data_8D04 # _entry.id 8D04 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8D04 pdb_00008d04 10.2210/pdb8d04/pdb WWPDB D_1000265764 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-09-28 2 'Structure model' 1 1 2022-10-19 3 'Structure model' 1 2 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8D04 _pdbx_database_status.recvd_initial_deposition_date 2022-05-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email dabaker@uw.edu _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Baker _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7896-6217 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ragotte, R.J.' 1 0000-0002-6463-1595 'Bera, A.K.' 2 0000-0001-9473-2912 'Wicky, B.I.M.' 3 0000-0002-2501-7875 'Milles, L.F.' 4 0000-0001-8417-3205 'Baker, D.' 5 0000-0001-7896-6217 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 378 _citation.language ? _citation.page_first 56 _citation.page_last 61 _citation.title 'Hallucinating symmetric protein assemblies.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.add1964 _citation.pdbx_database_id_PubMed 36108048 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wicky, B.I.M.' 1 ? primary 'Milles, L.F.' 2 ? primary 'Courbet, A.' 3 ? primary 'Ragotte, R.J.' 4 ? primary 'Dauparas, J.' 5 ? primary 'Kinfu, E.' 6 ? primary 'Tipps, S.' 7 ? primary 'Kibler, R.D.' 8 ? primary 'Baek, M.' 9 ? primary 'DiMaio, F.' 10 ? primary 'Li, X.' 11 ? primary 'Carter, L.' 12 ? primary 'Kang, A.' 13 ? primary 'Nguyen, H.' 14 ? primary 'Bera, A.K.' 15 ? primary 'Baker, D.' 16 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description HALC2_062 _entity.formula_weight 8162.173 _entity.pdbx_number_of_molecules 6 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MSGMARVEYSYEKLNDTHYKLKLKVTYEYRKSPEARRLAEDLVQAFVDALSSLPFITVEYEVEEVEVEGS _entity_poly.pdbx_seq_one_letter_code_can MSGMARVEYSYEKLNDTHYKLKLKVTYEYRKSPEARRLAEDLVQAFVDALSSLPFITVEYEVEEVEVEGS _entity_poly.pdbx_strand_id B,A,E,F,C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLY n 1 4 MET n 1 5 ALA n 1 6 ARG n 1 7 VAL n 1 8 GLU n 1 9 TYR n 1 10 SER n 1 11 TYR n 1 12 GLU n 1 13 LYS n 1 14 LEU n 1 15 ASN n 1 16 ASP n 1 17 THR n 1 18 HIS n 1 19 TYR n 1 20 LYS n 1 21 LEU n 1 22 LYS n 1 23 LEU n 1 24 LYS n 1 25 VAL n 1 26 THR n 1 27 TYR n 1 28 GLU n 1 29 TYR n 1 30 ARG n 1 31 LYS n 1 32 SER n 1 33 PRO n 1 34 GLU n 1 35 ALA n 1 36 ARG n 1 37 ARG n 1 38 LEU n 1 39 ALA n 1 40 GLU n 1 41 ASP n 1 42 LEU n 1 43 VAL n 1 44 GLN n 1 45 ALA n 1 46 PHE n 1 47 VAL n 1 48 ASP n 1 49 ALA n 1 50 LEU n 1 51 SER n 1 52 SER n 1 53 LEU n 1 54 PRO n 1 55 PHE n 1 56 ILE n 1 57 THR n 1 58 VAL n 1 59 GLU n 1 60 TYR n 1 61 GLU n 1 62 VAL n 1 63 GLU n 1 64 GLU n 1 65 VAL n 1 66 GLU n 1 67 VAL n 1 68 GLU n 1 69 GLY n 1 70 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 70 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? B . n A 1 2 SER 2 2 ? ? ? B . n A 1 3 GLY 3 3 3 GLY GLY B . n A 1 4 MET 4 4 4 MET MET B . n A 1 5 ALA 5 5 5 ALA ALA B . n A 1 6 ARG 6 6 6 ARG ARG B . n A 1 7 VAL 7 7 7 VAL VAL B . n A 1 8 GLU 8 8 8 GLU GLU B . n A 1 9 TYR 9 9 9 TYR TYR B . n A 1 10 SER 10 10 10 SER SER B . n A 1 11 TYR 11 11 11 TYR TYR B . n A 1 12 GLU 12 12 12 GLU GLU B . n A 1 13 LYS 13 13 13 LYS LYS B . n A 1 14 LEU 14 14 14 LEU LEU B . n A 1 15 ASN 15 15 15 ASN ASN B . n A 1 16 ASP 16 16 16 ASP ASP B . n A 1 17 THR 17 17 17 THR THR B . n A 1 18 HIS 18 18 18 HIS HIS B . n A 1 19 TYR 19 19 19 TYR TYR B . n A 1 20 LYS 20 20 20 LYS LYS B . n A 1 21 LEU 21 21 21 LEU LEU B . n A 1 22 LYS 22 22 22 LYS LYS B . n A 1 23 LEU 23 23 23 LEU LEU B . n A 1 24 LYS 24 24 24 LYS LYS B . n A 1 25 VAL 25 25 25 VAL VAL B . n A 1 26 THR 26 26 26 THR THR B . n A 1 27 TYR 27 27 27 TYR TYR B . n A 1 28 GLU 28 28 28 GLU GLU B . n A 1 29 TYR 29 29 29 TYR TYR B . n A 1 30 ARG 30 30 30 ARG ARG B . n A 1 31 LYS 31 31 31 LYS LYS B . n A 1 32 SER 32 32 32 SER SER B . n A 1 33 PRO 33 33 33 PRO PRO B . n A 1 34 GLU 34 34 34 GLU GLU B . n A 1 35 ALA 35 35 35 ALA ALA B . n A 1 36 ARG 36 36 36 ARG ARG B . n A 1 37 ARG 37 37 37 ARG ARG B . n A 1 38 LEU 38 38 38 LEU LEU B . n A 1 39 ALA 39 39 39 ALA ALA B . n A 1 40 GLU 40 40 40 GLU GLU B . n A 1 41 ASP 41 41 41 ASP ASP B . n A 1 42 LEU 42 42 42 LEU LEU B . n A 1 43 VAL 43 43 43 VAL VAL B . n A 1 44 GLN 44 44 44 GLN GLN B . n A 1 45 ALA 45 45 45 ALA ALA B . n A 1 46 PHE 46 46 46 PHE PHE B . n A 1 47 VAL 47 47 47 VAL VAL B . n A 1 48 ASP 48 48 48 ASP ASP B . n A 1 49 ALA 49 49 49 ALA ALA B . n A 1 50 LEU 50 50 50 LEU LEU B . n A 1 51 SER 51 51 51 SER SER B . n A 1 52 SER 52 52 52 SER SER B . n A 1 53 LEU 53 53 53 LEU LEU B . n A 1 54 PRO 54 54 54 PRO PRO B . n A 1 55 PHE 55 55 55 PHE PHE B . n A 1 56 ILE 56 56 56 ILE ILE B . n A 1 57 THR 57 57 57 THR THR B . n A 1 58 VAL 58 58 58 VAL VAL B . n A 1 59 GLU 59 59 59 GLU GLU B . n A 1 60 TYR 60 60 60 TYR TYR B . n A 1 61 GLU 61 61 61 GLU GLU B . n A 1 62 VAL 62 62 62 VAL VAL B . n A 1 63 GLU 63 63 63 GLU GLU B . n A 1 64 GLU 64 64 64 GLU GLU B . n A 1 65 VAL 65 65 65 VAL VAL B . n A 1 66 GLU 66 66 ? ? ? B . n A 1 67 VAL 67 67 ? ? ? B . n A 1 68 GLU 68 68 ? ? ? B . n A 1 69 GLY 69 69 ? ? ? B . n A 1 70 SER 70 70 ? ? ? B . n B 1 1 MET 1 1 ? ? ? A . n B 1 2 SER 2 2 ? ? ? A . n B 1 3 GLY 3 3 3 GLY GLY A . n B 1 4 MET 4 4 4 MET MET A . n B 1 5 ALA 5 5 5 ALA ALA A . n B 1 6 ARG 6 6 6 ARG ARG A . n B 1 7 VAL 7 7 7 VAL VAL A . n B 1 8 GLU 8 8 8 GLU GLU A . n B 1 9 TYR 9 9 9 TYR TYR A . n B 1 10 SER 10 10 10 SER SER A . n B 1 11 TYR 11 11 11 TYR TYR A . n B 1 12 GLU 12 12 12 GLU GLU A . n B 1 13 LYS 13 13 13 LYS LYS A . n B 1 14 LEU 14 14 14 LEU LEU A . n B 1 15 ASN 15 15 15 ASN ASN A . n B 1 16 ASP 16 16 16 ASP ASP A . n B 1 17 THR 17 17 17 THR THR A . n B 1 18 HIS 18 18 18 HIS HIS A . n B 1 19 TYR 19 19 19 TYR TYR A . n B 1 20 LYS 20 20 20 LYS LYS A . n B 1 21 LEU 21 21 21 LEU LEU A . n B 1 22 LYS 22 22 22 LYS LYS A . n B 1 23 LEU 23 23 23 LEU LEU A . n B 1 24 LYS 24 24 24 LYS LYS A . n B 1 25 VAL 25 25 25 VAL VAL A . n B 1 26 THR 26 26 26 THR THR A . n B 1 27 TYR 27 27 27 TYR TYR A . n B 1 28 GLU 28 28 28 GLU GLU A . n B 1 29 TYR 29 29 29 TYR TYR A . n B 1 30 ARG 30 30 30 ARG ARG A . n B 1 31 LYS 31 31 31 LYS LYS A . n B 1 32 SER 32 32 32 SER SER A . n B 1 33 PRO 33 33 33 PRO PRO A . n B 1 34 GLU 34 34 34 GLU GLU A . n B 1 35 ALA 35 35 35 ALA ALA A . n B 1 36 ARG 36 36 36 ARG ARG A . n B 1 37 ARG 37 37 37 ARG ARG A . n B 1 38 LEU 38 38 38 LEU LEU A . n B 1 39 ALA 39 39 39 ALA ALA A . n B 1 40 GLU 40 40 40 GLU GLU A . n B 1 41 ASP 41 41 41 ASP ASP A . n B 1 42 LEU 42 42 42 LEU LEU A . n B 1 43 VAL 43 43 43 VAL VAL A . n B 1 44 GLN 44 44 44 GLN GLN A . n B 1 45 ALA 45 45 45 ALA ALA A . n B 1 46 PHE 46 46 46 PHE PHE A . n B 1 47 VAL 47 47 47 VAL VAL A . n B 1 48 ASP 48 48 48 ASP ASP A . n B 1 49 ALA 49 49 49 ALA ALA A . n B 1 50 LEU 50 50 50 LEU LEU A . n B 1 51 SER 51 51 51 SER SER A . n B 1 52 SER 52 52 52 SER SER A . n B 1 53 LEU 53 53 53 LEU LEU A . n B 1 54 PRO 54 54 54 PRO PRO A . n B 1 55 PHE 55 55 55 PHE PHE A . n B 1 56 ILE 56 56 56 ILE ILE A . n B 1 57 THR 57 57 57 THR THR A . n B 1 58 VAL 58 58 58 VAL VAL A . n B 1 59 GLU 59 59 59 GLU GLU A . n B 1 60 TYR 60 60 60 TYR TYR A . n B 1 61 GLU 61 61 61 GLU GLU A . n B 1 62 VAL 62 62 62 VAL VAL A . n B 1 63 GLU 63 63 63 GLU GLU A . n B 1 64 GLU 64 64 64 GLU GLU A . n B 1 65 VAL 65 65 65 VAL VAL A . n B 1 66 GLU 66 66 66 GLU GLU A . n B 1 67 VAL 67 67 67 VAL VAL A . n B 1 68 GLU 68 68 68 GLU GLU A . n B 1 69 GLY 69 69 ? ? ? A . n B 1 70 SER 70 70 ? ? ? A . n C 1 1 MET 1 1 ? ? ? E . n C 1 2 SER 2 2 ? ? ? E . n C 1 3 GLY 3 3 3 GLY GLY E . n C 1 4 MET 4 4 4 MET MET E . n C 1 5 ALA 5 5 5 ALA ALA E . n C 1 6 ARG 6 6 6 ARG ARG E . n C 1 7 VAL 7 7 7 VAL VAL E . n C 1 8 GLU 8 8 8 GLU GLU E . n C 1 9 TYR 9 9 9 TYR TYR E . n C 1 10 SER 10 10 10 SER SER E . n C 1 11 TYR 11 11 11 TYR TYR E . n C 1 12 GLU 12 12 12 GLU GLU E . n C 1 13 LYS 13 13 13 LYS LYS E . n C 1 14 LEU 14 14 14 LEU LEU E . n C 1 15 ASN 15 15 15 ASN ASN E . n C 1 16 ASP 16 16 16 ASP ASP E . n C 1 17 THR 17 17 17 THR THR E . n C 1 18 HIS 18 18 18 HIS HIS E . n C 1 19 TYR 19 19 19 TYR TYR E . n C 1 20 LYS 20 20 20 LYS LYS E . n C 1 21 LEU 21 21 21 LEU LEU E . n C 1 22 LYS 22 22 22 LYS LYS E . n C 1 23 LEU 23 23 23 LEU LEU E . n C 1 24 LYS 24 24 24 LYS LYS E . n C 1 25 VAL 25 25 25 VAL VAL E . n C 1 26 THR 26 26 26 THR THR E . n C 1 27 TYR 27 27 27 TYR TYR E . n C 1 28 GLU 28 28 28 GLU GLU E . n C 1 29 TYR 29 29 29 TYR TYR E . n C 1 30 ARG 30 30 30 ARG ARG E . n C 1 31 LYS 31 31 31 LYS LYS E . n C 1 32 SER 32 32 32 SER SER E . n C 1 33 PRO 33 33 33 PRO PRO E . n C 1 34 GLU 34 34 34 GLU GLU E . n C 1 35 ALA 35 35 35 ALA ALA E . n C 1 36 ARG 36 36 36 ARG ARG E . n C 1 37 ARG 37 37 37 ARG ARG E . n C 1 38 LEU 38 38 38 LEU LEU E . n C 1 39 ALA 39 39 39 ALA ALA E . n C 1 40 GLU 40 40 40 GLU GLU E . n C 1 41 ASP 41 41 41 ASP ASP E . n C 1 42 LEU 42 42 42 LEU LEU E . n C 1 43 VAL 43 43 43 VAL VAL E . n C 1 44 GLN 44 44 44 GLN GLN E . n C 1 45 ALA 45 45 45 ALA ALA E . n C 1 46 PHE 46 46 46 PHE PHE E . n C 1 47 VAL 47 47 47 VAL VAL E . n C 1 48 ASP 48 48 48 ASP ASP E . n C 1 49 ALA 49 49 49 ALA ALA E . n C 1 50 LEU 50 50 50 LEU LEU E . n C 1 51 SER 51 51 51 SER SER E . n C 1 52 SER 52 52 52 SER SER E . n C 1 53 LEU 53 53 53 LEU LEU E . n C 1 54 PRO 54 54 54 PRO PRO E . n C 1 55 PHE 55 55 55 PHE PHE E . n C 1 56 ILE 56 56 56 ILE ILE E . n C 1 57 THR 57 57 57 THR THR E . n C 1 58 VAL 58 58 58 VAL VAL E . n C 1 59 GLU 59 59 59 GLU GLU E . n C 1 60 TYR 60 60 60 TYR TYR E . n C 1 61 GLU 61 61 61 GLU GLU E . n C 1 62 VAL 62 62 62 VAL VAL E . n C 1 63 GLU 63 63 63 GLU GLU E . n C 1 64 GLU 64 64 64 GLU GLU E . n C 1 65 VAL 65 65 65 VAL VAL E . n C 1 66 GLU 66 66 66 GLU GLU E . n C 1 67 VAL 67 67 67 VAL VAL E . n C 1 68 GLU 68 68 ? ? ? E . n C 1 69 GLY 69 69 ? ? ? E . n C 1 70 SER 70 70 ? ? ? E . n D 1 1 MET 1 1 ? ? ? F . n D 1 2 SER 2 2 ? ? ? F . n D 1 3 GLY 3 3 3 GLY GLY F . n D 1 4 MET 4 4 4 MET MET F . n D 1 5 ALA 5 5 5 ALA ALA F . n D 1 6 ARG 6 6 6 ARG ARG F . n D 1 7 VAL 7 7 7 VAL VAL F . n D 1 8 GLU 8 8 8 GLU GLU F . n D 1 9 TYR 9 9 9 TYR TYR F . n D 1 10 SER 10 10 10 SER SER F . n D 1 11 TYR 11 11 11 TYR TYR F . n D 1 12 GLU 12 12 12 GLU GLU F . n D 1 13 LYS 13 13 13 LYS LYS F . n D 1 14 LEU 14 14 14 LEU LEU F . n D 1 15 ASN 15 15 15 ASN ASN F . n D 1 16 ASP 16 16 16 ASP ASP F . n D 1 17 THR 17 17 17 THR THR F . n D 1 18 HIS 18 18 18 HIS HIS F . n D 1 19 TYR 19 19 19 TYR TYR F . n D 1 20 LYS 20 20 20 LYS LYS F . n D 1 21 LEU 21 21 21 LEU LEU F . n D 1 22 LYS 22 22 22 LYS LYS F . n D 1 23 LEU 23 23 23 LEU LEU F . n D 1 24 LYS 24 24 24 LYS LYS F . n D 1 25 VAL 25 25 25 VAL VAL F . n D 1 26 THR 26 26 26 THR THR F . n D 1 27 TYR 27 27 27 TYR TYR F . n D 1 28 GLU 28 28 28 GLU GLU F . n D 1 29 TYR 29 29 29 TYR TYR F . n D 1 30 ARG 30 30 30 ARG ARG F . n D 1 31 LYS 31 31 31 LYS LYS F . n D 1 32 SER 32 32 32 SER SER F . n D 1 33 PRO 33 33 33 PRO PRO F . n D 1 34 GLU 34 34 34 GLU GLU F . n D 1 35 ALA 35 35 35 ALA ALA F . n D 1 36 ARG 36 36 36 ARG ARG F . n D 1 37 ARG 37 37 37 ARG ARG F . n D 1 38 LEU 38 38 38 LEU LEU F . n D 1 39 ALA 39 39 39 ALA ALA F . n D 1 40 GLU 40 40 40 GLU GLU F . n D 1 41 ASP 41 41 41 ASP ASP F . n D 1 42 LEU 42 42 42 LEU LEU F . n D 1 43 VAL 43 43 43 VAL VAL F . n D 1 44 GLN 44 44 44 GLN GLN F . n D 1 45 ALA 45 45 45 ALA ALA F . n D 1 46 PHE 46 46 46 PHE PHE F . n D 1 47 VAL 47 47 47 VAL VAL F . n D 1 48 ASP 48 48 48 ASP ASP F . n D 1 49 ALA 49 49 49 ALA ALA F . n D 1 50 LEU 50 50 50 LEU LEU F . n D 1 51 SER 51 51 51 SER SER F . n D 1 52 SER 52 52 52 SER SER F . n D 1 53 LEU 53 53 53 LEU LEU F . n D 1 54 PRO 54 54 54 PRO PRO F . n D 1 55 PHE 55 55 55 PHE PHE F . n D 1 56 ILE 56 56 56 ILE ILE F . n D 1 57 THR 57 57 57 THR THR F . n D 1 58 VAL 58 58 58 VAL VAL F . n D 1 59 GLU 59 59 59 GLU GLU F . n D 1 60 TYR 60 60 60 TYR TYR F . n D 1 61 GLU 61 61 61 GLU GLU F . n D 1 62 VAL 62 62 62 VAL VAL F . n D 1 63 GLU 63 63 63 GLU GLU F . n D 1 64 GLU 64 64 64 GLU GLU F . n D 1 65 VAL 65 65 65 VAL VAL F . n D 1 66 GLU 66 66 66 GLU GLU F . n D 1 67 VAL 67 67 67 VAL VAL F . n D 1 68 GLU 68 68 ? ? ? F . n D 1 69 GLY 69 69 ? ? ? F . n D 1 70 SER 70 70 ? ? ? F . n E 1 1 MET 1 1 ? ? ? C . n E 1 2 SER 2 2 ? ? ? C . n E 1 3 GLY 3 3 3 GLY GLY C . n E 1 4 MET 4 4 4 MET MET C . n E 1 5 ALA 5 5 5 ALA ALA C . n E 1 6 ARG 6 6 6 ARG ARG C . n E 1 7 VAL 7 7 7 VAL VAL C . n E 1 8 GLU 8 8 8 GLU GLU C . n E 1 9 TYR 9 9 9 TYR TYR C . n E 1 10 SER 10 10 10 SER SER C . n E 1 11 TYR 11 11 11 TYR TYR C . n E 1 12 GLU 12 12 12 GLU GLU C . n E 1 13 LYS 13 13 13 LYS LYS C . n E 1 14 LEU 14 14 14 LEU LEU C . n E 1 15 ASN 15 15 15 ASN ASN C . n E 1 16 ASP 16 16 16 ASP ASP C . n E 1 17 THR 17 17 17 THR THR C . n E 1 18 HIS 18 18 18 HIS HIS C . n E 1 19 TYR 19 19 19 TYR TYR C . n E 1 20 LYS 20 20 20 LYS LYS C . n E 1 21 LEU 21 21 21 LEU LEU C . n E 1 22 LYS 22 22 22 LYS LYS C . n E 1 23 LEU 23 23 23 LEU LEU C . n E 1 24 LYS 24 24 24 LYS LYS C . n E 1 25 VAL 25 25 25 VAL VAL C . n E 1 26 THR 26 26 26 THR THR C . n E 1 27 TYR 27 27 27 TYR TYR C . n E 1 28 GLU 28 28 28 GLU GLU C . n E 1 29 TYR 29 29 29 TYR TYR C . n E 1 30 ARG 30 30 30 ARG ARG C . n E 1 31 LYS 31 31 31 LYS LYS C . n E 1 32 SER 32 32 32 SER SER C . n E 1 33 PRO 33 33 33 PRO PRO C . n E 1 34 GLU 34 34 34 GLU GLU C . n E 1 35 ALA 35 35 35 ALA ALA C . n E 1 36 ARG 36 36 36 ARG ARG C . n E 1 37 ARG 37 37 37 ARG ARG C . n E 1 38 LEU 38 38 38 LEU LEU C . n E 1 39 ALA 39 39 39 ALA ALA C . n E 1 40 GLU 40 40 40 GLU GLU C . n E 1 41 ASP 41 41 41 ASP ASP C . n E 1 42 LEU 42 42 42 LEU LEU C . n E 1 43 VAL 43 43 43 VAL VAL C . n E 1 44 GLN 44 44 44 GLN GLN C . n E 1 45 ALA 45 45 45 ALA ALA C . n E 1 46 PHE 46 46 46 PHE PHE C . n E 1 47 VAL 47 47 47 VAL VAL C . n E 1 48 ASP 48 48 48 ASP ASP C . n E 1 49 ALA 49 49 49 ALA ALA C . n E 1 50 LEU 50 50 50 LEU LEU C . n E 1 51 SER 51 51 51 SER SER C . n E 1 52 SER 52 52 52 SER SER C . n E 1 53 LEU 53 53 53 LEU LEU C . n E 1 54 PRO 54 54 54 PRO PRO C . n E 1 55 PHE 55 55 55 PHE PHE C . n E 1 56 ILE 56 56 56 ILE ILE C . n E 1 57 THR 57 57 57 THR THR C . n E 1 58 VAL 58 58 58 VAL VAL C . n E 1 59 GLU 59 59 59 GLU GLU C . n E 1 60 TYR 60 60 60 TYR TYR C . n E 1 61 GLU 61 61 61 GLU GLU C . n E 1 62 VAL 62 62 62 VAL VAL C . n E 1 63 GLU 63 63 63 GLU GLU C . n E 1 64 GLU 64 64 64 GLU GLU C . n E 1 65 VAL 65 65 65 VAL VAL C . n E 1 66 GLU 66 66 66 GLU GLU C . n E 1 67 VAL 67 67 ? ? ? C . n E 1 68 GLU 68 68 ? ? ? C . n E 1 69 GLY 69 69 ? ? ? C . n E 1 70 SER 70 70 ? ? ? C . n F 1 1 MET 1 1 ? ? ? D . n F 1 2 SER 2 2 ? ? ? D . n F 1 3 GLY 3 3 3 GLY GLY D . n F 1 4 MET 4 4 4 MET MET D . n F 1 5 ALA 5 5 5 ALA ALA D . n F 1 6 ARG 6 6 6 ARG ARG D . n F 1 7 VAL 7 7 7 VAL VAL D . n F 1 8 GLU 8 8 8 GLU GLU D . n F 1 9 TYR 9 9 9 TYR TYR D . n F 1 10 SER 10 10 10 SER SER D . n F 1 11 TYR 11 11 11 TYR TYR D . n F 1 12 GLU 12 12 12 GLU GLU D . n F 1 13 LYS 13 13 13 LYS LYS D . n F 1 14 LEU 14 14 14 LEU LEU D . n F 1 15 ASN 15 15 15 ASN ASN D . n F 1 16 ASP 16 16 16 ASP ASP D . n F 1 17 THR 17 17 17 THR THR D . n F 1 18 HIS 18 18 18 HIS HIS D . n F 1 19 TYR 19 19 19 TYR TYR D . n F 1 20 LYS 20 20 20 LYS LYS D . n F 1 21 LEU 21 21 21 LEU LEU D . n F 1 22 LYS 22 22 22 LYS LYS D . n F 1 23 LEU 23 23 23 LEU LEU D . n F 1 24 LYS 24 24 24 LYS LYS D . n F 1 25 VAL 25 25 25 VAL VAL D . n F 1 26 THR 26 26 26 THR THR D . n F 1 27 TYR 27 27 27 TYR TYR D . n F 1 28 GLU 28 28 28 GLU GLU D . n F 1 29 TYR 29 29 29 TYR TYR D . n F 1 30 ARG 30 30 30 ARG ARG D . n F 1 31 LYS 31 31 31 LYS LYS D . n F 1 32 SER 32 32 32 SER SER D . n F 1 33 PRO 33 33 33 PRO PRO D . n F 1 34 GLU 34 34 34 GLU GLU D . n F 1 35 ALA 35 35 35 ALA ALA D . n F 1 36 ARG 36 36 36 ARG ARG D . n F 1 37 ARG 37 37 37 ARG ARG D . n F 1 38 LEU 38 38 38 LEU LEU D . n F 1 39 ALA 39 39 39 ALA ALA D . n F 1 40 GLU 40 40 40 GLU GLU D . n F 1 41 ASP 41 41 41 ASP ASP D . n F 1 42 LEU 42 42 42 LEU LEU D . n F 1 43 VAL 43 43 43 VAL VAL D . n F 1 44 GLN 44 44 44 GLN GLN D . n F 1 45 ALA 45 45 45 ALA ALA D . n F 1 46 PHE 46 46 46 PHE PHE D . n F 1 47 VAL 47 47 47 VAL VAL D . n F 1 48 ASP 48 48 48 ASP ASP D . n F 1 49 ALA 49 49 49 ALA ALA D . n F 1 50 LEU 50 50 50 LEU LEU D . n F 1 51 SER 51 51 51 SER SER D . n F 1 52 SER 52 52 52 SER SER D . n F 1 53 LEU 53 53 53 LEU LEU D . n F 1 54 PRO 54 54 54 PRO PRO D . n F 1 55 PHE 55 55 55 PHE PHE D . n F 1 56 ILE 56 56 56 ILE ILE D . n F 1 57 THR 57 57 57 THR THR D . n F 1 58 VAL 58 58 58 VAL VAL D . n F 1 59 GLU 59 59 59 GLU GLU D . n F 1 60 TYR 60 60 60 TYR TYR D . n F 1 61 GLU 61 61 61 GLU GLU D . n F 1 62 VAL 62 62 62 VAL VAL D . n F 1 63 GLU 63 63 63 GLU GLU D . n F 1 64 GLU 64 64 64 GLU GLU D . n F 1 65 VAL 65 65 65 VAL VAL D . n F 1 66 GLU 66 66 ? ? ? D . n F 1 67 VAL 67 67 ? ? ? D . n F 1 68 GLU 68 68 ? ? ? D . n F 1 69 GLY 69 69 ? ? ? D . n F 1 70 SER 70 70 ? ? ? D . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8D04 _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.910 _cell.length_a_esd ? _cell.length_b 67.910 _cell.length_b_esd ? _cell.length_c 228.407 _cell.length_c_esd ? _cell.volume 912236.620 _cell.volume_esd ? _cell.Z_PDB 36 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8D04 _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall 'P 65' _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8D04 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.10 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.38 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M Bis-Tris 2.0 M Ammonium sulfate ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-04-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97926 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97926 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 60.45 _reflns.entry_id 8D04 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.11 _reflns.d_resolution_low 58.81 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 34088 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.81 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.65 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.11 _reflns_shell.d_res_low 2.186 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3405 _reflns_shell.percent_possible_all 99.47 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.559 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 76.64 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8D04 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.11 _refine.ls_d_res_low 58.81 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 34033 _refine.ls_number_reflns_R_free 1678 _refine.ls_number_reflns_R_work 32355 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.81 _refine.ls_percent_reflns_R_free 4.93 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2389 _refine.ls_R_factor_R_free 0.2643 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2375 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'Design model' _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.8480 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2866 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.11 _refine_hist.d_res_low 58.81 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3210 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3210 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0026 ? 3270 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5139 ? 4416 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0425 ? 491 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0023 ? 559 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.0482 ? 1244 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.11 2.17 . . 152 2641 99.40 . . . 0.3316 . 0.3244 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.17 2.24 . . 147 2683 99.68 . . . 0.3516 . 0.3049 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.24 2.32 . . 153 2683 99.96 . . . 0.3101 . 0.3124 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.32 2.42 . . 119 2718 99.82 . . . 0.3517 . 0.3506 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.42 2.53 . . 139 2712 99.82 . . . 0.3196 . 0.3038 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.53 2.66 . . 145 2672 99.96 . . . 0.3662 . 0.2870 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.66 2.83 . . 130 2719 100.00 . . . 0.3183 . 0.2908 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.83 3.04 . . 135 2695 100.00 . . . 0.2914 . 0.3062 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.04 3.35 . . 119 2726 99.96 . . . 0.3162 . 0.2662 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.35 3.83 . . 144 2689 99.65 . . . 0.3028 . 0.2418 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.83 4.83 . . 151 2705 99.93 . . . 0.2473 . 0.2050 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.83 58.81 . . 144 2712 99.55 . . . 0.2039 . 0.1972 . . . . . . . . . . . # _struct.entry_id 8D04 _struct.title 'Hallucinated C2 protein assembly HALC2_062' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8D04 _struct_keywords.text 'De novo design Hallucination Cyclic ProteinMPNN, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8D04 _struct_ref.pdbx_db_accession 8D04 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8D04 B 1 ? 70 ? 8D04 1 ? 70 ? 1 70 2 1 8D04 A 1 ? 70 ? 8D04 1 ? 70 ? 1 70 3 1 8D04 E 1 ? 70 ? 8D04 1 ? 70 ? 1 70 4 1 8D04 F 1 ? 70 ? 8D04 1 ? 70 ? 1 70 5 1 8D04 C 1 ? 70 ? 8D04 1 ? 70 ? 1 70 6 1 8D04 D 1 ? 70 ? 8D04 1 ? 70 ? 1 70 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 3 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3060 ? 1 MORE -30 ? 1 'SSA (A^2)' 7310 ? 2 'ABSA (A^2)' 3010 ? 2 MORE -33 ? 2 'SSA (A^2)' 7240 ? 3 'ABSA (A^2)' 2960 ? 3 MORE -30 ? 3 'SSA (A^2)' 7700 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1 C,E 3 1 D,F # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'light scattering' ? 2 2 'light scattering' ? 3 3 'light scattering' ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 32 ? LEU A 53 ? SER B 32 LEU B 53 1 ? 22 HELX_P HELX_P2 AA2 SER B 32 ? SER B 52 ? SER A 32 SER A 52 1 ? 21 HELX_P HELX_P3 AA3 SER C 32 ? SER C 51 ? SER E 32 SER E 51 1 ? 20 HELX_P HELX_P4 AA4 SER D 32 ? LEU D 53 ? SER F 32 LEU F 53 1 ? 22 HELX_P HELX_P5 AA5 SER E 32 ? LEU E 53 ? SER C 32 LEU C 53 1 ? 22 HELX_P HELX_P6 AA6 SER F 32 ? SER F 52 ? SER D 32 SER D 52 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 9 ? AA3 ? 3 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? parallel AA2 8 9 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? parallel AA4 1 2 ? anti-parallel AA4 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 5 ? LYS A 13 ? ALA B 5 LYS B 13 AA1 2 TYR A 19 ? TYR A 27 ? TYR B 19 TYR B 27 AA1 3 ILE A 56 ? GLU A 64 ? ILE B 56 GLU B 64 AA2 1 THR B 57 ? VAL B 65 ? THR A 57 VAL A 65 AA2 2 THR B 17 ? GLU B 28 ? THR A 17 GLU A 28 AA2 3 MET B 4 ? LEU B 14 ? MET A 4 LEU A 14 AA2 4 ILE D 56 ? GLU D 64 ? ILE F 56 GLU F 64 AA2 5 TYR D 19 ? TYR D 27 ? TYR F 19 TYR F 27 AA2 6 ALA D 5 ? LYS D 13 ? ALA F 5 LYS F 13 AA2 7 ILE C 56 ? GLU C 64 ? ILE E 56 GLU E 64 AA2 8 TYR C 19 ? GLU C 28 ? TYR E 19 GLU E 28 AA2 9 MET C 4 ? LYS C 13 ? MET E 4 LYS E 13 AA3 1 ALA E 5 ? LYS E 13 ? ALA C 5 LYS C 13 AA3 2 TYR E 19 ? TYR E 27 ? TYR C 19 TYR C 27 AA3 3 ILE E 56 ? GLU E 64 ? ILE C 56 GLU C 64 AA4 1 ALA F 5 ? GLU F 12 ? ALA D 5 GLU D 12 AA4 2 TYR F 19 ? TYR F 27 ? TYR D 19 TYR D 27 AA4 3 ILE F 56 ? GLU F 64 ? ILE D 56 GLU D 64 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 10 ? N SER B 10 O LYS A 22 ? O LYS B 22 AA1 2 3 N LEU A 21 ? N LEU B 21 O THR A 57 ? O THR B 57 AA2 1 2 O THR B 57 ? O THR A 57 N LEU B 21 ? N LEU A 21 AA2 2 3 O LYS B 24 ? O LYS A 24 N GLU B 8 ? N GLU A 8 AA2 3 4 N TYR B 11 ? N TYR A 11 O VAL D 62 ? O VAL F 62 AA2 4 5 O GLU D 61 ? O GLU F 61 N VAL D 25 ? N VAL F 25 AA2 5 6 O LYS D 24 ? O LYS F 24 N GLU D 8 ? N GLU F 8 AA2 6 7 O TYR D 11 ? O TYR F 11 N VAL C 62 ? N VAL E 62 AA2 7 8 O GLU C 61 ? O GLU E 61 N VAL C 25 ? N VAL E 25 AA2 8 9 O LYS C 22 ? O LYS E 22 N SER C 10 ? N SER E 10 AA3 1 2 N SER E 10 ? N SER C 10 O LYS E 22 ? O LYS C 22 AA3 2 3 N LEU E 21 ? N LEU C 21 O THR E 57 ? O THR C 57 AA4 1 2 N GLU F 8 ? N GLU D 8 O LYS F 24 ? O LYS D 24 AA4 2 3 N LEU F 21 ? N LEU D 21 O THR F 57 ? O THR D 57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN B 15 ? ? -123.14 -161.43 2 1 ASP A 16 ? ? 57.97 11.35 3 1 PHE A 55 ? ? -92.16 30.85 4 1 LEU E 14 ? ? -61.81 -70.16 5 1 ASP F 16 ? ? -107.08 48.71 6 1 ASN C 15 ? ? 51.68 -145.95 7 1 THR C 17 ? ? 59.49 17.88 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+5/6 3 y,-x+y,z+1/6 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 -x,-y,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B MET 1 ? A MET 1 2 1 Y 1 B SER 2 ? A SER 2 3 1 Y 1 B GLU 66 ? A GLU 66 4 1 Y 1 B VAL 67 ? A VAL 67 5 1 Y 1 B GLU 68 ? A GLU 68 6 1 Y 1 B GLY 69 ? A GLY 69 7 1 Y 1 B SER 70 ? A SER 70 8 1 Y 1 A MET 1 ? B MET 1 9 1 Y 1 A SER 2 ? B SER 2 10 1 Y 1 A GLY 69 ? B GLY 69 11 1 Y 1 A SER 70 ? B SER 70 12 1 Y 1 E MET 1 ? C MET 1 13 1 Y 1 E SER 2 ? C SER 2 14 1 Y 1 E GLU 68 ? C GLU 68 15 1 Y 1 E GLY 69 ? C GLY 69 16 1 Y 1 E SER 70 ? C SER 70 17 1 Y 1 F MET 1 ? D MET 1 18 1 Y 1 F SER 2 ? D SER 2 19 1 Y 1 F GLU 68 ? D GLU 68 20 1 Y 1 F GLY 69 ? D GLY 69 21 1 Y 1 F SER 70 ? D SER 70 22 1 Y 1 C MET 1 ? E MET 1 23 1 Y 1 C SER 2 ? E SER 2 24 1 Y 1 C VAL 67 ? E VAL 67 25 1 Y 1 C GLU 68 ? E GLU 68 26 1 Y 1 C GLY 69 ? E GLY 69 27 1 Y 1 C SER 70 ? E SER 70 28 1 Y 1 D MET 1 ? F MET 1 29 1 Y 1 D SER 2 ? F SER 2 30 1 Y 1 D GLU 66 ? F GLU 66 31 1 Y 1 D VAL 67 ? F VAL 67 32 1 Y 1 D GLU 68 ? F GLU 68 33 1 Y 1 D GLY 69 ? F GLY 69 34 1 Y 1 D SER 70 ? F SER 70 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # _pdbx_audit_support.funding_organization 'Howard Hughes Medical Institute (HHMI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'Design model' # _space_group.name_H-M_alt 'P 65' _space_group.name_Hall 'P 65' _space_group.IT_number 170 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 8D04 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014725 _atom_sites.fract_transf_matrix[1][2] 0.008502 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017003 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004378 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_