 3 O ALA A 103 ? O ALA A 103 N MET A 44 ? N MET A 44 AA1 3 4 N PHE A 39 ? N PHE A 39 O ILE A 152 ? O ILE A 152 AA1 4 5 N SER A 153 ? N SER A 153 O ILE A 168 ? O ILE A 168 AA2 1 2 N LEU A 94 ? N LEU A 94 O LEU A 102 ? O LEU A 102 AA2 2 3 O ALA A 103 ? O ALA A 103 N MET A 44 ? N MET A 44 AA2 3 4 N PHE A 39 ? N PHE A 39 O ILE A 152 ? O ILE A 152 AA2 4 5 N LEU A 147 ? N LEU A 147 O ILE A 188 ? O ILE A 188 AA2 5 6 N LEU A 189 ? N LEU A 189 O VAL A 213 ? O VAL A 213 AA2 6 7 O ASN A 216 ? O ASN A 216 N GLU A 203 ? N GLU A 203 AA3 1 2 N LYS A 334 ? N LYS A 334 O LEU A 345 ? O LEU A 345 AA3 2 3 O CYS A 342 ? O CYS A 342 N LEU A 299 ? N LEU A 299 AA3 3 4 N ILE A 294 ? N ILE A 294 O ALA A 387 ? O ALA A 387 AA3 4 5 N HIS A 398 ? N HIS A 398 O ARG A 401 ? O ARG A 401 AA4 1 2 N LYS A 334 ? N LYS A 334 O LEU A 345 ? O LEU A 345 AA4 2 3 O CYS A 342 ? O CYS A 342 N LEU A 299 ? N LEU A 299 AA4 3 4 N ILE A 294 ? N ILE A 294 O ALA A 387 ? O ALA A 387 AA4 4 5 N ILE A 384 ? N ILE A 384 O THR A 426 ? O THR A 426 AA4 5 6 N VAL A 425 ? N VAL A 425 O TYR A 462 ? O TYR A 462 AA4 6 7 O GLN A 461 ? O GLN A 461 N LYS A 443 ? N LYS A 443 # _atom_sites.entry_id 8COJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010111 _atom_sites.fract_transf_matrix[1][2] 0.005837 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011675 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010025 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? F ? ? 4.90428 4.07044 ? ? 12.99538 1.63651 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 GLU 6 6 ? ? ? A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 TRP 105 105 105 TRP TRP A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 CYS 122 122 122 CYS CYS A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 THR 132 132 ? ? ? A . n A 1 133 GLN 133 133 ? ? ? A . n A 1 134 GLU 134 134 ? ? ? A . n A 1 135 TRP 135 135 ? ? ? A . n A 1 136 GLU 136 136 ? ? ? A . n A 1 137 GLU 137 137 ? ? ? A . n A 1 138 GLY 138 138 ? ? ? A . n A 1 139 LEU 139 139 ? ? ? A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 HIS 151 151 151 HIS HIS A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 MET 154 154 154 MET MET A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 HIS 162 162 162 HIS HIS A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 HIS 164 164 164 HIS HIS A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 GLN 170 170 170 GLN GLN A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 ASP 173 173 173 ASP ASP A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 ARG 176 176 176 ARG ARG A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 GLN 179 179 179 GLN GLN A . n A 1 180 ASN 180 180 180 ASN ASN A . n A 1 181 MET 181 181 181 MET MET A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 GLN 183 183 183 GLN GLN A . n A 1 184 MET 184 184 184 MET MET A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 VAL 187 187 187 VAL VAL A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 ASN 192 192 192 ASN ASN A . n A 1 193 CYS 193 193 193 CYS CYS A . n A 1 194 TRP 194 194 194 TRP TRP A . n A 1 195 GLN 195 195 195 GLN GLN A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 CYS 197 197 197 CYS CYS A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 ARG 199 199 199 ARG ARG A . n A 1 200 SER 200 200 200 SER SER A . n A 1 201 MET 201 201 201 MET MET A . n A 1 202 ILE 202 202 202 ILE ILE A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 ILE 204 204 204 ILE ILE A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 SER 206 206 206 SER SER A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 GLN 210 210 210 GLN GLN A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 LYS 214 214 214 LYS LYS A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 ASN 216 216 216 ASN ASN A . n A 1 217 PHE 217 217 217 PHE PHE A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 PRO 220 220 220 PRO PRO A . n A 1 221 PRO 221 221 221 PRO PRO A . n A 1 222 PRO 222 222 222 PRO PRO A . n A 1 223 ASN 223 223 223 ASN ASN A . n A 1 224 PHE 224 224 224 PHE PHE A . n A 1 225 ASN 225 225 225 ASN ASN A . n A 1 226 PHE 226 226 226 PHE PHE A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 PHE 229 229 229 PHE PHE A . n A 1 230 PHE 230 230 230 PHE PHE A . n A 1 231 THR 231 231 231 THR THR A . n A 1 232 LYS 232 232 232 LYS LYS A . n A 1 233 CYS 233 233 233 CYS CYS A . n A 1 234 THR 234 234 234 THR THR A . n A 1 235 THR 235 235 235 THR THR A . n A 1 236 PHE 236 236 236 PHE PHE A . n A 1 237 MET 237 237 237 MET MET A . n A 1 238 HIS 238 238 238 HIS HIS A . n A 1 239 TYR 239 239 239 TYR TYR A . n A 1 240 TYR 240 240 240 TYR TYR A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 SER 242 242 242 SER SER A . n A 1 243 GLY 243 243 243 GLY GLY A . n A 1 244 GLU 244 244 244 GLU GLU A . n A 1 245 HIS 245 245 245 HIS HIS A . n A 1 246 LYS 246 246 246 LYS LYS A . n A 1 247 ASN 247 247 247 ASN ASN A . n A 1 248 LEU 248 248 248 LEU LEU A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 ARG 250 250 250 ARG ARG A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 CME 253 253 253 CME CME A . n A 1 254 THR 254 254 254 THR THR A . n A 1 255 LEU 255 255 255 LEU LEU A . n A 1 256 LYS 256 256 256 LYS LYS A . n A 1 257 PRO 257 257 257 PRO PRO A . n A 1 258 ASP 258 258 258 ASP ASP A . n A 1 259 PRO 259 259 259 PRO PRO A . n A 1 260 GLU 260 260 260 GLU GLU A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 GLU 262 262 262 GLU GLU A . n A 1 263 MET 263 263 263 MET MET A . n A 1 264 SER 264 264 264 SER SER A . n A 1 265 LEU 265 265 265 LEU LEU A . n A 1 266 GLN 266 266 266 GLN GLN A . n A 1 267 LYS 267 267 267 LYS LYS A . n A 1 268 TYR 268 268 268 TYR TYR A . n A 1 269 VAL 269 269 269 VAL VAL A . n A 1 270 MET 270 270 270 MET MET A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 SER 272 272 272 SER SER A . n A 1 273 ILE 273 273 273 ILE ILE A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 LYS 275 275 275 LYS LYS A . n A 1 276 GLN 276 276 276 GLN GLN A . n A 1 277 ILE 277 277 277 ILE ILE A . n A 1 278 ASP 278 278 278 ASP ASP A . n A 1 279 ASN 279 279 279 ASN ASN A . n A 1 280 LYS 280 280 280 LYS LYS A . n A 1 281 GLN 281 281 281 GLN GLN A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 GLN 283 283 283 GLN GLN A . n A 1 284 GLY 284 284 284 GLY GLY A . n A 1 285 TYR 285 285 285 TYR TYR A . n A 1 286 LEU 286 286 286 LEU LEU A . n A 1 287 SER 287 287 287 SER SER A . n A 1 288 GLU 288 288 288 GLU GLU A . n A 1 289 LEU 289 289 289 LEU LEU A . n A 1 290 ARG 290 290 290 ARG ARG A . n A 1 291 PRO 291 291 291 PRO PRO A . n A 1 292 VAL 292 292 292 VAL VAL A . n A 1 293 THR 293 293 293 THR THR A . n A 1 294 ILE 294 294 294 ILE ILE A . n A 1 295 VAL 295 295 295 VAL VAL A . n A 1 296 PHE 296 296 296 PHE PHE A . n A 1 297 VAL 297 297 297 VAL VAL A . n A 1 298 ASN 298 298 298 ASN ASN A . n A 1 299 LEU 299 299 299 LEU LEU A . n A 1 300 MET 300 300 300 MET MET A . n A 1 301 PHE 301 301 301 PHE PHE A . n A 1 302 GLU 302 302 302 GLU GLU A . n A 1 303 ASP 303 303 303 ASP ASP A . n A 1 304 GLN 304 304 304 GLN GLN A . n A 1 305 ASP 305 305 305 ASP ASP A . n A 1 306 LYS 306 306 306 LYS LYS A . n A 1 307 ALA 307 307 307 ALA ALA A . n A 1 308 GLU 308 308 308 GLU GLU A . n A 1 309 GLU 309 309 309 GLU GLU A . n A 1 310 ILE 310 310 310 ILE ILE A . n A 1 311 GLY 311 311 311 GLY GLY A . n A 1 312 PRO 312 312 312 PRO PRO A . n A 1 313 ALA 313 313 313 ALA ALA A . n A 1 314 ILE 314 314 314 ILE ILE A . n A 1 315 GLN 315 315 315 GLN GLN A . n A 1 316 ASP 316 316 316 ASP ASP A . n A 1 317 ALA 317 317 317 ALA ALA A . n A 1 318 TYR 318 318 318 TYR TYR A . n A 1 319 MET 319 319 319 MET MET A . n A 1 320 HIS 320 320 320 HIS HIS A . n A 1 321 ILE 321 321 321 ILE ILE A . n A 1 322 THR 322 322 322 THR THR A . n A 1 323 SER 323 323 323 SER SER A . n A 1 324 VAL 324 324 324 VAL VAL A . n A 1 325 LEU 325 325 325 LEU LEU A . n A 1 326 LYS 326 326 326 LYS LYS A . n A 1 327 ILE 327 327 327 ILE ILE A . n A 1 328 PHE 328 328 328 PHE PHE A . n A 1 329 GLN 329 329 329 GLN GLN A . n A 1 330 GLY 330 330 330 GLY GLY A . n A 1 331 GLN 331 331 331 GLN GLN A . n A 1 332 ILE 332 332 332 ILE ILE A . n A 1 333 ASN 333 333 333 ASN ASN A . n A 1 334 LYS 334 334 334 LYS LYS A . n A 1 335 VAL 335 335 335 VAL VAL A . n A 1 336 PHE 336 336 336 PHE PHE A . n A 1 337 MET 337 337 337 MET MET A . n A 1 338 PHE 338 338 338 PHE PHE A . n A 1 339 ASP 339 339 339 ASP ASP A . n A 1 340 LYS 340 340 340 LYS LYS A . n A 1 341 GLY 341 341 341 GLY GLY A . n A 1 342 CYS 342 342 342 CYS CYS A . n A 1 343 SER 343 343 343 SER SER A . n A 1 344 PHE 344 344 344 PHE PHE A . n A 1 345 LEU 345 345 345 LEU LEU A . n A 1 346 CYS 346 346 346 CYS CYS A . n A 1 347 VAL 347 347 347 VAL VAL A . n A 1 348 PHE 348 348 348 PHE PHE A . n A 1 349 GLY 349 349 349 GLY GLY A . n A 1 350 PHE 350 350 350 PHE PHE A . n A 1 351 PRO 351 351 351 PRO PRO A . n A 1 352 GLY 352 352 352 GLY GLY A . n A 1 353 GLU 353 353 353 GLU GLU A . n A 1 354 LYS 354 354 354 LYS LYS A . n A 1 355 VAL 355 355 355 VAL VAL A . n A 1 356 PRO 356 356 356 PRO PRO A . n A 1 357 ASP 357 357 357 ASP ASP A . n A 1 358 GLU 358 358 358 GLU GLU A . n A 1 359 LEU 359 359 359 LEU LEU A . n A 1 360 THR 360 360 360 THR THR A . n A 1 361 HIS 361 361 361 HIS HIS A . n A 1 362 ALA 362 362 362 ALA ALA A . n A 1 363 LEU 363 363 363 LEU LEU A . n A 1 364 GLU 364 364 364 GLU GLU A . n A 1 365 CYS 365 365 365 CYS CYS A . n A 1 366 ALA 366 366 366 ALA ALA A . n A 1 367 MET 367 367 367 MET MET A . n A 1 368 ASP 368 368 368 ASP ASP A . n A 1 369 ILE 369 369 369 ILE ILE A . n A 1 370 PHE 370 370 370 PHE PHE A . n A 1 371 ASP 371 371 371 ASP ASP A . n A 1 372 PHE 372 372 372 PHE PHE A . n A 1 373 CYS 373 373 373 CYS CYS A . n A 1 374 SER 374 374 374 SER SER A . n A 1 375 GLN 375 375 375 GLN GLN A . n A 1 376 VAL 376 376 376 VAL VAL A . n A 1 377 HIS 377 377 377 HIS HIS A . n A 1 378 LYS 378 378 378 LYS LYS A . n A 1 379 ILE 379 379 379 ILE ILE A . n A 1 380 GLN 380 380 380 GLN GLN A . n A 1 381 THR 381 381 381 THR THR A . n A 1 382 VAL 382 382 382 VAL VAL A . n A 1 383 SER 383 383 383 SER SER A . n A 1 384 ILE 384 384 384 ILE ILE A . n A 1 385 GLY 385 385 385 GLY GLY A . n A 1 386 VAL 386 386 386 VAL VAL A . n A 1 387 ALA 387 387 387 ALA ALA A . n A 1 388 SER 388 388 388 SER SER A . n A 1 389 GLY 389 389 389 GLY GLY A . n A 1 390 ILE 390 390 390 ILE ILE A . n A 1 391 VAL 391 391 391 VAL VAL A . n A 1 392 PHE 392 392 392 PHE PHE A . n A 1 393 CYS 393 393 393 CYS CYS A . n A 1 394 GLY 394 394 394 GLY GLY A . n A 1 395 ILE 395 395 395 ILE ILE A . n A 1 396 VAL 396 396 396 VAL VAL A . n A 1 397 GLY 397 397 397 GLY GLY A . n A 1 398 HIS 398 398 398 HIS HIS A . n A 1 399 THR 399 399 399 THR THR A . n A 1 400 VAL 400 400 400 VAL VAL A . n A 1 401 ARG 401 401 401 ARG ARG A . n A 1 402 HIS 402 402 402 HIS HIS A . n A 1 403 GLU 403 403 403 GLU GLU A . n A 1 404 TYR 404 404 404 TYR TYR A . n A 1 405 THR 405 405 405 THR THR A . n A 1 406 VAL 406 406 406 VAL VAL A . n A 1 407 ILE 407 407 407 ILE ILE A . n A 1 408 GLY 408 408 408 GLY GLY A . n A 1 409 GLN 409 409 409 GLN GLN A . n A 1 410 LYS 410 410 410 LYS LYS A . n A 1 411 VAL 411 411 411 VAL VAL A . n A 1 412 ASN 412 412 412 ASN ASN A . n A 1 413 LEU 413 413 413 LEU LEU A . n A 1 414 ALA 414 414 414 ALA ALA A . n A 1 415 ALA 415 415 415 ALA ALA A . n A 1 416 ARG 416 416 416 ARG ARG A . n A 1 417 MET 417 417 417 MET MET A . n A 1 418 MET 418 418 418 MET MET A . n A 1 419 MET 419 419 419 MET MET A . n A 1 420 TYR 420 420 420 TYR TYR A . n A 1 421 TYR 421 421 421 TYR TYR A . n A 1 422 PRO 422 422 422 PRO PRO A . n A 1 423 GLY 423 423 423 GLY GLY A . n A 1 424 ILE 424 424 424 ILE ILE A . n A 1 425 VAL 425 425 425 VAL VAL A . n A 1 426 THR 426 426 426 THR THR A . n A 1 427 CYS 427 427 427 CYS CYS A . n A 1 428 ASP 428 428 428 ASP ASP A . n A 1 429 SER 429 429 429 SER SER A . n A 1 430 VAL 430 430 430 VAL VAL A . n A 1 431 THR 431 431 431 THR THR A . n A 1 432 TYR 432 432 432 TYR TYR A . n A 1 433 ASN 433 433 433 ASN ASN A . n A 1 434 GLY 434 434 434 GLY GLY A . n A 1 435 SER 435 435 435 SER SER A . n A 1 436 ASN 436 436 436 ASN ASN A . n A 1 437 LEU 437 437 437 LEU LEU A . n A 1 438 PRO 438 438 438 PRO PRO A . n A 1 439 ALA 439 439 439 ALA ALA A . n A 1 440 TYR 440 440 440 TYR TYR A . n A 1 441 PHE 441 441 441 PHE PHE A . n A 1 442 PHE 442 442 442 PHE PHE A . n A 1 443 LYS 443 443 443 LYS LYS A . n A 1 444 GLU 444 444 444 GLU GLU A . n A 1 445 LEU 445 445 445 LEU LEU A . n A 1 446 PRO 446 446 446 PRO PRO A . n A 1 447 LYS 447 447 447 LYS LYS A . n A 1 448 LYS 448 448 448 LYS LYS A . n A 1 449 VAL 449 449 449 VAL VAL A . n A 1 450 MET 450 450 450 MET MET A . n A 1 451 LYS 451 451 451 LYS LYS A . n A 1 452 GLY 452 452 452 GLY GLY A . n A 1 453 VAL 453 453 453 VAL VAL A . n A 1 454 ALA 454 454 454 ALA ALA A . n A 1 455 ASP 455 455 455 ASP ASP A . n A 1 456 SER 456 456 456 SER SER A . n A 1 457 GLY 457 457 457 GLY GLY A . n A 1 458 PRO 458 458 458 PRO PRO A . n A 1 459 LEU 459 459 459 LEU LEU A . n A 1 460 TYR 460 460 460 TYR TYR A . n A 1 461 GLN 461 461 461 GLN GLN A . n A 1 462 TYR 462 462 462 TYR TYR A . n A 1 463 TRP 463 463 463 TRP TRP A . n A 1 464 GLY 464 464 464 GLY GLY A . n A 1 465 ARG 465 465 465 ARG ARG A . n A 1 466 THR 466 466 466 THR THR A . n A 1 467 GLU 467 467 467 GLU GLU A . n A 1 468 LYS 468 468 468 LYS LYS A . n A 1 469 VAL 469 469 ? ? ? A . n A 1 470 HIS 470 470 ? ? ? A . n A 1 471 HIS 471 471 ? ? ? A . n A 1 472 HIS 472 472 ? ? ? A . n A 1 473 HIS 473 473 ? ? ? A . n A 1 474 HIS 474 474 ? ? ? A . n A 1 475 HIS 475 475 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email clemens.steegborn@uni-bayreuth.de _pdbx_contact_author.name_first Clemens _pdbx_contact_author.name_last Steegborn _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0913-1467 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 VE1 1 501 501 VE1 102 A . C 3 DMS 1 502 601 DMS DMS A . D 3 DMS 1 503 701 DMS DMS A . E 3 DMS 1 504 801 DMS DMS A . F 3 DMS 1 505 901 DMS DMS A . G 4 ACT 1 506 1001 ACT ACT A . H 5 EDO 1 507 1101 EDO EDO A . I 5 EDO 1 508 1201 EDO EDO A . J 5 EDO 1 509 1301 EDO EDO A . K 5 EDO 1 510 1401 EDO EDO A . L 5 EDO 1 511 1501 EDO EDO A . M 5 EDO 1 512 1601 EDO EDO A . N 6 HOH 1 601 7 HOH HOH A . N 6 HOH 2 602 38 HOH HOH A . N 6 HOH 3 603 36 HOH HOH A . N 6 HOH 4 604 124 HOH HOH A . N 6 HOH 5 605 58 HOH HOH A . N 6 HOH 6 606 5 HOH HOH A . N 6 HOH 7 607 33 HOH HOH A . N 6 HOH 8 608 31 HOH HOH A . N 6 HOH 9 609 20 HOH HOH A . N 6 HOH 10 610 89 HOH HOH A . N 6 HOH 11 611 63 HOH HOH A . N 6 HOH 12 612 6 HOH HOH A . N 6 HOH 13 613 66 HOH HOH A . N 6 HOH 14 614 4 HOH HOH A . N 6 HOH 15 615 86 HOH HOH A . N 6 HOH 16 616 2 HOH HOH A . N 6 HOH 17 617 75 HOH HOH A . N 6 HOH 18 618 37 HOH HOH A . N 6 HOH 19 619 19 HOH HOH A . N 6 HOH 20 620 125 HOH HOH A . N 6 HOH 21 621 107 HOH HOH A . N 6 HOH 22 622 22 HOH HOH A . N 6 HOH 23 623 3 HOH HOH A . N 6 HOH 24 624 35 HOH HOH A . N 6 HOH 25 625 23 HOH HOH A . N 6 HOH 26 626 57 HOH HOH A . N 6 HOH 27 627 65 HOH HOH A . N 6 HOH 28 628 73 HOH HOH A . N 6 HOH 29 629 1 HOH HOH A . N 6 HOH 30 630 32 HOH HOH A . N 6 HOH 31 631 56 HOH HOH A . N 6 HOH 32 632 80 HOH HOH A . N 6 HOH 33 633 8 HOH HOH A . N 6 HOH 34 634 90 HOH HOH A . N 6 HOH 35 635 41 HOH HOH A . N 6 HOH 36 636 48 HOH HOH A . N 6 HOH 37 637 9 HOH HOH A . N 6 HOH 38 638 12 HOH HOH A . N 6 HOH 39 639 13 HOH HOH A . N 6 HOH 40 640 96 HOH HOH A . N 6 HOH 41 641 71 HOH HOH A . N 6 HOH 42 642 84 HOH HOH A . N 6 HOH 43 643 60 HOH HOH A . N 6 HOH 44 644 59 HOH HOH A . N 6 HOH 45 645 18 HOH HOH A . N 6 HOH 46 646 94 HOH HOH A . N 6 HOH 47 647 43 HOH HOH A . N 6 HOH 48 648 130 HOH HOH A . N 6 HOH 49 649 29 HOH HOH A . N 6 HOH 50 650 122 HOH HOH A . N 6 HOH 51 651 70 HOH HOH A . N 6 HOH 52 652 85 HOH HOH A . N 6 HOH 53 653 49 HOH HOH A . N 6 HOH 54 654 52 HOH HOH A . N 6 HOH 55 655 53 HOH HOH A . N 6 HOH 56 656 95 HOH HOH A . N 6 HOH 57 657 103 HOH HOH A . N 6 HOH 58 658 61 HOH HOH A . N 6 HOH 59 659 25 HOH HOH A . N 6 HOH 60 660 17 HOH HOH A . N 6 HOH 61 661 74 HOH HOH A . N 6 HOH 62 662 21 HOH HOH A . N 6 HOH 63 663 62 HOH HOH A . N 6 HOH 64 664 44 HOH HOH A . N 6 HOH 65 665 46 HOH HOH A . N 6 HOH 66 666 24 HOH HOH A . N 6 HOH 67 667 45 HOH HOH A . N 6 HOH 68 668 30 HOH HOH A . N 6 HOH 69 669 11 HOH HOH A . N 6 HOH 70 670 16 HOH HOH A . N 6 HOH 71 671 102 HOH HOH A . N 6 HOH 72 672 115 HOH HOH A . N 6 HOH 73 673 72 HOH HOH A . N 6 HOH 74 674 133 HOH HOH A . N 6 HOH 75 675 26 HOH HOH A . N 6 HOH 76 676 105 HOH HOH A . N 6 HOH 77 677 14 HOH HOH A . N 6 HOH 78 678 97 HOH HOH A . N 6 HOH 79 679 50 HOH HOH A . N 6 HOH 80 680 93 HOH HOH A . N 6 HOH 81 681 110 HOH HOH A . N 6 HOH 82 682 67 HOH HOH A . N 6 HOH 83 683 136 HOH HOH A . N 6 HOH 84 684 34 HOH HOH A . N 6 HOH 85 685 15 HOH HOH A . N 6 HOH 86 686 99 HOH HOH A . N 6 HOH 87 687 126 HOH HOH A . N 6 HOH 88 688 91 HOH HOH A . N 6 HOH 89 689 123 HOH HOH A . N 6 HOH 90 690 138 HOH HOH A . N 6 HOH 91 691 132 HOH HOH A . N 6 HOH 92 692 68 HOH HOH A . N 6 HOH 93 693 127 HOH HOH A . N 6 HOH 94 694 109 HOH HOH A . N 6 HOH 95 695 108 HOH HOH A . N 6 HOH 96 696 88 HOH HOH A . N 6 HOH 97 697 79 HOH HOH A . N 6 HOH 98 698 77 HOH HOH A . N 6 HOH 99 699 137 HOH HOH A . N 6 HOH 100 700 113 HOH HOH A . N 6 HOH 101 701 117 HOH HOH A . N 6 HOH 102 702 40 HOH HOH A . N 6 HOH 103 703 119 HOH HOH A . N 6 HOH 104 704 135 HOH HOH A . N 6 HOH 105 705 42 HOH HOH A . N 6 HOH 106 706 51 HOH HOH A . N 6 HOH 107 707 131 HOH HOH A . N 6 HOH 108 708 120 HOH HOH A . N 6 HOH 109 709 116 HOH HOH A . N 6 HOH 110 710 121 HOH HOH A . N 6 HOH 111 711 47 HOH HOH A . N 6 HOH 112 712 134 HOH HOH A . N 6 HOH 113 713 112 HOH HOH A . N 6 HOH 114 714 92 HOH HOH A . N 6 HOH 115 715 128 HOH HOH A . N 6 HOH 116 716 83 HOH HOH A . N 6 HOH 117 717 114 HOH HOH A . N 6 HOH 118 718 64 HOH HOH A . N 6 HOH 119 719 129 HOH HOH A . N 6 HOH 120 720 118 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CME _pdbx_struct_mod_residue.label_seq_id 253 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CME _pdbx_struct_mod_residue.auth_seq_id 253 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2280 ? 1 MORE 27 ? 1 'SSA (A^2)' 20050 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-04-26 2 'Structure model' 1 1 2023-05-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/2 3 y,-x+y,z+1/2 4 -y,x-y,z 5 -x+y,-x,z 6 -x,-y,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 8.43032262072 36.4239555061 -5.36927869722 0.263742980857 ? 0.0215289238918 ? 0.0279072559452 ? 0.259117988293 ? -0.0191876331893 ? 0.306199070095 ? -0.00886407863011 ? -0.065186595506 ? 0.2138307183 ? 0.565351969589 ? -0.182623478086 ? 0.437205203907 ? 0.0045522429763 ? 0.0816200108928 ? -0.00568800460903 ? -0.0154090000397 ? -0.0166786647989 ? -0.0197837366041 ? 0.0135862189143 ? 0.0774195901098 ? 7.34999970533e-06 ? 2 'X-RAY DIFFRACTION' ? refined 9.92639648654 30.1310013479 -12.4569678327 0.255576993595 ? 0.0387324261804 ? 0.00684204370069 ? 0.296776424911 ? -0.0377550255442 ? 0.271448184125 ? 0.90679991977 ? -0.343030327906 ? -0.718844050984 ? 1.04643412845 ? 0.165950890116 ? 1.54041351779 ? -0.0241605856311 ? -0.0716973443996 ? -0.0240225883574 ? -0.143386616537 ? 0.0148266672835 ? -0.0109891743513 ? 0.177208041942 ? 0.211315118571 ? -0.000189326330118 ? 3 'X-RAY DIFFRACTION' ? refined 13.4191294837 27.4028596669 14.5856830167 0.328682391657 ? 0.0352253606371 ? 0.0112327913792 ? 0.236667062421 ? 0.0374061831737 ? 0.25257561845 ? 1.07688777728 ? -0.860977913975 ? 0.891061994986 ? 0.657234559549 ? -0.332118785778 ? 1.539724768 ? -0.034533434069 ? -0.0570358490174 ? -0.0373580996279 ? 0.151711212643 ? -0.0217413336152 ? -0.00256151381301 ? 0.0942043784725 ? 0.157890642727 ? 0.000838067609586 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 7 through 108 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 109 through 287 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 288 through 468 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 8COJ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OG1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 THR _pdbx_validate_close_contact.auth_seq_id_1 360 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OD1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASN _pdbx_validate_close_contact.auth_seq_id_2 436 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.15 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A MET 237 ? ? 1_555 HZ3 A LYS 443 ? ? 6_554 1.23 2 1 C A HIS 238 ? ? 1_555 HZ1 A LYS 443 ? ? 6_554 1.41 3 1 O A MET 237 ? ? 1_555 NZ A LYS 443 ? ? 6_554 1.76 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD1 A PHE 350 ? ? CE1 A PHE 350 ? ? 1.151 1.388 -0.237 0.020 N 2 1 CZ A PHE 350 ? ? CE2 A PHE 350 ? ? 1.067 1.369 -0.302 0.019 N 3 1 CE2 A PHE 350 ? ? CD2 A PHE 350 ? ? 1.234 1.388 -0.154 0.020 N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CD _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LYS _pdbx_validate_rmsd_angle.auth_seq_id_1 443 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CE _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LYS _pdbx_validate_rmsd_angle.auth_seq_id_2 443 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NZ _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LYS _pdbx_validate_rmsd_angle.auth_seq_id_3 443 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 97.21 _pdbx_validate_rmsd_angle.angle_target_value 111.70 _pdbx_validate_rmsd_angle.angle_deviation -14.49 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 10 ? ? -97.88 34.32 2 1 ALA A 97 ? ? -142.35 28.60 3 1 ASP A 159 ? ? -117.42 -168.02 4 1 ASN A 185 ? ? 80.73 3.86 5 1 HIS A 238 ? ? -69.21 7.93 6 1 TYR A 239 ? ? -141.61 26.66 7 1 ASP A 258 ? ? -163.02 89.21 8 1 LYS A 340 ? ? 59.85 11.85 9 1 PRO A 351 ? ? -27.14 -54.88 10 1 LYS A 378 ? ? 79.57 -6.99 11 1 ALA A 454 ? ? -68.20 -172.59 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 SER A 49 ? ? GLY A 50 ? ? -135.63 2 1 PHE A 350 ? ? PRO A 351 ? ? -143.46 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PHE 51 ? CG ? A PHE 51 CG 2 1 Y 1 A PHE 51 ? CD1 ? A PHE 51 CD1 3 1 Y 1 A PHE 51 ? CD2 ? A PHE 51 CD2 4 1 Y 1 A PHE 51 ? CE1 ? A PHE 51 CE1 5 1 Y 1 A PHE 51 ? CE2 ? A PHE 51 CE2 6 1 Y 1 A PHE 51 ? CZ ? A PHE 51 CZ 7 1 Y 1 A LYS 57 ? CG ? A LYS 57 CG 8 1 Y 1 A LYS 57 ? CD ? A LYS 57 CD 9 1 Y 1 A LYS 57 ? CE ? A LYS 57 CE 10 1 Y 1 A LYS 57 ? NZ ? A LYS 57 NZ 11 1 Y 1 A LYS 219 ? CG ? A LYS 219 CG 12 1 Y 1 A LYS 219 ? CD ? A LYS 219 CD 13 1 Y 1 A LYS 219 ? CE ? A LYS 219 CE 14 1 Y 1 A LYS 219 ? NZ ? A LYS 219 NZ 15 1 Y 1 A GLU 353 ? CG ? A GLU 353 CG 16 1 Y 1 A GLU 353 ? CD ? A GLU 353 CD 17 1 Y 1 A GLU 353 ? OE1 ? A GLU 353 OE1 18 1 Y 1 A GLU 353 ? OE2 ? A GLU 353 OE2 19 1 Y 1 A LYS 354 ? CG ? A LYS 354 CG 20 1 Y 1 A LYS 354 ? CD ? A LYS 354 CD 21 1 Y 1 A LYS 354 ? CE ? A LYS 354 CE 22 1 Y 1 A LYS 354 ? NZ ? A LYS 354 NZ 23 1 Y 1 A ARG 465 ? CG ? A ARG 465 CG 24 1 Y 1 A ARG 465 ? CD ? A ARG 465 CD 25 1 Y 1 A ARG 465 ? NE ? A ARG 465 NE 26 1 Y 1 A ARG 465 ? CZ ? A ARG 465 CZ 27 1 Y 1 A ARG 465 ? NH1 ? A ARG 465 NH1 28 1 Y 1 A ARG 465 ? NH2 ? A ARG 465 NH2 29 1 Y 1 A LYS 468 ? CG ? A LYS 468 CG 30 1 Y 1 A LYS 468 ? CD ? A LYS 468 CD 31 1 Y 1 A LYS 468 ? CE ? A LYS 468 CE 32 1 Y 1 A LYS 468 ? NZ ? A LYS 468 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A GLU 6 ? A GLU 6 7 1 Y 1 A THR 132 ? A THR 132 8 1 Y 1 A GLN 133 ? A GLN 133 9 1 Y 1 A GLU 134 ? A GLU 134 10 1 Y 1 A TRP 135 ? A TRP 135 11 1 Y 1 A GLU 136 ? A GLU 136 12 1 Y 1 A GLU 137 ? A GLU 137 13 1 Y 1 A GLY 138 ? A GLY 138 14 1 Y 1 A LEU 139 ? A LEU 139 15 1 Y 1 A VAL 469 ? A VAL 469 16 1 Y 1 A HIS 470 ? A HIS 470 17 1 Y 1 A HIS 471 ? A HIS 471 18 1 Y 1 A HIS 472 ? A HIS 472 19 1 Y 1 A HIS 473 ? A HIS 473 20 1 Y 1 A HIS 474 ? A HIS 474 21 1 Y 1 A HIS 475 ? A HIS 475 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number STE1701/11 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id VE1 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id VE1 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '4-chloranyl-6-[4-[(3-fluorophenyl)methyl]-1-methyl-pyrazol-3-yl]pyrimidin-2-amine' VE1 3 'DIMETHYL SULFOXIDE' DMS 4 'ACETATE ION' ACT 5 1,2-ETHANEDIOL EDO 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4cll _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 63' _space_group.name_Hall 'P 6c' _space_group.IT_number 173 _space_group.crystal_system hexagonal _space_group.id 1 #