data_8CT7
# 
_entry.id   8CT7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.397 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   8CT7         pdb_00008ct7 10.2210/pdb8ct7/pdb 
WWPDB D_1000265405 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2023-02-15 
2 'Structure model' 1 1 2023-03-15 
3 'Structure model' 1 2 2023-10-25 
4 'Structure model' 1 3 2024-10-09 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Refinement description' 
4 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                      
2 2 'Structure model' citation_author               
3 3 'Structure model' chem_comp_atom                
4 3 'Structure model' chem_comp_bond                
5 3 'Structure model' pdbx_initial_refinement_model 
6 4 'Structure model' pdbx_entry_details            
7 4 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                            
2  2 'Structure model' '_citation.journal_abbrev'                     
3  2 'Structure model' '_citation.journal_id_CSD'                     
4  2 'Structure model' '_citation.journal_id_ISSN'                    
5  2 'Structure model' '_citation.journal_volume'                     
6  2 'Structure model' '_citation.page_first'                         
7  2 'Structure model' '_citation.page_last'                          
8  2 'Structure model' '_citation.pdbx_database_id_DOI'               
9  2 'Structure model' '_citation.pdbx_database_id_PubMed'            
10 2 'Structure model' '_citation.title'                              
11 2 'Structure model' '_citation.year'                               
12 4 'Structure model' '_pdbx_entry_details.has_protein_modification' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        8CT7 
_pdbx_database_status.recvd_initial_deposition_date   2022-05-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_pdbx_contact_author.id                 2 
_pdbx_contact_author.email              vanduyne@pennmedicine.upenn.edu 
_pdbx_contact_author.name_first         Gregory 
_pdbx_contact_author.name_last          'Van Duyne' 
_pdbx_contact_author.name_mi            D 
_pdbx_contact_author.role               'principal investigator/group leader' 
_pdbx_contact_author.identifier_ORCID   0000-0003-0247-1626 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Gupta, K.'       1 0000-0002-7006-2667 
'Van Duyne, G.D.' 2 0000-0003-0247-1626 
'Eilers, G.'      3 0000-0001-9191-5932 
'Bushman, F.D.'   4 0000-0003-4740-4056 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Plos Pathog.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1553-7374 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            19 
_citation.language                  ? 
_citation.page_first                e1011097 
_citation.page_last                 e1011097 
_citation.title                     
'Structure of a HIV-1 IN-Allosteric inhibitor complex at 2.93 angstrom resolution: Routes to inhibitor optimization.' 
_citation.year                      2023 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1371/journal.ppat.1011097 
_citation.pdbx_database_id_PubMed   36867659 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Eilers, G.'     1 ?                   
primary 'Gupta, K.'      2 0000-0002-7006-2667 
primary 'Allen, A.'      3 ?                   
primary 'Montermoso, S.' 4 ?                   
primary 'Murali, H.'     5 ?                   
primary 'Sharp, R.'      6 ?                   
primary 'Hwang, Y.'      7 ?                   
primary 'Bushman, F.D.'  8 ?                   
primary 'Van Duyne, G.'  9 ?                   
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Integrase                                                                                         17894.152 1  ? 
F185K ? ? 
2 non-polymer syn '(2S)-tert-butoxy[4-(2,3-dihydropyrano[4,3,2-de]quinolin-7-yl)-2-methylquinolin-3-yl]acetic acid' 442.506   1  ? 
?     ? ? 
3 non-polymer syn 1,2-ETHANEDIOL                                                                                    62.068    1  ? 
?     ? ? 
4 non-polymer syn 'SULFATE ION'                                                                                     96.063    1  ? 
?     ? ? 
5 water       nat water                                                                                             18.015    19 ? 
?     ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MHGQVDCSPGIWQLD(CAF)THLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTT
VKAA(CAF)WWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIV
DIIATDIQT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA
CWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
T
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(2S)-tert-butoxy[4-(2,3-dihydropyrano[4,3,2-de]quinolin-7-yl)-2-methylquinolin-3-yl]acetic acid' L3D 
3 1,2-ETHANEDIOL                                                                                    EDO 
4 'SULFATE ION'                                                                                     SO4 
5 water                                                                                             HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   GLY n 
1 4   GLN n 
1 5   VAL n 
1 6   ASP n 
1 7   CYS n 
1 8   SER n 
1 9   PRO n 
1 10  GLY n 
1 11  ILE n 
1 12  TRP n 
1 13  GLN n 
1 14  LEU n 
1 15  ASP n 
1 16  CAF n 
1 17  THR n 
1 18  HIS n 
1 19  LEU n 
1 20  GLU n 
1 21  GLY n 
1 22  LYS n 
1 23  VAL n 
1 24  ILE n 
1 25  LEU n 
1 26  VAL n 
1 27  ALA n 
1 28  VAL n 
1 29  HIS n 
1 30  VAL n 
1 31  ALA n 
1 32  SER n 
1 33  GLY n 
1 34  TYR n 
1 35  ILE n 
1 36  GLU n 
1 37  ALA n 
1 38  GLU n 
1 39  VAL n 
1 40  ILE n 
1 41  PRO n 
1 42  ALA n 
1 43  GLU n 
1 44  THR n 
1 45  GLY n 
1 46  GLN n 
1 47  GLU n 
1 48  THR n 
1 49  ALA n 
1 50  TYR n 
1 51  PHE n 
1 52  LEU n 
1 53  LEU n 
1 54  LYS n 
1 55  LEU n 
1 56  ALA n 
1 57  GLY n 
1 58  ARG n 
1 59  TRP n 
1 60  PRO n 
1 61  VAL n 
1 62  LYS n 
1 63  THR n 
1 64  VAL n 
1 65  HIS n 
1 66  THR n 
1 67  ASP n 
1 68  ASN n 
1 69  GLY n 
1 70  SER n 
1 71  ASN n 
1 72  PHE n 
1 73  THR n 
1 74  SER n 
1 75  THR n 
1 76  THR n 
1 77  VAL n 
1 78  LYS n 
1 79  ALA n 
1 80  ALA n 
1 81  CAF n 
1 82  TRP n 
1 83  TRP n 
1 84  ALA n 
1 85  GLY n 
1 86  ILE n 
1 87  LYS n 
1 88  GLN n 
1 89  GLU n 
1 90  PHE n 
1 91  GLY n 
1 92  ILE n 
1 93  PRO n 
1 94  TYR n 
1 95  ASN n 
1 96  PRO n 
1 97  GLN n 
1 98  SER n 
1 99  GLN n 
1 100 GLY n 
1 101 VAL n 
1 102 ILE n 
1 103 GLU n 
1 104 SER n 
1 105 MET n 
1 106 ASN n 
1 107 LYS n 
1 108 GLU n 
1 109 LEU n 
1 110 LYS n 
1 111 LYS n 
1 112 ILE n 
1 113 ILE n 
1 114 GLY n 
1 115 GLN n 
1 116 VAL n 
1 117 ARG n 
1 118 ASP n 
1 119 GLN n 
1 120 ALA n 
1 121 GLU n 
1 122 HIS n 
1 123 LEU n 
1 124 LYS n 
1 125 THR n 
1 126 ALA n 
1 127 VAL n 
1 128 GLN n 
1 129 MET n 
1 130 ALA n 
1 131 VAL n 
1 132 PHE n 
1 133 ILE n 
1 134 HIS n 
1 135 ASN n 
1 136 LYS n 
1 137 LYS n 
1 138 ARG n 
1 139 LYS n 
1 140 GLY n 
1 141 GLY n 
1 142 ILE n 
1 143 GLY n 
1 144 GLY n 
1 145 TYR n 
1 146 SER n 
1 147 ALA n 
1 148 GLY n 
1 149 GLU n 
1 150 ARG n 
1 151 ILE n 
1 152 VAL n 
1 153 ASP n 
1 154 ILE n 
1 155 ILE n 
1 156 ALA n 
1 157 THR n 
1 158 ASP n 
1 159 ILE n 
1 160 GLN n 
1 161 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   161 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 pol 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human immunodeficiency virus 1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11676 
_entity_src_gen.pdbx_gene_src_variant              F185K 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET24 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                           ? 
'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                                                          ? 
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                        ? 
'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                   ? 
'C4 H7 N O4'       133.103 
CAF 'L-peptide linking' n S-DIMETHYLARSINOYL-CYSTEINE                                                                       
'CYSTEIN-S-YL CACODYLATE' 'C5 H12 As N O3 S' 241.140 
CYS 'L-peptide linking' y CYSTEINE                                                                                          ? 
'C3 H7 N O2 S'     121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                                                                    
'ETHYLENE GLYCOL'         'C2 H6 O2'         62.068  
GLN 'L-peptide linking' y GLUTAMINE                                                                                         ? 
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                   ? 
'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                                                           ? 
'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                         ? 
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                                                             ? 
'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                        ? 
'C6 H13 N O2'      131.173 
L3D non-polymer         . '(2S)-tert-butoxy[4-(2,3-dihydropyrano[4,3,2-de]quinolin-7-yl)-2-methylquinolin-3-yl]acetic acid' ? 
'C27 H26 N2 O4'    442.506 
LEU 'L-peptide linking' y LEUCINE                                                                                           ? 
'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                                                            ? 
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                                                        ? 
'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                     ? 
'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                                                           ? 
'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                                                            ? 
'C3 H7 N O3'       105.093 
SO4 non-polymer         . 'SULFATE ION'                                                                                     ? 
'O4 S -2'          96.063  
THR 'L-peptide linking' y THREONINE                                                                                         ? 
'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                        ? 
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                          ? 
'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                                                            ? 
'C5 H11 N O2'      117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   50  ?   ?   ?   A . n 
A 1 2   HIS 2   51  ?   ?   ?   A . n 
A 1 3   GLY 3   52  ?   ?   ?   A . n 
A 1 4   GLN 4   53  ?   ?   ?   A . n 
A 1 5   VAL 5   54  ?   ?   ?   A . n 
A 1 6   ASP 6   55  55  ASP ASP A . n 
A 1 7   CYS 7   56  56  CYS CYS A . n 
A 1 8   SER 8   57  57  SER SER A . n 
A 1 9   PRO 9   58  58  PRO PRO A . n 
A 1 10  GLY 10  59  59  GLY GLY A . n 
A 1 11  ILE 11  60  60  ILE ILE A . n 
A 1 12  TRP 12  61  61  TRP TRP A . n 
A 1 13  GLN 13  62  62  GLN GLN A . n 
A 1 14  LEU 14  63  63  LEU LEU A . n 
A 1 15  ASP 15  64  64  ASP ASP A . n 
A 1 16  CAF 16  65  65  CAF CAF A . n 
A 1 17  THR 17  66  66  THR THR A . n 
A 1 18  HIS 18  67  67  HIS HIS A . n 
A 1 19  LEU 19  68  68  LEU LEU A . n 
A 1 20  GLU 20  69  69  GLU GLU A . n 
A 1 21  GLY 21  70  70  GLY GLY A . n 
A 1 22  LYS 22  71  71  LYS LYS A . n 
A 1 23  VAL 23  72  72  VAL VAL A . n 
A 1 24  ILE 24  73  73  ILE ILE A . n 
A 1 25  LEU 25  74  74  LEU LEU A . n 
A 1 26  VAL 26  75  75  VAL VAL A . n 
A 1 27  ALA 27  76  76  ALA ALA A . n 
A 1 28  VAL 28  77  77  VAL VAL A . n 
A 1 29  HIS 29  78  78  HIS HIS A . n 
A 1 30  VAL 30  79  79  VAL VAL A . n 
A 1 31  ALA 31  80  80  ALA ALA A . n 
A 1 32  SER 32  81  81  SER SER A . n 
A 1 33  GLY 33  82  82  GLY GLY A . n 
A 1 34  TYR 34  83  83  TYR TYR A . n 
A 1 35  ILE 35  84  84  ILE ILE A . n 
A 1 36  GLU 36  85  85  GLU GLU A . n 
A 1 37  ALA 37  86  86  ALA ALA A . n 
A 1 38  GLU 38  87  87  GLU GLU A . n 
A 1 39  VAL 39  88  88  VAL VAL A . n 
A 1 40  ILE 40  89  89  ILE ILE A . n 
A 1 41  PRO 41  90  90  PRO PRO A . n 
A 1 42  ALA 42  91  91  ALA ALA A . n 
A 1 43  GLU 43  92  92  GLU GLU A . n 
A 1 44  THR 44  93  93  THR THR A . n 
A 1 45  GLY 45  94  94  GLY GLY A . n 
A 1 46  GLN 46  95  95  GLN GLN A . n 
A 1 47  GLU 47  96  96  GLU GLU A . n 
A 1 48  THR 48  97  97  THR THR A . n 
A 1 49  ALA 49  98  98  ALA ALA A . n 
A 1 50  TYR 50  99  99  TYR TYR A . n 
A 1 51  PHE 51  100 100 PHE PHE A . n 
A 1 52  LEU 52  101 101 LEU LEU A . n 
A 1 53  LEU 53  102 102 LEU LEU A . n 
A 1 54  LYS 54  103 103 LYS LYS A . n 
A 1 55  LEU 55  104 104 LEU LEU A . n 
A 1 56  ALA 56  105 105 ALA ALA A . n 
A 1 57  GLY 57  106 106 GLY GLY A . n 
A 1 58  ARG 58  107 107 ARG ARG A . n 
A 1 59  TRP 59  108 108 TRP TRP A . n 
A 1 60  PRO 60  109 109 PRO PRO A . n 
A 1 61  VAL 61  110 110 VAL VAL A . n 
A 1 62  LYS 62  111 111 LYS LYS A . n 
A 1 63  THR 63  112 112 THR THR A . n 
A 1 64  VAL 64  113 113 VAL VAL A . n 
A 1 65  HIS 65  114 114 HIS HIS A . n 
A 1 66  THR 66  115 115 THR THR A . n 
A 1 67  ASP 67  116 116 ASP ASP A . n 
A 1 68  ASN 68  117 117 ASN ASN A . n 
A 1 69  GLY 69  118 118 GLY GLY A . n 
A 1 70  SER 70  119 119 SER SER A . n 
A 1 71  ASN 71  120 120 ASN ASN A . n 
A 1 72  PHE 72  121 121 PHE PHE A . n 
A 1 73  THR 73  122 122 THR THR A . n 
A 1 74  SER 74  123 123 SER SER A . n 
A 1 75  THR 75  124 124 THR THR A . n 
A 1 76  THR 76  125 125 THR THR A . n 
A 1 77  VAL 77  126 126 VAL VAL A . n 
A 1 78  LYS 78  127 127 LYS LYS A . n 
A 1 79  ALA 79  128 128 ALA ALA A . n 
A 1 80  ALA 80  129 129 ALA ALA A . n 
A 1 81  CAF 81  130 130 CAF CAF A . n 
A 1 82  TRP 82  131 131 TRP TRP A . n 
A 1 83  TRP 83  132 132 TRP TRP A . n 
A 1 84  ALA 84  133 133 ALA ALA A . n 
A 1 85  GLY 85  134 134 GLY GLY A . n 
A 1 86  ILE 86  135 135 ILE ILE A . n 
A 1 87  LYS 87  136 136 LYS LYS A . n 
A 1 88  GLN 88  137 137 GLN GLN A . n 
A 1 89  GLU 89  138 138 GLU GLU A . n 
A 1 90  PHE 90  139 139 PHE PHE A . n 
A 1 91  GLY 91  140 140 GLY GLY A . n 
A 1 92  ILE 92  141 141 ILE ILE A . n 
A 1 93  PRO 93  142 142 PRO PRO A . n 
A 1 94  TYR 94  143 ?   ?   ?   A . n 
A 1 95  ASN 95  144 ?   ?   ?   A . n 
A 1 96  PRO 96  145 ?   ?   ?   A . n 
A 1 97  GLN 97  146 ?   ?   ?   A . n 
A 1 98  SER 98  147 ?   ?   ?   A . n 
A 1 99  GLN 99  148 ?   ?   ?   A . n 
A 1 100 GLY 100 149 149 GLY GLY A . n 
A 1 101 VAL 101 150 150 VAL VAL A . n 
A 1 102 ILE 102 151 151 ILE ILE A . n 
A 1 103 GLU 103 152 152 GLU GLU A . n 
A 1 104 SER 104 153 153 SER SER A . n 
A 1 105 MET 105 154 154 MET MET A . n 
A 1 106 ASN 106 155 155 ASN ASN A . n 
A 1 107 LYS 107 156 156 LYS LYS A . n 
A 1 108 GLU 108 157 157 GLU GLU A . n 
A 1 109 LEU 109 158 158 LEU LEU A . n 
A 1 110 LYS 110 159 159 LYS LYS A . n 
A 1 111 LYS 111 160 160 LYS LYS A . n 
A 1 112 ILE 112 161 161 ILE ILE A . n 
A 1 113 ILE 113 162 162 ILE ILE A . n 
A 1 114 GLY 114 163 163 GLY GLY A . n 
A 1 115 GLN 115 164 164 GLN GLN A . n 
A 1 116 VAL 116 165 165 VAL VAL A . n 
A 1 117 ARG 117 166 166 ARG ARG A . n 
A 1 118 ASP 118 167 167 ASP ASP A . n 
A 1 119 GLN 119 168 168 GLN GLN A . n 
A 1 120 ALA 120 169 169 ALA ALA A . n 
A 1 121 GLU 121 170 170 GLU GLU A . n 
A 1 122 HIS 122 171 171 HIS HIS A . n 
A 1 123 LEU 123 172 172 LEU LEU A . n 
A 1 124 LYS 124 173 173 LYS LYS A . n 
A 1 125 THR 125 174 174 THR THR A . n 
A 1 126 ALA 126 175 175 ALA ALA A . n 
A 1 127 VAL 127 176 176 VAL VAL A . n 
A 1 128 GLN 128 177 177 GLN GLN A . n 
A 1 129 MET 129 178 178 MET MET A . n 
A 1 130 ALA 130 179 179 ALA ALA A . n 
A 1 131 VAL 131 180 180 VAL VAL A . n 
A 1 132 PHE 132 181 181 PHE PHE A . n 
A 1 133 ILE 133 182 182 ILE ILE A . n 
A 1 134 HIS 134 183 183 HIS HIS A . n 
A 1 135 ASN 135 184 184 ASN ASN A . n 
A 1 136 LYS 136 185 185 LYS LYS A . n 
A 1 137 LYS 137 186 186 LYS LYS A . n 
A 1 138 ARG 138 187 187 ARG ARG A . n 
A 1 139 LYS 139 188 188 LYS LYS A . n 
A 1 140 GLY 140 189 ?   ?   ?   A . n 
A 1 141 GLY 141 190 ?   ?   ?   A . n 
A 1 142 ILE 142 191 ?   ?   ?   A . n 
A 1 143 GLY 143 192 ?   ?   ?   A . n 
A 1 144 GLY 144 193 193 GLY GLY A . n 
A 1 145 TYR 145 194 194 TYR TYR A . n 
A 1 146 SER 146 195 195 SER SER A . n 
A 1 147 ALA 147 196 196 ALA ALA A . n 
A 1 148 GLY 148 197 197 GLY GLY A . n 
A 1 149 GLU 149 198 198 GLU GLU A . n 
A 1 150 ARG 150 199 199 ARG ARG A . n 
A 1 151 ILE 151 200 200 ILE ILE A . n 
A 1 152 VAL 152 201 201 VAL VAL A . n 
A 1 153 ASP 153 202 202 ASP ASP A . n 
A 1 154 ILE 154 203 203 ILE ILE A . n 
A 1 155 ILE 155 204 204 ILE ILE A . n 
A 1 156 ALA 156 205 205 ALA ALA A . n 
A 1 157 THR 157 206 206 THR THR A . n 
A 1 158 ASP 158 207 207 ASP ASP A . n 
A 1 159 ILE 159 208 208 ILE ILE A . n 
A 1 160 GLN 160 209 209 GLN GLN A . n 
A 1 161 THR 161 210 210 THR THR A . n 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        L3D 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   L3D 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 L3D 1  301 300 L3D L3D A . 
C 3 EDO 1  302 401 EDO EDO A . 
D 4 SO4 1  303 501 SO4 SO4 A . 
E 5 HOH 1  401 15  HOH HOH A . 
E 5 HOH 2  402 13  HOH HOH A . 
E 5 HOH 3  403 12  HOH HOH A . 
E 5 HOH 4  404 5   HOH HOH A . 
E 5 HOH 5  405 24  HOH HOH A . 
E 5 HOH 6  406 8   HOH HOH A . 
E 5 HOH 7  407 2   HOH HOH A . 
E 5 HOH 8  408 22  HOH HOH A . 
E 5 HOH 9  409 1   HOH HOH A . 
E 5 HOH 10 410 7   HOH HOH A . 
E 5 HOH 11 411 16  HOH HOH A . 
E 5 HOH 12 412 3   HOH HOH A . 
E 5 HOH 13 413 4   HOH HOH A . 
E 5 HOH 14 414 18  HOH HOH A . 
E 5 HOH 15 415 17  HOH HOH A . 
E 5 HOH 16 416 11  HOH HOH A . 
E 5 HOH 17 417 6   HOH HOH A . 
E 5 HOH 18 418 9   HOH HOH A . 
E 5 HOH 19 419 19  HOH HOH A . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A CAF 65  ? CE2 ? A CAF 16 CE2 
2 1 Y 1 A CAF 130 ? CE2 ? A CAF 81 CE2 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.0         1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .           2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .           3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1.3660 4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     8CT7 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     72.486 
_cell.length_a_esd                 ? 
_cell.length_b                     72.486 
_cell.length_b_esd                 ? 
_cell.length_c                     66.454 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
_cell.pdbx_esd_method              ? 
# 
_symmetry.entry_id                         8CT7 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   8CT7 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                       ? 
_exptl_crystal.density_diffrn               ? 
_exptl_crystal.density_Matthews             2.82 
_exptl_crystal.density_method               ? 
_exptl_crystal.density_percent_sol          56.33 
_exptl_crystal.description                  ? 
_exptl_crystal.F_000                        ? 
_exptl_crystal.id                           1 
_exptl_crystal.preparation                  ? 
_exptl_crystal.size_max                     ? 
_exptl_crystal.size_mid                     ? 
_exptl_crystal.size_min                     ? 
_exptl_crystal.size_rad                     ? 
_exptl_crystal.colour_lustre                ? 
_exptl_crystal.colour_modifier              ? 
_exptl_crystal.colour_primary               ? 
_exptl_crystal.density_meas                 ? 
_exptl_crystal.density_meas_esd             ? 
_exptl_crystal.density_meas_gt              ? 
_exptl_crystal.density_meas_lt              ? 
_exptl_crystal.density_meas_temp            ? 
_exptl_crystal.density_meas_temp_esd        ? 
_exptl_crystal.density_meas_temp_gt         ? 
_exptl_crystal.density_meas_temp_lt         ? 
_exptl_crystal.pdbx_crystal_image_url       ? 
_exptl_crystal.pdbx_crystal_image_format    ? 
_exptl_crystal.pdbx_mosaicity               ? 
_exptl_crystal.pdbx_mosaicity_esd           ? 
_exptl_crystal.pdbx_mosaic_method           ? 
_exptl_crystal.pdbx_mosaic_block_size       ? 
_exptl_crystal.pdbx_mosaic_block_size_esd   ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;7% PEG 8000, 0.2 M ammonium sulfate, 0.1 M sodium cacodylate, pH 6.5, 5 mM manganese chloride, 5 mM magnesium chloride, and 5 mM DTT
;
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.temp            293.15 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER2 X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-10-13 
_diffrn_detector.pdbx_frequency               ? 
_diffrn_detector.id                           ? 
_diffrn_detector.number_of_axes               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.92 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_synchrotron_site       CHESS 
# 
_reflns.B_iso_Wilson_estimate                          44.8 
_reflns.entry_id                                       8CT7 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              2.13 
_reflns.d_resolution_low                               29.38 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     11625 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           99.9 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                2.0 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          29.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                0.024 
_reflns.pdbx_Rpim_I_all                                0.017 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   1 
_reflns.pdbx_CC_star                                   1 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_Rmerge_I_obs                              0.017 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_CC_split_method                           ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
# 
_reflns_shell.d_res_high                                    2.13 
_reflns_shell.d_res_low                                     2.206 
_reflns_shell.meanI_over_sigI_all                           ? 
_reflns_shell.meanI_over_sigI_obs                           ? 
_reflns_shell.number_measured_all                           ? 
_reflns_shell.number_measured_obs                           ? 
_reflns_shell.number_possible                               ? 
_reflns_shell.number_unique_all                             ? 
_reflns_shell.number_unique_obs                             1133 
_reflns_shell.percent_possible_obs                          ? 
_reflns_shell.Rmerge_F_all                                  ? 
_reflns_shell.Rmerge_F_obs                                  ? 
_reflns_shell.meanI_over_sigI_gt                            ? 
_reflns_shell.meanI_over_uI_all                             ? 
_reflns_shell.meanI_over_uI_gt                              ? 
_reflns_shell.number_measured_gt                            ? 
_reflns_shell.number_unique_gt                              ? 
_reflns_shell.percent_possible_gt                           ? 
_reflns_shell.Rmerge_F_gt                                   ? 
_reflns_shell.Rmerge_I_gt                                   ? 
_reflns_shell.pdbx_redundancy                               2 
_reflns_shell.pdbx_chi_squared                              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all                     ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs                     ? 
_reflns_shell.pdbx_Rrim_I_all                               0.024 
_reflns_shell.pdbx_Rpim_I_all                               0.017 
_reflns_shell.pdbx_rejects                                  ? 
_reflns_shell.pdbx_ordinal                                  1 
_reflns_shell.pdbx_diffrn_id                                1 
_reflns_shell.pdbx_CC_half                                  0.927 
_reflns_shell.pdbx_CC_star                                  0.981 
_reflns_shell.pdbx_R_split                                  ? 
_reflns_shell.percent_possible_all                          100 
_reflns_shell.Rmerge_I_all                                  ? 
_reflns_shell.Rmerge_I_obs                                  0.160 
_reflns_shell.pdbx_Rsym_value                               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal             ? 
_reflns_shell.pdbx_percent_possible_spherical               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous   ? 
_reflns_shell.pdbx_percent_possible_spherical_anomalous     ? 
_reflns_shell.pdbx_redundancy_anomalous                     ? 
_reflns_shell.pdbx_CC_half_anomalous                        ? 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous             ? 
_reflns_shell.pdbx_percent_possible_anomalous               ? 
# 
_refine.aniso_B[1][1]                            -0.07 
_refine.aniso_B[1][2]                            -0.03 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][2]                            -0.07 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            0.22 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               50.584 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 8CT7 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.13 
_refine.ls_d_res_low                             29.38 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     10468 
_refine.ls_number_reflns_R_free                  1180 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.70 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.20017 
_refine.ls_R_factor_R_free                       0.22485 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.19729 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3L3U 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.200 
_refine.pdbx_overall_ESU_R_Free                  0.168 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             4.380 
_refine.overall_SU_ML                            0.114 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.13 
_refine_hist.d_res_low                        29.38 
_refine_hist.number_atoms_solvent             19 
_refine_hist.number_atoms_total               1199 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        1138 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         42 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
_struct.entry_id                     8CT7 
_struct.title                        'Catalytic Core Domain of HIV-1 Integrase (F185K) bound with BI-224436' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        8CT7 
_struct_keywords.text            
'VIRAL DNA INTEGRATION, DNA BINDING, LEDGF BINDING, VIRAL PROTEIN, VIRAL PROTEIN-INHIBITOR complex' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN/INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q72498_9HIV1 
_struct_ref.pdbx_db_accession          Q72498 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA
CWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQ
T
;
_struct_ref.pdbx_align_begin           765 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              8CT7 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 161 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q72498 
_struct_ref_seq.db_align_beg                  765 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  925 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       50 
_struct_ref_seq.pdbx_auth_seq_align_end       210 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             8CT7 
_struct_ref_seq_dif.mon_id                       LYS 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      136 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q72498 
_struct_ref_seq_dif.db_mon_id                    PHE 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          900 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            185 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4310  ? 
1 MORE         -43   ? 
1 'SSA (A^2)'  13220 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'equilibrium centrifugation' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 5_555 x-y,-y,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 44.3026666667 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 THR A 44  ? TRP A 59  ? THR A 93  TRP A 108 1 ? 16 
HELX_P HELX_P2 AA2 ASN A 68  ? THR A 73  ? ASN A 117 THR A 122 5 ? 6  
HELX_P HELX_P3 AA3 SER A 74  ? GLY A 85  ? SER A 123 GLY A 134 1 ? 12 
HELX_P HELX_P4 AA4 VAL A 101 ? ARG A 117 ? VAL A 150 ARG A 166 1 ? 17 
HELX_P HELX_P5 AA5 ASP A 118 ? ALA A 120 ? ASP A 167 ALA A 169 5 ? 3  
HELX_P HELX_P6 AA6 HIS A 122 ? LYS A 137 ? HIS A 171 LYS A 186 1 ? 16 
HELX_P HELX_P7 AA7 SER A 146 ? THR A 161 ? SER A 195 THR A 210 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A ASP 15 C ? ? ? 1_555 A CAF 16 N ? ? A ASP 64  A CAF 65  1_555 ? ? ? ? ? ? ? 1.336 ? ? 
covale2 covale both ? A CAF 16 C ? ? ? 1_555 A THR 17 N ? ? A CAF 65  A THR 66  1_555 ? ? ? ? ? ? ? 1.340 ? ? 
covale3 covale both ? A ALA 80 C ? ? ? 1_555 A CAF 81 N ? ? A ALA 129 A CAF 130 1_555 ? ? ? ? ? ? ? 1.337 ? ? 
covale4 covale both ? A CAF 81 C ? ? ? 1_555 A TRP 82 N ? ? A CAF 130 A TRP 131 1_555 ? ? ? ? ? ? ? 1.338 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 CAF A 16 ? . . . . CAF A 65  ? 1_555 . . . . . . . CYS 1 CAF None 'Non-standard residue' 
2 CAF A 81 ? . . . . CAF A 130 ? 1_555 . . . . . . . CYS 1 CAF None 'Non-standard residue' 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 35 ? ILE A 40 ? ILE A 84  ILE A 89  
AA1 2 LYS A 22 ? HIS A 29 ? LYS A 71  HIS A 78  
AA1 3 ILE A 11 ? LEU A 19 ? ILE A 60  LEU A 68  
AA1 4 THR A 63 ? HIS A 65 ? THR A 112 HIS A 114 
AA1 5 LYS A 87 ? GLN A 88 ? LYS A 136 GLN A 137 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLU A 36 ? O GLU A 85  N ALA A 27 ? N ALA A 76  
AA1 2 3 O VAL A 26 ? O VAL A 75  N ASP A 15 ? N ASP A 64  
AA1 3 4 N LEU A 14 ? N LEU A 63  O HIS A 65 ? O HIS A 114 
AA1 4 5 N VAL A 64 ? N VAL A 113 O LYS A 87 ? O LYS A 136 
# 
_pdbx_entry_details.entry_id                   8CT7 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.has_ligand_of_interest     Y 
_pdbx_entry_details.has_protein_modification   Y 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ILE 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     141 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             54.32 
_pdbx_validate_torsion.psi             75.07 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     107 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.096 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A CAF 16 A CAF 65  ? CYS 'modified residue' 
2 A CAF 81 A CAF 130 ? CYS 'modified residue' 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z          
2 -y,x-y,z+1/3   
3 -x+y,-x,z+2/3  
4 x-y,-y,-z+2/3  
5 -x,-x+y,-z+1/3 
6 y,x,-z         
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 50  ? A MET 1   
2  1 Y 1 A HIS 51  ? A HIS 2   
3  1 Y 1 A GLY 52  ? A GLY 3   
4  1 Y 1 A GLN 53  ? A GLN 4   
5  1 Y 1 A VAL 54  ? A VAL 5   
6  1 Y 1 A TYR 143 ? A TYR 94  
7  1 Y 1 A ASN 144 ? A ASN 95  
8  1 Y 1 A PRO 145 ? A PRO 96  
9  1 Y 1 A GLN 146 ? A GLN 97  
10 1 Y 1 A SER 147 ? A SER 98  
11 1 Y 1 A GLN 148 ? A GLN 99  
12 1 Y 1 A GLY 189 ? A GLY 140 
13 1 Y 1 A GLY 190 ? A GLY 141 
14 1 Y 1 A ILE 191 ? A ILE 142 
15 1 Y 1 A GLY 192 ? A GLY 143 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CAF N    N  N N 74  
CAF CA   C  N R 75  
CAF CB   C  N N 76  
CAF C    C  N N 77  
CAF O    O  N N 78  
CAF OXT  O  N N 79  
CAF SG   S  N N 80  
CAF AS   AS N N 81  
CAF CE1  C  N N 82  
CAF CE2  C  N N 83  
CAF O1   O  N N 84  
CAF H    H  N N 85  
CAF H2   H  N N 86  
CAF HA   H  N N 87  
CAF HB2  H  N N 88  
CAF HB3  H  N N 89  
CAF HXT  H  N N 90  
CAF HE11 H  N N 91  
CAF HE12 H  N N 92  
CAF HE13 H  N N 93  
CAF HE21 H  N N 94  
CAF HE22 H  N N 95  
CAF HE23 H  N N 96  
CYS N    N  N N 97  
CYS CA   C  N R 98  
CYS C    C  N N 99  
CYS O    O  N N 100 
CYS CB   C  N N 101 
CYS SG   S  N N 102 
CYS OXT  O  N N 103 
CYS H    H  N N 104 
CYS H2   H  N N 105 
CYS HA   H  N N 106 
CYS HB2  H  N N 107 
CYS HB3  H  N N 108 
CYS HG   H  N N 109 
CYS HXT  H  N N 110 
EDO C1   C  N N 111 
EDO O1   O  N N 112 
EDO C2   C  N N 113 
EDO O2   O  N N 114 
EDO H11  H  N N 115 
EDO H12  H  N N 116 
EDO HO1  H  N N 117 
EDO H21  H  N N 118 
EDO H22  H  N N 119 
EDO HO2  H  N N 120 
GLN N    N  N N 121 
GLN CA   C  N S 122 
GLN C    C  N N 123 
GLN O    O  N N 124 
GLN CB   C  N N 125 
GLN CG   C  N N 126 
GLN CD   C  N N 127 
GLN OE1  O  N N 128 
GLN NE2  N  N N 129 
GLN OXT  O  N N 130 
GLN H    H  N N 131 
GLN H2   H  N N 132 
GLN HA   H  N N 133 
GLN HB2  H  N N 134 
GLN HB3  H  N N 135 
GLN HG2  H  N N 136 
GLN HG3  H  N N 137 
GLN HE21 H  N N 138 
GLN HE22 H  N N 139 
GLN HXT  H  N N 140 
GLU N    N  N N 141 
GLU CA   C  N S 142 
GLU C    C  N N 143 
GLU O    O  N N 144 
GLU CB   C  N N 145 
GLU CG   C  N N 146 
GLU CD   C  N N 147 
GLU OE1  O  N N 148 
GLU OE2  O  N N 149 
GLU OXT  O  N N 150 
GLU H    H  N N 151 
GLU H2   H  N N 152 
GLU HA   H  N N 153 
GLU HB2  H  N N 154 
GLU HB3  H  N N 155 
GLU HG2  H  N N 156 
GLU HG3  H  N N 157 
GLU HE2  H  N N 158 
GLU HXT  H  N N 159 
GLY N    N  N N 160 
GLY CA   C  N N 161 
GLY C    C  N N 162 
GLY O    O  N N 163 
GLY OXT  O  N N 164 
GLY H    H  N N 165 
GLY H2   H  N N 166 
GLY HA2  H  N N 167 
GLY HA3  H  N N 168 
GLY HXT  H  N N 169 
HIS N    N  N N 170 
HIS CA   C  N S 171 
HIS C    C  N N 172 
HIS O    O  N N 173 
HIS CB   C  N N 174 
HIS CG   C  Y N 175 
HIS ND1  N  Y N 176 
HIS CD2  C  Y N 177 
HIS CE1  C  Y N 178 
HIS NE2  N  Y N 179 
HIS OXT  O  N N 180 
HIS H    H  N N 181 
HIS H2   H  N N 182 
HIS HA   H  N N 183 
HIS HB2  H  N N 184 
HIS HB3  H  N N 185 
HIS HD1  H  N N 186 
HIS HD2  H  N N 187 
HIS HE1  H  N N 188 
HIS HE2  H  N N 189 
HIS HXT  H  N N 190 
HOH O    O  N N 191 
HOH H1   H  N N 192 
HOH H2   H  N N 193 
ILE N    N  N N 194 
ILE CA   C  N S 195 
ILE C    C  N N 196 
ILE O    O  N N 197 
ILE CB   C  N S 198 
ILE CG1  C  N N 199 
ILE CG2  C  N N 200 
ILE CD1  C  N N 201 
ILE OXT  O  N N 202 
ILE H    H  N N 203 
ILE H2   H  N N 204 
ILE HA   H  N N 205 
ILE HB   H  N N 206 
ILE HG12 H  N N 207 
ILE HG13 H  N N 208 
ILE HG21 H  N N 209 
ILE HG22 H  N N 210 
ILE HG23 H  N N 211 
ILE HD11 H  N N 212 
ILE HD12 H  N N 213 
ILE HD13 H  N N 214 
ILE HXT  H  N N 215 
L3D C01  C  N N 216 
L3D C02  C  Y N 217 
L3D C03  C  Y N 218 
L3D C04  C  N S 219 
L3D C05  C  N N 220 
L3D O06  O  N N 221 
L3D O07  O  N N 222 
L3D O08  O  N N 223 
L3D C09  C  N N 224 
L3D C10  C  N N 225 
L3D C11  C  N N 226 
L3D C12  C  N N 227 
L3D C13  C  Y N 228 
L3D C14  C  Y N 229 
L3D C15  C  Y N 230 
L3D C16  C  Y N 231 
L3D C17  C  Y N 232 
L3D C18  C  Y N 233 
L3D C19  C  Y N 234 
L3D N20  N  Y N 235 
L3D C21  C  Y N 236 
L3D C22  C  Y N 237 
L3D C23  C  Y N 238 
L3D C24  C  N N 239 
L3D C25  C  N N 240 
L3D O26  O  N N 241 
L3D C27  C  Y N 242 
L3D C28  C  Y N 243 
L3D C29  C  Y N 244 
L3D C30  C  Y N 245 
L3D C31  C  Y N 246 
L3D C32  C  Y N 247 
L3D N33  N  Y N 248 
L3D H1   H  N N 249 
L3D H2   H  N N 250 
L3D H3   H  N N 251 
L3D H4   H  N N 252 
L3D H5   H  N N 253 
L3D H6   H  N N 254 
L3D H7   H  N N 255 
L3D H8   H  N N 256 
L3D H9   H  N N 257 
L3D H10  H  N N 258 
L3D H11  H  N N 259 
L3D H12  H  N N 260 
L3D H13  H  N N 261 
L3D H14  H  N N 262 
L3D H15  H  N N 263 
L3D H16  H  N N 264 
L3D H17  H  N N 265 
L3D H18  H  N N 266 
L3D H19  H  N N 267 
L3D H20  H  N N 268 
L3D H21  H  N N 269 
L3D H22  H  N N 270 
L3D H23  H  N N 271 
L3D H24  H  N N 272 
L3D H25  H  N N 273 
L3D H26  H  N N 274 
LEU N    N  N N 275 
LEU CA   C  N S 276 
LEU C    C  N N 277 
LEU O    O  N N 278 
LEU CB   C  N N 279 
LEU CG   C  N N 280 
LEU CD1  C  N N 281 
LEU CD2  C  N N 282 
LEU OXT  O  N N 283 
LEU H    H  N N 284 
LEU H2   H  N N 285 
LEU HA   H  N N 286 
LEU HB2  H  N N 287 
LEU HB3  H  N N 288 
LEU HG   H  N N 289 
LEU HD11 H  N N 290 
LEU HD12 H  N N 291 
LEU HD13 H  N N 292 
LEU HD21 H  N N 293 
LEU HD22 H  N N 294 
LEU HD23 H  N N 295 
LEU HXT  H  N N 296 
LYS N    N  N N 297 
LYS CA   C  N S 298 
LYS C    C  N N 299 
LYS O    O  N N 300 
LYS CB   C  N N 301 
LYS CG   C  N N 302 
LYS CD   C  N N 303 
LYS CE   C  N N 304 
LYS NZ   N  N N 305 
LYS OXT  O  N N 306 
LYS H    H  N N 307 
LYS H2   H  N N 308 
LYS HA   H  N N 309 
LYS HB2  H  N N 310 
LYS HB3  H  N N 311 
LYS HG2  H  N N 312 
LYS HG3  H  N N 313 
LYS HD2  H  N N 314 
LYS HD3  H  N N 315 
LYS HE2  H  N N 316 
LYS HE3  H  N N 317 
LYS HZ1  H  N N 318 
LYS HZ2  H  N N 319 
LYS HZ3  H  N N 320 
LYS HXT  H  N N 321 
MET N    N  N N 322 
MET CA   C  N S 323 
MET C    C  N N 324 
MET O    O  N N 325 
MET CB   C  N N 326 
MET CG   C  N N 327 
MET SD   S  N N 328 
MET CE   C  N N 329 
MET OXT  O  N N 330 
MET H    H  N N 331 
MET H2   H  N N 332 
MET HA   H  N N 333 
MET HB2  H  N N 334 
MET HB3  H  N N 335 
MET HG2  H  N N 336 
MET HG3  H  N N 337 
MET HE1  H  N N 338 
MET HE2  H  N N 339 
MET HE3  H  N N 340 
MET HXT  H  N N 341 
PHE N    N  N N 342 
PHE CA   C  N S 343 
PHE C    C  N N 344 
PHE O    O  N N 345 
PHE CB   C  N N 346 
PHE CG   C  Y N 347 
PHE CD1  C  Y N 348 
PHE CD2  C  Y N 349 
PHE CE1  C  Y N 350 
PHE CE2  C  Y N 351 
PHE CZ   C  Y N 352 
PHE OXT  O  N N 353 
PHE H    H  N N 354 
PHE H2   H  N N 355 
PHE HA   H  N N 356 
PHE HB2  H  N N 357 
PHE HB3  H  N N 358 
PHE HD1  H  N N 359 
PHE HD2  H  N N 360 
PHE HE1  H  N N 361 
PHE HE2  H  N N 362 
PHE HZ   H  N N 363 
PHE HXT  H  N N 364 
PRO N    N  N N 365 
PRO CA   C  N S 366 
PRO C    C  N N 367 
PRO O    O  N N 368 
PRO CB   C  N N 369 
PRO CG   C  N N 370 
PRO CD   C  N N 371 
PRO OXT  O  N N 372 
PRO H    H  N N 373 
PRO HA   H  N N 374 
PRO HB2  H  N N 375 
PRO HB3  H  N N 376 
PRO HG2  H  N N 377 
PRO HG3  H  N N 378 
PRO HD2  H  N N 379 
PRO HD3  H  N N 380 
PRO HXT  H  N N 381 
SER N    N  N N 382 
SER CA   C  N S 383 
SER C    C  N N 384 
SER O    O  N N 385 
SER CB   C  N N 386 
SER OG   O  N N 387 
SER OXT  O  N N 388 
SER H    H  N N 389 
SER H2   H  N N 390 
SER HA   H  N N 391 
SER HB2  H  N N 392 
SER HB3  H  N N 393 
SER HG   H  N N 394 
SER HXT  H  N N 395 
SO4 S    S  N N 396 
SO4 O1   O  N N 397 
SO4 O2   O  N N 398 
SO4 O3   O  N N 399 
SO4 O4   O  N N 400 
THR N    N  N N 401 
THR CA   C  N S 402 
THR C    C  N N 403 
THR O    O  N N 404 
THR CB   C  N R 405 
THR OG1  O  N N 406 
THR CG2  C  N N 407 
THR OXT  O  N N 408 
THR H    H  N N 409 
THR H2   H  N N 410 
THR HA   H  N N 411 
THR HB   H  N N 412 
THR HG1  H  N N 413 
THR HG21 H  N N 414 
THR HG22 H  N N 415 
THR HG23 H  N N 416 
THR HXT  H  N N 417 
TRP N    N  N N 418 
TRP CA   C  N S 419 
TRP C    C  N N 420 
TRP O    O  N N 421 
TRP CB   C  N N 422 
TRP CG   C  Y N 423 
TRP CD1  C  Y N 424 
TRP CD2  C  Y N 425 
TRP NE1  N  Y N 426 
TRP CE2  C  Y N 427 
TRP CE3  C  Y N 428 
TRP CZ2  C  Y N 429 
TRP CZ3  C  Y N 430 
TRP CH2  C  Y N 431 
TRP OXT  O  N N 432 
TRP H    H  N N 433 
TRP H2   H  N N 434 
TRP HA   H  N N 435 
TRP HB2  H  N N 436 
TRP HB3  H  N N 437 
TRP HD1  H  N N 438 
TRP HE1  H  N N 439 
TRP HE3  H  N N 440 
TRP HZ2  H  N N 441 
TRP HZ3  H  N N 442 
TRP HH2  H  N N 443 
TRP HXT  H  N N 444 
TYR N    N  N N 445 
TYR CA   C  N S 446 
TYR C    C  N N 447 
TYR O    O  N N 448 
TYR CB   C  N N 449 
TYR CG   C  Y N 450 
TYR CD1  C  Y N 451 
TYR CD2  C  Y N 452 
TYR CE1  C  Y N 453 
TYR CE2  C  Y N 454 
TYR CZ   C  Y N 455 
TYR OH   O  N N 456 
TYR OXT  O  N N 457 
TYR H    H  N N 458 
TYR H2   H  N N 459 
TYR HA   H  N N 460 
TYR HB2  H  N N 461 
TYR HB3  H  N N 462 
TYR HD1  H  N N 463 
TYR HD2  H  N N 464 
TYR HE1  H  N N 465 
TYR HE2  H  N N 466 
TYR HH   H  N N 467 
TYR HXT  H  N N 468 
VAL N    N  N N 469 
VAL CA   C  N S 470 
VAL C    C  N N 471 
VAL O    O  N N 472 
VAL CB   C  N N 473 
VAL CG1  C  N N 474 
VAL CG2  C  N N 475 
VAL OXT  O  N N 476 
VAL H    H  N N 477 
VAL H2   H  N N 478 
VAL HA   H  N N 479 
VAL HB   H  N N 480 
VAL HG11 H  N N 481 
VAL HG12 H  N N 482 
VAL HG13 H  N N 483 
VAL HG21 H  N N 484 
VAL HG22 H  N N 485 
VAL HG23 H  N N 486 
VAL HXT  H  N N 487 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CAF N   CA   sing N N 70  
CAF N   H    sing N N 71  
CAF N   H2   sing N N 72  
CAF CA  CB   sing N N 73  
CAF CA  C    sing N N 74  
CAF CA  HA   sing N N 75  
CAF CB  SG   sing N N 76  
CAF CB  HB2  sing N N 77  
CAF CB  HB3  sing N N 78  
CAF C   O    doub N N 79  
CAF C   OXT  sing N N 80  
CAF OXT HXT  sing N N 81  
CAF SG  AS   sing N N 82  
CAF AS  CE1  sing N N 83  
CAF AS  CE2  sing N N 84  
CAF AS  O1   doub N N 85  
CAF CE1 HE11 sing N N 86  
CAF CE1 HE12 sing N N 87  
CAF CE1 HE13 sing N N 88  
CAF CE2 HE21 sing N N 89  
CAF CE2 HE22 sing N N 90  
CAF CE2 HE23 sing N N 91  
CYS N   CA   sing N N 92  
CYS N   H    sing N N 93  
CYS N   H2   sing N N 94  
CYS CA  C    sing N N 95  
CYS CA  CB   sing N N 96  
CYS CA  HA   sing N N 97  
CYS C   O    doub N N 98  
CYS C   OXT  sing N N 99  
CYS CB  SG   sing N N 100 
CYS CB  HB2  sing N N 101 
CYS CB  HB3  sing N N 102 
CYS SG  HG   sing N N 103 
CYS OXT HXT  sing N N 104 
EDO C1  O1   sing N N 105 
EDO C1  C2   sing N N 106 
EDO C1  H11  sing N N 107 
EDO C1  H12  sing N N 108 
EDO O1  HO1  sing N N 109 
EDO C2  O2   sing N N 110 
EDO C2  H21  sing N N 111 
EDO C2  H22  sing N N 112 
EDO O2  HO2  sing N N 113 
GLN N   CA   sing N N 114 
GLN N   H    sing N N 115 
GLN N   H2   sing N N 116 
GLN CA  C    sing N N 117 
GLN CA  CB   sing N N 118 
GLN CA  HA   sing N N 119 
GLN C   O    doub N N 120 
GLN C   OXT  sing N N 121 
GLN CB  CG   sing N N 122 
GLN CB  HB2  sing N N 123 
GLN CB  HB3  sing N N 124 
GLN CG  CD   sing N N 125 
GLN CG  HG2  sing N N 126 
GLN CG  HG3  sing N N 127 
GLN CD  OE1  doub N N 128 
GLN CD  NE2  sing N N 129 
GLN NE2 HE21 sing N N 130 
GLN NE2 HE22 sing N N 131 
GLN OXT HXT  sing N N 132 
GLU N   CA   sing N N 133 
GLU N   H    sing N N 134 
GLU N   H2   sing N N 135 
GLU CA  C    sing N N 136 
GLU CA  CB   sing N N 137 
GLU CA  HA   sing N N 138 
GLU C   O    doub N N 139 
GLU C   OXT  sing N N 140 
GLU CB  CG   sing N N 141 
GLU CB  HB2  sing N N 142 
GLU CB  HB3  sing N N 143 
GLU CG  CD   sing N N 144 
GLU CG  HG2  sing N N 145 
GLU CG  HG3  sing N N 146 
GLU CD  OE1  doub N N 147 
GLU CD  OE2  sing N N 148 
GLU OE2 HE2  sing N N 149 
GLU OXT HXT  sing N N 150 
GLY N   CA   sing N N 151 
GLY N   H    sing N N 152 
GLY N   H2   sing N N 153 
GLY CA  C    sing N N 154 
GLY CA  HA2  sing N N 155 
GLY CA  HA3  sing N N 156 
GLY C   O    doub N N 157 
GLY C   OXT  sing N N 158 
GLY OXT HXT  sing N N 159 
HIS N   CA   sing N N 160 
HIS N   H    sing N N 161 
HIS N   H2   sing N N 162 
HIS CA  C    sing N N 163 
HIS CA  CB   sing N N 164 
HIS CA  HA   sing N N 165 
HIS C   O    doub N N 166 
HIS C   OXT  sing N N 167 
HIS CB  CG   sing N N 168 
HIS CB  HB2  sing N N 169 
HIS CB  HB3  sing N N 170 
HIS CG  ND1  sing Y N 171 
HIS CG  CD2  doub Y N 172 
HIS ND1 CE1  doub Y N 173 
HIS ND1 HD1  sing N N 174 
HIS CD2 NE2  sing Y N 175 
HIS CD2 HD2  sing N N 176 
HIS CE1 NE2  sing Y N 177 
HIS CE1 HE1  sing N N 178 
HIS NE2 HE2  sing N N 179 
HIS OXT HXT  sing N N 180 
HOH O   H1   sing N N 181 
HOH O   H2   sing N N 182 
ILE N   CA   sing N N 183 
ILE N   H    sing N N 184 
ILE N   H2   sing N N 185 
ILE CA  C    sing N N 186 
ILE CA  CB   sing N N 187 
ILE CA  HA   sing N N 188 
ILE C   O    doub N N 189 
ILE C   OXT  sing N N 190 
ILE CB  CG1  sing N N 191 
ILE CB  CG2  sing N N 192 
ILE CB  HB   sing N N 193 
ILE CG1 CD1  sing N N 194 
ILE CG1 HG12 sing N N 195 
ILE CG1 HG13 sing N N 196 
ILE CG2 HG21 sing N N 197 
ILE CG2 HG22 sing N N 198 
ILE CG2 HG23 sing N N 199 
ILE CD1 HD11 sing N N 200 
ILE CD1 HD12 sing N N 201 
ILE CD1 HD13 sing N N 202 
ILE OXT HXT  sing N N 203 
L3D C11 C09  sing N N 204 
L3D C12 C09  sing N N 205 
L3D C09 C10  sing N N 206 
L3D C09 O08  sing N N 207 
L3D C15 C16  doub Y N 208 
L3D C15 C14  sing Y N 209 
L3D C16 C17  sing Y N 210 
L3D C30 C29  doub Y N 211 
L3D C30 C31  sing Y N 212 
L3D C29 C28  sing Y N 213 
L3D C31 C32  doub Y N 214 
L3D O08 C04  sing N N 215 
L3D C28 N33  doub Y N 216 
L3D C28 C27  sing Y N 217 
L3D C32 C27  sing Y N 218 
L3D N33 C02  sing Y N 219 
L3D C27 C13  doub Y N 220 
L3D C02 C01  sing N N 221 
L3D C02 C03  doub Y N 222 
L3D C13 C03  sing Y N 223 
L3D C13 C14  sing N N 224 
L3D C03 C04  sing N N 225 
L3D C14 C19  doub Y N 226 
L3D C04 C05  sing N N 227 
L3D C17 O26  sing N N 228 
L3D C17 C18  doub Y N 229 
L3D O26 C25  sing N N 230 
L3D C19 C18  sing Y N 231 
L3D C19 N20  sing Y N 232 
L3D C18 C23  sing Y N 233 
L3D C05 O07  doub N N 234 
L3D C05 O06  sing N N 235 
L3D C25 C24  sing N N 236 
L3D N20 C21  doub Y N 237 
L3D C23 C24  sing N N 238 
L3D C23 C22  doub Y N 239 
L3D C21 C22  sing Y N 240 
L3D C01 H1   sing N N 241 
L3D C01 H2   sing N N 242 
L3D C01 H3   sing N N 243 
L3D C04 H4   sing N N 244 
L3D O06 H5   sing N N 245 
L3D C10 H6   sing N N 246 
L3D C10 H7   sing N N 247 
L3D C10 H8   sing N N 248 
L3D C11 H9   sing N N 249 
L3D C11 H10  sing N N 250 
L3D C11 H11  sing N N 251 
L3D C12 H12  sing N N 252 
L3D C12 H13  sing N N 253 
L3D C12 H14  sing N N 254 
L3D C15 H15  sing N N 255 
L3D C16 H16  sing N N 256 
L3D C21 H17  sing N N 257 
L3D C22 H18  sing N N 258 
L3D C24 H19  sing N N 259 
L3D C24 H20  sing N N 260 
L3D C25 H21  sing N N 261 
L3D C25 H22  sing N N 262 
L3D C29 H23  sing N N 263 
L3D C30 H24  sing N N 264 
L3D C31 H25  sing N N 265 
L3D C32 H26  sing N N 266 
LEU N   CA   sing N N 267 
LEU N   H    sing N N 268 
LEU N   H2   sing N N 269 
LEU CA  C    sing N N 270 
LEU CA  CB   sing N N 271 
LEU CA  HA   sing N N 272 
LEU C   O    doub N N 273 
LEU C   OXT  sing N N 274 
LEU CB  CG   sing N N 275 
LEU CB  HB2  sing N N 276 
LEU CB  HB3  sing N N 277 
LEU CG  CD1  sing N N 278 
LEU CG  CD2  sing N N 279 
LEU CG  HG   sing N N 280 
LEU CD1 HD11 sing N N 281 
LEU CD1 HD12 sing N N 282 
LEU CD1 HD13 sing N N 283 
LEU CD2 HD21 sing N N 284 
LEU CD2 HD22 sing N N 285 
LEU CD2 HD23 sing N N 286 
LEU OXT HXT  sing N N 287 
LYS N   CA   sing N N 288 
LYS N   H    sing N N 289 
LYS N   H2   sing N N 290 
LYS CA  C    sing N N 291 
LYS CA  CB   sing N N 292 
LYS CA  HA   sing N N 293 
LYS C   O    doub N N 294 
LYS C   OXT  sing N N 295 
LYS CB  CG   sing N N 296 
LYS CB  HB2  sing N N 297 
LYS CB  HB3  sing N N 298 
LYS CG  CD   sing N N 299 
LYS CG  HG2  sing N N 300 
LYS CG  HG3  sing N N 301 
LYS CD  CE   sing N N 302 
LYS CD  HD2  sing N N 303 
LYS CD  HD3  sing N N 304 
LYS CE  NZ   sing N N 305 
LYS CE  HE2  sing N N 306 
LYS CE  HE3  sing N N 307 
LYS NZ  HZ1  sing N N 308 
LYS NZ  HZ2  sing N N 309 
LYS NZ  HZ3  sing N N 310 
LYS OXT HXT  sing N N 311 
MET N   CA   sing N N 312 
MET N   H    sing N N 313 
MET N   H2   sing N N 314 
MET CA  C    sing N N 315 
MET CA  CB   sing N N 316 
MET CA  HA   sing N N 317 
MET C   O    doub N N 318 
MET C   OXT  sing N N 319 
MET CB  CG   sing N N 320 
MET CB  HB2  sing N N 321 
MET CB  HB3  sing N N 322 
MET CG  SD   sing N N 323 
MET CG  HG2  sing N N 324 
MET CG  HG3  sing N N 325 
MET SD  CE   sing N N 326 
MET CE  HE1  sing N N 327 
MET CE  HE2  sing N N 328 
MET CE  HE3  sing N N 329 
MET OXT HXT  sing N N 330 
PHE N   CA   sing N N 331 
PHE N   H    sing N N 332 
PHE N   H2   sing N N 333 
PHE CA  C    sing N N 334 
PHE CA  CB   sing N N 335 
PHE CA  HA   sing N N 336 
PHE C   O    doub N N 337 
PHE C   OXT  sing N N 338 
PHE CB  CG   sing N N 339 
PHE CB  HB2  sing N N 340 
PHE CB  HB3  sing N N 341 
PHE CG  CD1  doub Y N 342 
PHE CG  CD2  sing Y N 343 
PHE CD1 CE1  sing Y N 344 
PHE CD1 HD1  sing N N 345 
PHE CD2 CE2  doub Y N 346 
PHE CD2 HD2  sing N N 347 
PHE CE1 CZ   doub Y N 348 
PHE CE1 HE1  sing N N 349 
PHE CE2 CZ   sing Y N 350 
PHE CE2 HE2  sing N N 351 
PHE CZ  HZ   sing N N 352 
PHE OXT HXT  sing N N 353 
PRO N   CA   sing N N 354 
PRO N   CD   sing N N 355 
PRO N   H    sing N N 356 
PRO CA  C    sing N N 357 
PRO CA  CB   sing N N 358 
PRO CA  HA   sing N N 359 
PRO C   O    doub N N 360 
PRO C   OXT  sing N N 361 
PRO CB  CG   sing N N 362 
PRO CB  HB2  sing N N 363 
PRO CB  HB3  sing N N 364 
PRO CG  CD   sing N N 365 
PRO CG  HG2  sing N N 366 
PRO CG  HG3  sing N N 367 
PRO CD  HD2  sing N N 368 
PRO CD  HD3  sing N N 369 
PRO OXT HXT  sing N N 370 
SER N   CA   sing N N 371 
SER N   H    sing N N 372 
SER N   H2   sing N N 373 
SER CA  C    sing N N 374 
SER CA  CB   sing N N 375 
SER CA  HA   sing N N 376 
SER C   O    doub N N 377 
SER C   OXT  sing N N 378 
SER CB  OG   sing N N 379 
SER CB  HB2  sing N N 380 
SER CB  HB3  sing N N 381 
SER OG  HG   sing N N 382 
SER OXT HXT  sing N N 383 
SO4 S   O1   doub N N 384 
SO4 S   O2   doub N N 385 
SO4 S   O3   sing N N 386 
SO4 S   O4   sing N N 387 
THR N   CA   sing N N 388 
THR N   H    sing N N 389 
THR N   H2   sing N N 390 
THR CA  C    sing N N 391 
THR CA  CB   sing N N 392 
THR CA  HA   sing N N 393 
THR C   O    doub N N 394 
THR C   OXT  sing N N 395 
THR CB  OG1  sing N N 396 
THR CB  CG2  sing N N 397 
THR CB  HB   sing N N 398 
THR OG1 HG1  sing N N 399 
THR CG2 HG21 sing N N 400 
THR CG2 HG22 sing N N 401 
THR CG2 HG23 sing N N 402 
THR OXT HXT  sing N N 403 
TRP N   CA   sing N N 404 
TRP N   H    sing N N 405 
TRP N   H2   sing N N 406 
TRP CA  C    sing N N 407 
TRP CA  CB   sing N N 408 
TRP CA  HA   sing N N 409 
TRP C   O    doub N N 410 
TRP C   OXT  sing N N 411 
TRP CB  CG   sing N N 412 
TRP CB  HB2  sing N N 413 
TRP CB  HB3  sing N N 414 
TRP CG  CD1  doub Y N 415 
TRP CG  CD2  sing Y N 416 
TRP CD1 NE1  sing Y N 417 
TRP CD1 HD1  sing N N 418 
TRP CD2 CE2  doub Y N 419 
TRP CD2 CE3  sing Y N 420 
TRP NE1 CE2  sing Y N 421 
TRP NE1 HE1  sing N N 422 
TRP CE2 CZ2  sing Y N 423 
TRP CE3 CZ3  doub Y N 424 
TRP CE3 HE3  sing N N 425 
TRP CZ2 CH2  doub Y N 426 
TRP CZ2 HZ2  sing N N 427 
TRP CZ3 CH2  sing Y N 428 
TRP CZ3 HZ3  sing N N 429 
TRP CH2 HH2  sing N N 430 
TRP OXT HXT  sing N N 431 
TYR N   CA   sing N N 432 
TYR N   H    sing N N 433 
TYR N   H2   sing N N 434 
TYR CA  C    sing N N 435 
TYR CA  CB   sing N N 436 
TYR CA  HA   sing N N 437 
TYR C   O    doub N N 438 
TYR C   OXT  sing N N 439 
TYR CB  CG   sing N N 440 
TYR CB  HB2  sing N N 441 
TYR CB  HB3  sing N N 442 
TYR CG  CD1  doub Y N 443 
TYR CG  CD2  sing Y N 444 
TYR CD1 CE1  sing Y N 445 
TYR CD1 HD1  sing N N 446 
TYR CD2 CE2  doub Y N 447 
TYR CD2 HD2  sing N N 448 
TYR CE1 CZ   doub Y N 449 
TYR CE1 HE1  sing N N 450 
TYR CE2 CZ   sing Y N 451 
TYR CE2 HE2  sing N N 452 
TYR CZ  OH   sing N N 453 
TYR OH  HH   sing N N 454 
TYR OXT HXT  sing N N 455 
VAL N   CA   sing N N 456 
VAL N   H    sing N N 457 
VAL N   H2   sing N N 458 
VAL CA  C    sing N N 459 
VAL CA  CB   sing N N 460 
VAL CA  HA   sing N N 461 
VAL C   O    doub N N 462 
VAL C   OXT  sing N N 463 
VAL CB  CG1  sing N N 464 
VAL CB  CG2  sing N N 465 
VAL CB  HB   sing N N 466 
VAL CG1 HG11 sing N N 467 
VAL CG1 HG12 sing N N 468 
VAL CG1 HG13 sing N N 469 
VAL CG2 HG21 sing N N 470 
VAL CG2 HG22 sing N N 471 
VAL CG2 HG23 sing N N 472 
VAL OXT HXT  sing N N 473 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           'R01 AI 052845' 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_initial_refinement_model.id 
_pdbx_initial_refinement_model.entity_id_list 
_pdbx_initial_refinement_model.type 
_pdbx_initial_refinement_model.source_name 
_pdbx_initial_refinement_model.accession_code 
_pdbx_initial_refinement_model.details 
1 ? 'experimental model' PDB 3LPU ? 
2 ? 'experimental model' PDB 3L3U ? 
# 
_space_group.crystal_system   trigonal 
_space_group.name_H-M_alt     'P 31 2 1' 
_space_group.IT_number        152 
_space_group.name_Hall        
;P 31 2"
;
_space_group.id               1 
# 
_atom_sites.entry_id                    8CT7 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.013796 
_atom_sites.fract_transf_matrix[1][2]   0.007965 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015930 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015048 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
AS 
C  
N  
O  
S  
# 
loop_