data_8D08 # _entry.id 8D08 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8D08 pdb_00008d08 10.2210/pdb8d08/pdb WWPDB D_1000265771 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-09-28 2 'Structure model' 1 1 2022-10-19 3 'Structure model' 1 2 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8D08 _pdbx_database_status.recvd_initial_deposition_date 2022-05-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email dabaker@uw.edu _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Baker _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7896-6217 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ragotte, R.J.' 1 0000-0002-6463-1595 'Bera, A.K.' 2 0000-0001-9473-2912 'Wicky, B.I.M.' 3 0000-0002-2501-7875 'Milles, L.F.' 4 0000-0001-8417-3205 'Baker, D.' 5 0000-0001-7896-6217 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 378 _citation.language ? _citation.page_first 56 _citation.page_last 61 _citation.title 'Hallucinating symmetric protein assemblies.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.add1964 _citation.pdbx_database_id_PubMed 36108048 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wicky, B.I.M.' 1 ? primary 'Milles, L.F.' 2 ? primary 'Courbet, A.' 3 ? primary 'Ragotte, R.J.' 4 ? primary 'Dauparas, J.' 5 ? primary 'Kinfu, E.' 6 ? primary 'Tipps, S.' 7 ? primary 'Kibler, R.D.' 8 ? primary 'Baek, M.' 9 ? primary 'DiMaio, F.' 10 ? primary 'Li, X.' 11 ? primary 'Carter, L.' 12 ? primary 'Kang, A.' 13 ? primary 'Nguyen, H.' 14 ? primary 'Bera, A.K.' 15 ? primary 'Baker, D.' 16 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description HALC4_135 _entity.formula_weight 8300.708 _entity.pdbx_number_of_molecules 4 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MSGMEKFKEQLLEEVKKIVLETMTKVMEHLEKWFVTLAEIIITKSEEKLEELKETMEKSIEELRKEAEGS _entity_poly.pdbx_seq_one_letter_code_can MSGMEKFKEQLLEEVKKIVLETMTKVMEHLEKWFVTLAEIIITKSEEKLEELKETMEKSIEELRKEAEGS _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLY n 1 4 MET n 1 5 GLU n 1 6 LYS n 1 7 PHE n 1 8 LYS n 1 9 GLU n 1 10 GLN n 1 11 LEU n 1 12 LEU n 1 13 GLU n 1 14 GLU n 1 15 VAL n 1 16 LYS n 1 17 LYS n 1 18 ILE n 1 19 VAL n 1 20 LEU n 1 21 GLU n 1 22 THR n 1 23 MET n 1 24 THR n 1 25 LYS n 1 26 VAL n 1 27 MET n 1 28 GLU n 1 29 HIS n 1 30 LEU n 1 31 GLU n 1 32 LYS n 1 33 TRP n 1 34 PHE n 1 35 VAL n 1 36 THR n 1 37 LEU n 1 38 ALA n 1 39 GLU n 1 40 ILE n 1 41 ILE n 1 42 ILE n 1 43 THR n 1 44 LYS n 1 45 SER n 1 46 GLU n 1 47 GLU n 1 48 LYS n 1 49 LEU n 1 50 GLU n 1 51 GLU n 1 52 LEU n 1 53 LYS n 1 54 GLU n 1 55 THR n 1 56 MET n 1 57 GLU n 1 58 LYS n 1 59 SER n 1 60 ILE n 1 61 GLU n 1 62 GLU n 1 63 LEU n 1 64 ARG n 1 65 LYS n 1 66 GLU n 1 67 ALA n 1 68 GLU n 1 69 GLY n 1 70 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 70 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 SER 70 70 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 SER 2 2 ? ? ? B . n B 1 3 GLY 3 3 ? ? ? B . n B 1 4 MET 4 4 4 MET MET B . n B 1 5 GLU 5 5 5 GLU GLU B . n B 1 6 LYS 6 6 6 LYS LYS B . n B 1 7 PHE 7 7 7 PHE PHE B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 GLU 9 9 9 GLU GLU B . n B 1 10 GLN 10 10 10 GLN GLN B . n B 1 11 LEU 11 11 11 LEU LEU B . n B 1 12 LEU 12 12 12 LEU LEU B . n B 1 13 GLU 13 13 13 GLU GLU B . n B 1 14 GLU 14 14 14 GLU GLU B . n B 1 15 VAL 15 15 15 VAL VAL B . n B 1 16 LYS 16 16 16 LYS LYS B . n B 1 17 LYS 17 17 17 LYS LYS B . n B 1 18 ILE 18 18 18 ILE ILE B . n B 1 19 VAL 19 19 19 VAL VAL B . n B 1 20 LEU 20 20 20 LEU LEU B . n B 1 21 GLU 21 21 21 GLU GLU B . n B 1 22 THR 22 22 22 THR THR B . n B 1 23 MET 23 23 23 MET MET B . n B 1 24 THR 24 24 24 THR THR B . n B 1 25 LYS 25 25 25 LYS LYS B . n B 1 26 VAL 26 26 26 VAL VAL B . n B 1 27 MET 27 27 27 MET MET B . n B 1 28 GLU 28 28 28 GLU GLU B . n B 1 29 HIS 29 29 29 HIS HIS B . n B 1 30 LEU 30 30 30 LEU LEU B . n B 1 31 GLU 31 31 31 GLU GLU B . n B 1 32 LYS 32 32 32 LYS LYS B . n B 1 33 TRP 33 33 33 TRP TRP B . n B 1 34 PHE 34 34 34 PHE PHE B . n B 1 35 VAL 35 35 35 VAL VAL B . n B 1 36 THR 36 36 36 THR THR B . n B 1 37 LEU 37 37 37 LEU LEU B . n B 1 38 ALA 38 38 38 ALA ALA B . n B 1 39 GLU 39 39 39 GLU GLU B . n B 1 40 ILE 40 40 40 ILE ILE B . n B 1 41 ILE 41 41 41 ILE ILE B . n B 1 42 ILE 42 42 42 ILE ILE B . n B 1 43 THR 43 43 43 THR THR B . n B 1 44 LYS 44 44 44 LYS LYS B . n B 1 45 SER 45 45 45 SER SER B . n B 1 46 GLU 46 46 46 GLU GLU B . n B 1 47 GLU 47 47 47 GLU GLU B . n B 1 48 LYS 48 48 48 LYS LYS B . n B 1 49 LEU 49 49 49 LEU LEU B . n B 1 50 GLU 50 50 50 GLU GLU B . n B 1 51 GLU 51 51 51 GLU GLU B . n B 1 52 LEU 52 52 52 LEU LEU B . n B 1 53 LYS 53 53 53 LYS LYS B . n B 1 54 GLU 54 54 54 GLU GLU B . n B 1 55 THR 55 55 55 THR THR B . n B 1 56 MET 56 56 56 MET MET B . n B 1 57 GLU 57 57 57 GLU GLU B . n B 1 58 LYS 58 58 58 LYS LYS B . n B 1 59 SER 59 59 59 SER SER B . n B 1 60 ILE 60 60 60 ILE ILE B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 GLU 62 62 62 GLU GLU B . n B 1 63 LEU 63 63 63 LEU LEU B . n B 1 64 ARG 64 64 64 ARG ARG B . n B 1 65 LYS 65 65 65 LYS LYS B . n B 1 66 GLU 66 66 66 GLU GLU B . n B 1 67 ALA 67 67 67 ALA ALA B . n B 1 68 GLU 68 68 68 GLU GLU B . n B 1 69 GLY 69 69 ? ? ? B . n B 1 70 SER 70 70 ? ? ? B . n C 1 1 MET 1 1 ? ? ? C . n C 1 2 SER 2 2 ? ? ? C . n C 1 3 GLY 3 3 ? ? ? C . n C 1 4 MET 4 4 4 MET MET C . n C 1 5 GLU 5 5 5 GLU GLU C . n C 1 6 LYS 6 6 6 LYS LYS C . n C 1 7 PHE 7 7 7 PHE PHE C . n C 1 8 LYS 8 8 8 LYS LYS C . n C 1 9 GLU 9 9 9 GLU GLU C . n C 1 10 GLN 10 10 10 GLN GLN C . n C 1 11 LEU 11 11 11 LEU LEU C . n C 1 12 LEU 12 12 12 LEU LEU C . n C 1 13 GLU 13 13 13 GLU GLU C . n C 1 14 GLU 14 14 14 GLU GLU C . n C 1 15 VAL 15 15 15 VAL VAL C . n C 1 16 LYS 16 16 16 LYS LYS C . n C 1 17 LYS 17 17 17 LYS LYS C . n C 1 18 ILE 18 18 18 ILE ILE C . n C 1 19 VAL 19 19 19 VAL VAL C . n C 1 20 LEU 20 20 20 LEU LEU C . n C 1 21 GLU 21 21 21 GLU GLU C . n C 1 22 THR 22 22 22 THR THR C . n C 1 23 MET 23 23 23 MET MET C . n C 1 24 THR 24 24 24 THR THR C . n C 1 25 LYS 25 25 25 LYS LYS C . n C 1 26 VAL 26 26 26 VAL VAL C . n C 1 27 MET 27 27 27 MET MET C . n C 1 28 GLU 28 28 28 GLU GLU C . n C 1 29 HIS 29 29 29 HIS HIS C . n C 1 30 LEU 30 30 30 LEU LEU C . n C 1 31 GLU 31 31 31 GLU GLU C . n C 1 32 LYS 32 32 32 LYS LYS C . n C 1 33 TRP 33 33 33 TRP TRP C . n C 1 34 PHE 34 34 34 PHE PHE C . n C 1 35 VAL 35 35 35 VAL VAL C . n C 1 36 THR 36 36 36 THR THR C . n C 1 37 LEU 37 37 37 LEU LEU C . n C 1 38 ALA 38 38 38 ALA ALA C . n C 1 39 GLU 39 39 39 GLU GLU C . n C 1 40 ILE 40 40 40 ILE ILE C . n C 1 41 ILE 41 41 41 ILE ILE C . n C 1 42 ILE 42 42 42 ILE ILE C . n C 1 43 THR 43 43 43 THR THR C . n C 1 44 LYS 44 44 44 LYS LYS C . n C 1 45 SER 45 45 45 SER SER C . n C 1 46 GLU 46 46 46 GLU GLU C . n C 1 47 GLU 47 47 47 GLU GLU C . n C 1 48 LYS 48 48 48 LYS LYS C . n C 1 49 LEU 49 49 49 LEU LEU C . n C 1 50 GLU 50 50 50 GLU GLU C . n C 1 51 GLU 51 51 51 GLU GLU C . n C 1 52 LEU 52 52 52 LEU LEU C . n C 1 53 LYS 53 53 53 LYS LYS C . n C 1 54 GLU 54 54 54 GLU GLU C . n C 1 55 THR 55 55 55 THR THR C . n C 1 56 MET 56 56 56 MET MET C . n C 1 57 GLU 57 57 57 GLU GLU C . n C 1 58 LYS 58 58 58 LYS LYS C . n C 1 59 SER 59 59 59 SER SER C . n C 1 60 ILE 60 60 60 ILE ILE C . n C 1 61 GLU 61 61 61 GLU GLU C . n C 1 62 GLU 62 62 62 GLU GLU C . n C 1 63 LEU 63 63 63 LEU LEU C . n C 1 64 ARG 64 64 64 ARG ARG C . n C 1 65 LYS 65 65 65 LYS LYS C . n C 1 66 GLU 66 66 66 GLU GLU C . n C 1 67 ALA 67 67 67 ALA ALA C . n C 1 68 GLU 68 68 68 GLU GLU C . n C 1 69 GLY 69 69 69 GLY GLY C . n C 1 70 SER 70 70 ? ? ? C . n D 1 1 MET 1 1 ? ? ? D . n D 1 2 SER 2 2 ? ? ? D . n D 1 3 GLY 3 3 3 GLY GLY D . n D 1 4 MET 4 4 4 MET MET D . n D 1 5 GLU 5 5 5 GLU GLU D . n D 1 6 LYS 6 6 6 LYS LYS D . n D 1 7 PHE 7 7 7 PHE PHE D . n D 1 8 LYS 8 8 8 LYS LYS D . n D 1 9 GLU 9 9 9 GLU GLU D . n D 1 10 GLN 10 10 10 GLN GLN D . n D 1 11 LEU 11 11 11 LEU LEU D . n D 1 12 LEU 12 12 12 LEU LEU D . n D 1 13 GLU 13 13 13 GLU GLU D . n D 1 14 GLU 14 14 14 GLU GLU D . n D 1 15 VAL 15 15 15 VAL VAL D . n D 1 16 LYS 16 16 16 LYS LYS D . n D 1 17 LYS 17 17 17 LYS LYS D . n D 1 18 ILE 18 18 18 ILE ILE D . n D 1 19 VAL 19 19 19 VAL VAL D . n D 1 20 LEU 20 20 20 LEU LEU D . n D 1 21 GLU 21 21 21 GLU GLU D . n D 1 22 THR 22 22 22 THR THR D . n D 1 23 MET 23 23 23 MET MET D . n D 1 24 THR 24 24 24 THR THR D . n D 1 25 LYS 25 25 25 LYS LYS D . n D 1 26 VAL 26 26 26 VAL VAL D . n D 1 27 MET 27 27 27 MET MET D . n D 1 28 GLU 28 28 28 GLU GLU D . n D 1 29 HIS 29 29 29 HIS HIS D . n D 1 30 LEU 30 30 30 LEU LEU D . n D 1 31 GLU 31 31 31 GLU GLU D . n D 1 32 LYS 32 32 32 LYS LYS D . n D 1 33 TRP 33 33 33 TRP TRP D . n D 1 34 PHE 34 34 34 PHE PHE D . n D 1 35 VAL 35 35 35 VAL VAL D . n D 1 36 THR 36 36 36 THR THR D . n D 1 37 LEU 37 37 37 LEU LEU D . n D 1 38 ALA 38 38 38 ALA ALA D . n D 1 39 GLU 39 39 39 GLU GLU D . n D 1 40 ILE 40 40 40 ILE ILE D . n D 1 41 ILE 41 41 41 ILE ILE D . n D 1 42 ILE 42 42 42 ILE ILE D . n D 1 43 THR 43 43 43 THR THR D . n D 1 44 LYS 44 44 44 LYS LYS D . n D 1 45 SER 45 45 45 SER SER D . n D 1 46 GLU 46 46 46 GLU GLU D . n D 1 47 GLU 47 47 47 GLU GLU D . n D 1 48 LYS 48 48 48 LYS LYS D . n D 1 49 LEU 49 49 49 LEU LEU D . n D 1 50 GLU 50 50 50 GLU GLU D . n D 1 51 GLU 51 51 51 GLU GLU D . n D 1 52 LEU 52 52 52 LEU LEU D . n D 1 53 LYS 53 53 53 LYS LYS D . n D 1 54 GLU 54 54 54 GLU GLU D . n D 1 55 THR 55 55 55 THR THR D . n D 1 56 MET 56 56 56 MET MET D . n D 1 57 GLU 57 57 57 GLU GLU D . n D 1 58 LYS 58 58 58 LYS LYS D . n D 1 59 SER 59 59 59 SER SER D . n D 1 60 ILE 60 60 60 ILE ILE D . n D 1 61 GLU 61 61 61 GLU GLU D . n D 1 62 GLU 62 62 62 GLU GLU D . n D 1 63 LEU 63 63 63 LEU LEU D . n D 1 64 ARG 64 64 64 ARG ARG D . n D 1 65 LYS 65 65 65 LYS LYS D . n D 1 66 GLU 66 66 66 GLU GLU D . n D 1 67 ALA 67 67 67 ALA ALA D . n D 1 68 GLU 68 68 68 GLU GLU D . n D 1 69 GLY 69 69 69 GLY GLY D . n D 1 70 SER 70 70 ? ? ? D . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8D08 _cell.details ? _cell.formula_units_Z ? _cell.length_a 35.867 _cell.length_a_esd ? _cell.length_b 35.867 _cell.length_b_esd ? _cell.length_c 437.996 _cell.length_c_esd ? _cell.volume 563456.314 _cell.volume_esd ? _cell.Z_PDB 32 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8D08 _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8D08 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.12 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.02 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M Lithium sulfate monohydrate 0.1 M BIS-TRIS 25% w/v Polyethylene glycol 3,350 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-04-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97926 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97926 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 138.43 _reflns.entry_id 8D08 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.3 _reflns.d_resolution_low 54.75 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8009 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.67 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.29 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 3.3 _reflns_shell.d_res_low 3.418 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.37 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 435 _reflns_shell.percent_possible_all 95.19 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.639 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 134.25 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8D08 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.30 _refine.ls_d_res_low 54.75 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8009 _refine.ls_number_reflns_R_free 406 _refine.ls_number_reflns_R_work 7603 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.53 _refine.ls_percent_reflns_R_free 5.07 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2526 _refine.ls_R_factor_R_free 0.2979 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2502 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.31 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'Design model' _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 36.0633 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5844 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.30 _refine_hist.d_res_low 54.75 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2208 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2208 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0111 ? 2224 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.3704 ? 2952 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0553 ? 348 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0069 ? 356 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 21.8771 ? 912 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.30 3.78 . . 156 2403 94.25 . . . 0.4004 . 0.3386 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.78 4.76 . . 134 2575 98.54 . . . 0.3346 . 0.2823 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.76 54.75 . . 116 2625 99.75 . . . 0.2514 . 0.2173 . . . . . . . . . . . # _struct.entry_id 8D08 _struct.title 'Hallucinated C4 protein assembly HALC4_135' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8D08 _struct_keywords.text 'De novo design Hallucination Cyclic Oligomer ProteinMPNN, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8D08 _struct_ref.pdbx_db_accession 8D08 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8D08 A 1 ? 70 ? 8D08 1 ? 70 ? 1 70 2 1 8D08 B 1 ? 70 ? 8D08 1 ? 70 ? 1 70 3 1 8D08 C 1 ? 70 ? 8D08 1 ? 70 ? 1 70 4 1 8D08 D 1 ? 70 ? 8D08 1 ? 70 ? 1 70 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 10070 ? 1 MORE -117 ? 1 'SSA (A^2)' 13480 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 4 ? LYS A 44 ? MET A 4 LYS A 44 1 ? 41 HELX_P HELX_P2 AA2 SER A 45 ? GLY A 69 ? SER A 45 GLY A 69 1 ? 25 HELX_P HELX_P3 AA3 GLU B 5 ? THR B 43 ? GLU B 5 THR B 43 1 ? 39 HELX_P HELX_P4 AA4 SER B 45 ? ALA B 67 ? SER B 45 ALA B 67 1 ? 23 HELX_P HELX_P5 AA5 GLU C 5 ? LYS C 44 ? GLU C 5 LYS C 44 1 ? 40 HELX_P HELX_P6 AA6 SER C 45 ? GLU C 68 ? SER C 45 GLU C 68 1 ? 24 HELX_P HELX_P7 AA7 MET D 4 ? LYS D 44 ? MET D 4 LYS D 44 1 ? 41 HELX_P HELX_P8 AA8 GLU D 46 ? GLU D 68 ? GLU D 46 GLU D 68 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 55 ? ? -62.56 -74.18 2 1 MET A 56 ? ? -36.01 -34.29 3 1 GLU A 68 ? ? -79.96 -77.76 4 1 ALA B 67 ? ? -58.63 -9.25 5 1 LYS D 44 ? ? 71.57 30.72 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/4 3 y+1/2,-x+1/2,z+3/4 4 x+1/2,-y+1/2,-z+3/4 5 -x+1/2,y+1/2,-z+1/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -12.899151038 _pdbx_refine_tls.origin_y 21.4432826255 _pdbx_refine_tls.origin_z -28.8402410023 _pdbx_refine_tls.T[1][1] 0.917333405591 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0614426592217 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.130585629795 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.776171753767 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.307033348572 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.962698432451 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 3.89848071151 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.329713496774 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -2.25002725419 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 2.01867207716 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 2.11159562562 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 8.68923714337 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0486543030644 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.372223909012 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.229219482641 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0731887784446 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.021284280942 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.339247289807 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.8282675921 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.326499843692 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.022330695286 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 4 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id D _pdbx_refine_tls_group.end_label_seq_id 67 _pdbx_refine_tls_group.end_auth_asym_id D _pdbx_refine_tls_group.end_auth_seq_id 69 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A SER 70 ? A SER 70 5 1 Y 1 B MET 1 ? B MET 1 6 1 Y 1 B SER 2 ? B SER 2 7 1 Y 1 B GLY 3 ? B GLY 3 8 1 Y 1 B GLY 69 ? B GLY 69 9 1 Y 1 B SER 70 ? B SER 70 10 1 Y 1 C MET 1 ? C MET 1 11 1 Y 1 C SER 2 ? C SER 2 12 1 Y 1 C GLY 3 ? C GLY 3 13 1 Y 1 C SER 70 ? C SER 70 14 1 Y 1 D MET 1 ? D MET 1 15 1 Y 1 D SER 2 ? D SER 2 16 1 Y 1 D SER 70 ? D SER 70 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 GLN N N N N 41 GLN CA C N S 42 GLN C C N N 43 GLN O O N N 44 GLN CB C N N 45 GLN CG C N N 46 GLN CD C N N 47 GLN OE1 O N N 48 GLN NE2 N N N 49 GLN OXT O N N 50 GLN H H N N 51 GLN H2 H N N 52 GLN HA H N N 53 GLN HB2 H N N 54 GLN HB3 H N N 55 GLN HG2 H N N 56 GLN HG3 H N N 57 GLN HE21 H N N 58 GLN HE22 H N N 59 GLN HXT H N N 60 GLU N N N N 61 GLU CA C N S 62 GLU C C N N 63 GLU O O N N 64 GLU CB C N N 65 GLU CG C N N 66 GLU CD C N N 67 GLU OE1 O N N 68 GLU OE2 O N N 69 GLU OXT O N N 70 GLU H H N N 71 GLU H2 H N N 72 GLU HA H N N 73 GLU HB2 H N N 74 GLU HB3 H N N 75 GLU HG2 H N N 76 GLU HG3 H N N 77 GLU HE2 H N N 78 GLU HXT H N N 79 GLY N N N N 80 GLY CA C N N 81 GLY C C N N 82 GLY O O N N 83 GLY OXT O N N 84 GLY H H N N 85 GLY H2 H N N 86 GLY HA2 H N N 87 GLY HA3 H N N 88 GLY HXT H N N 89 HIS N N N N 90 HIS CA C N S 91 HIS C C N N 92 HIS O O N N 93 HIS CB C N N 94 HIS CG C Y N 95 HIS ND1 N Y N 96 HIS CD2 C Y N 97 HIS CE1 C Y N 98 HIS NE2 N Y N 99 HIS OXT O N N 100 HIS H H N N 101 HIS H2 H N N 102 HIS HA H N N 103 HIS HB2 H N N 104 HIS HB3 H N N 105 HIS HD1 H N N 106 HIS HD2 H N N 107 HIS HE1 H N N 108 HIS HE2 H N N 109 HIS HXT H N N 110 ILE N N N N 111 ILE CA C N S 112 ILE C C N N 113 ILE O O N N 114 ILE CB C N S 115 ILE CG1 C N N 116 ILE CG2 C N N 117 ILE CD1 C N N 118 ILE OXT O N N 119 ILE H H N N 120 ILE H2 H N N 121 ILE HA H N N 122 ILE HB H N N 123 ILE HG12 H N N 124 ILE HG13 H N N 125 ILE HG21 H N N 126 ILE HG22 H N N 127 ILE HG23 H N N 128 ILE HD11 H N N 129 ILE HD12 H N N 130 ILE HD13 H N N 131 ILE HXT H N N 132 LEU N N N N 133 LEU CA C N S 134 LEU C C N N 135 LEU O O N N 136 LEU CB C N N 137 LEU CG C N N 138 LEU CD1 C N N 139 LEU CD2 C N N 140 LEU OXT O N N 141 LEU H H N N 142 LEU H2 H N N 143 LEU HA H N N 144 LEU HB2 H N N 145 LEU HB3 H N N 146 LEU HG H N N 147 LEU HD11 H N N 148 LEU HD12 H N N 149 LEU HD13 H N N 150 LEU HD21 H N N 151 LEU HD22 H N N 152 LEU HD23 H N N 153 LEU HXT H N N 154 LYS N N N N 155 LYS CA C N S 156 LYS C C N N 157 LYS O O N N 158 LYS CB C N N 159 LYS CG C N N 160 LYS CD C N N 161 LYS CE C N N 162 LYS NZ N N N 163 LYS OXT O N N 164 LYS H H N N 165 LYS H2 H N N 166 LYS HA H N N 167 LYS HB2 H N N 168 LYS HB3 H N N 169 LYS HG2 H N N 170 LYS HG3 H N N 171 LYS HD2 H N N 172 LYS HD3 H N N 173 LYS HE2 H N N 174 LYS HE3 H N N 175 LYS HZ1 H N N 176 LYS HZ2 H N N 177 LYS HZ3 H N N 178 LYS HXT H N N 179 MET N N N N 180 MET CA C N S 181 MET C C N N 182 MET O O N N 183 MET CB C N N 184 MET CG C N N 185 MET SD S N N 186 MET CE C N N 187 MET OXT O N N 188 MET H H N N 189 MET H2 H N N 190 MET HA H N N 191 MET HB2 H N N 192 MET HB3 H N N 193 MET HG2 H N N 194 MET HG3 H N N 195 MET HE1 H N N 196 MET HE2 H N N 197 MET HE3 H N N 198 MET HXT H N N 199 PHE N N N N 200 PHE CA C N S 201 PHE C C N N 202 PHE O O N N 203 PHE CB C N N 204 PHE CG C Y N 205 PHE CD1 C Y N 206 PHE CD2 C Y N 207 PHE CE1 C Y N 208 PHE CE2 C Y N 209 PHE CZ C Y N 210 PHE OXT O N N 211 PHE H H N N 212 PHE H2 H N N 213 PHE HA H N N 214 PHE HB2 H N N 215 PHE HB3 H N N 216 PHE HD1 H N N 217 PHE HD2 H N N 218 PHE HE1 H N N 219 PHE HE2 H N N 220 PHE HZ H N N 221 PHE HXT H N N 222 SER N N N N 223 SER CA C N S 224 SER C C N N 225 SER O O N N 226 SER CB C N N 227 SER OG O N N 228 SER OXT O N N 229 SER H H N N 230 SER H2 H N N 231 SER HA H N N 232 SER HB2 H N N 233 SER HB3 H N N 234 SER HG H N N 235 SER HXT H N N 236 THR N N N N 237 THR CA C N S 238 THR C C N N 239 THR O O N N 240 THR CB C N R 241 THR OG1 O N N 242 THR CG2 C N N 243 THR OXT O N N 244 THR H H N N 245 THR H2 H N N 246 THR HA H N N 247 THR HB H N N 248 THR HG1 H N N 249 THR HG21 H N N 250 THR HG22 H N N 251 THR HG23 H N N 252 THR HXT H N N 253 TRP N N N N 254 TRP CA C N S 255 TRP C C N N 256 TRP O O N N 257 TRP CB C N N 258 TRP CG C Y N 259 TRP CD1 C Y N 260 TRP CD2 C Y N 261 TRP NE1 N Y N 262 TRP CE2 C Y N 263 TRP CE3 C Y N 264 TRP CZ2 C Y N 265 TRP CZ3 C Y N 266 TRP CH2 C Y N 267 TRP OXT O N N 268 TRP H H N N 269 TRP H2 H N N 270 TRP HA H N N 271 TRP HB2 H N N 272 TRP HB3 H N N 273 TRP HD1 H N N 274 TRP HE1 H N N 275 TRP HE3 H N N 276 TRP HZ2 H N N 277 TRP HZ3 H N N 278 TRP HH2 H N N 279 TRP HXT H N N 280 VAL N N N N 281 VAL CA C N S 282 VAL C C N N 283 VAL O O N N 284 VAL CB C N N 285 VAL CG1 C N N 286 VAL CG2 C N N 287 VAL OXT O N N 288 VAL H H N N 289 VAL H2 H N N 290 VAL HA H N N 291 VAL HB H N N 292 VAL HG11 H N N 293 VAL HG12 H N N 294 VAL HG13 H N N 295 VAL HG21 H N N 296 VAL HG22 H N N 297 VAL HG23 H N N 298 VAL HXT H N N 299 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 GLN N CA sing N N 39 GLN N H sing N N 40 GLN N H2 sing N N 41 GLN CA C sing N N 42 GLN CA CB sing N N 43 GLN CA HA sing N N 44 GLN C O doub N N 45 GLN C OXT sing N N 46 GLN CB CG sing N N 47 GLN CB HB2 sing N N 48 GLN CB HB3 sing N N 49 GLN CG CD sing N N 50 GLN CG HG2 sing N N 51 GLN CG HG3 sing N N 52 GLN CD OE1 doub N N 53 GLN CD NE2 sing N N 54 GLN NE2 HE21 sing N N 55 GLN NE2 HE22 sing N N 56 GLN OXT HXT sing N N 57 GLU N CA sing N N 58 GLU N H sing N N 59 GLU N H2 sing N N 60 GLU CA C sing N N 61 GLU CA CB sing N N 62 GLU CA HA sing N N 63 GLU C O doub N N 64 GLU C OXT sing N N 65 GLU CB CG sing N N 66 GLU CB HB2 sing N N 67 GLU CB HB3 sing N N 68 GLU CG CD sing N N 69 GLU CG HG2 sing N N 70 GLU CG HG3 sing N N 71 GLU CD OE1 doub N N 72 GLU CD OE2 sing N N 73 GLU OE2 HE2 sing N N 74 GLU OXT HXT sing N N 75 GLY N CA sing N N 76 GLY N H sing N N 77 GLY N H2 sing N N 78 GLY CA C sing N N 79 GLY CA HA2 sing N N 80 GLY CA HA3 sing N N 81 GLY C O doub N N 82 GLY C OXT sing N N 83 GLY OXT HXT sing N N 84 HIS N CA sing N N 85 HIS N H sing N N 86 HIS N H2 sing N N 87 HIS CA C sing N N 88 HIS CA CB sing N N 89 HIS CA HA sing N N 90 HIS C O doub N N 91 HIS C OXT sing N N 92 HIS CB CG sing N N 93 HIS CB HB2 sing N N 94 HIS CB HB3 sing N N 95 HIS CG ND1 sing Y N 96 HIS CG CD2 doub Y N 97 HIS ND1 CE1 doub Y N 98 HIS ND1 HD1 sing N N 99 HIS CD2 NE2 sing Y N 100 HIS CD2 HD2 sing N N 101 HIS CE1 NE2 sing Y N 102 HIS CE1 HE1 sing N N 103 HIS NE2 HE2 sing N N 104 HIS OXT HXT sing N N 105 ILE N CA sing N N 106 ILE N H sing N N 107 ILE N H2 sing N N 108 ILE CA C sing N N 109 ILE CA CB sing N N 110 ILE CA HA sing N N 111 ILE C O doub N N 112 ILE C OXT sing N N 113 ILE CB CG1 sing N N 114 ILE CB CG2 sing N N 115 ILE CB HB sing N N 116 ILE CG1 CD1 sing N N 117 ILE CG1 HG12 sing N N 118 ILE CG1 HG13 sing N N 119 ILE CG2 HG21 sing N N 120 ILE CG2 HG22 sing N N 121 ILE CG2 HG23 sing N N 122 ILE CD1 HD11 sing N N 123 ILE CD1 HD12 sing N N 124 ILE CD1 HD13 sing N N 125 ILE OXT HXT sing N N 126 LEU N CA sing N N 127 LEU N H sing N N 128 LEU N H2 sing N N 129 LEU CA C sing N N 130 LEU CA CB sing N N 131 LEU CA HA sing N N 132 LEU C O doub N N 133 LEU C OXT sing N N 134 LEU CB CG sing N N 135 LEU CB HB2 sing N N 136 LEU CB HB3 sing N N 137 LEU CG CD1 sing N N 138 LEU CG CD2 sing N N 139 LEU CG HG sing N N 140 LEU CD1 HD11 sing N N 141 LEU CD1 HD12 sing N N 142 LEU CD1 HD13 sing N N 143 LEU CD2 HD21 sing N N 144 LEU CD2 HD22 sing N N 145 LEU CD2 HD23 sing N N 146 LEU OXT HXT sing N N 147 LYS N CA sing N N 148 LYS N H sing N N 149 LYS N H2 sing N N 150 LYS CA C sing N N 151 LYS CA CB sing N N 152 LYS CA HA sing N N 153 LYS C O doub N N 154 LYS C OXT sing N N 155 LYS CB CG sing N N 156 LYS CB HB2 sing N N 157 LYS CB HB3 sing N N 158 LYS CG CD sing N N 159 LYS CG HG2 sing N N 160 LYS CG HG3 sing N N 161 LYS CD CE sing N N 162 LYS CD HD2 sing N N 163 LYS CD HD3 sing N N 164 LYS CE NZ sing N N 165 LYS CE HE2 sing N N 166 LYS CE HE3 sing N N 167 LYS NZ HZ1 sing N N 168 LYS NZ HZ2 sing N N 169 LYS NZ HZ3 sing N N 170 LYS OXT HXT sing N N 171 MET N CA sing N N 172 MET N H sing N N 173 MET N H2 sing N N 174 MET CA C sing N N 175 MET CA CB sing N N 176 MET CA HA sing N N 177 MET C O doub N N 178 MET C OXT sing N N 179 MET CB CG sing N N 180 MET CB HB2 sing N N 181 MET CB HB3 sing N N 182 MET CG SD sing N N 183 MET CG HG2 sing N N 184 MET CG HG3 sing N N 185 MET SD CE sing N N 186 MET CE HE1 sing N N 187 MET CE HE2 sing N N 188 MET CE HE3 sing N N 189 MET OXT HXT sing N N 190 PHE N CA sing N N 191 PHE N H sing N N 192 PHE N H2 sing N N 193 PHE CA C sing N N 194 PHE CA CB sing N N 195 PHE CA HA sing N N 196 PHE C O doub N N 197 PHE C OXT sing N N 198 PHE CB CG sing N N 199 PHE CB HB2 sing N N 200 PHE CB HB3 sing N N 201 PHE CG CD1 doub Y N 202 PHE CG CD2 sing Y N 203 PHE CD1 CE1 sing Y N 204 PHE CD1 HD1 sing N N 205 PHE CD2 CE2 doub Y N 206 PHE CD2 HD2 sing N N 207 PHE CE1 CZ doub Y N 208 PHE CE1 HE1 sing N N 209 PHE CE2 CZ sing Y N 210 PHE CE2 HE2 sing N N 211 PHE CZ HZ sing N N 212 PHE OXT HXT sing N N 213 SER N CA sing N N 214 SER N H sing N N 215 SER N H2 sing N N 216 SER CA C sing N N 217 SER CA CB sing N N 218 SER CA HA sing N N 219 SER C O doub N N 220 SER C OXT sing N N 221 SER CB OG sing N N 222 SER CB HB2 sing N N 223 SER CB HB3 sing N N 224 SER OG HG sing N N 225 SER OXT HXT sing N N 226 THR N CA sing N N 227 THR N H sing N N 228 THR N H2 sing N N 229 THR CA C sing N N 230 THR CA CB sing N N 231 THR CA HA sing N N 232 THR C O doub N N 233 THR C OXT sing N N 234 THR CB OG1 sing N N 235 THR CB CG2 sing N N 236 THR CB HB sing N N 237 THR OG1 HG1 sing N N 238 THR CG2 HG21 sing N N 239 THR CG2 HG22 sing N N 240 THR CG2 HG23 sing N N 241 THR OXT HXT sing N N 242 TRP N CA sing N N 243 TRP N H sing N N 244 TRP N H2 sing N N 245 TRP CA C sing N N 246 TRP CA CB sing N N 247 TRP CA HA sing N N 248 TRP C O doub N N 249 TRP C OXT sing N N 250 TRP CB CG sing N N 251 TRP CB HB2 sing N N 252 TRP CB HB3 sing N N 253 TRP CG CD1 doub Y N 254 TRP CG CD2 sing Y N 255 TRP CD1 NE1 sing Y N 256 TRP CD1 HD1 sing N N 257 TRP CD2 CE2 doub Y N 258 TRP CD2 CE3 sing Y N 259 TRP NE1 CE2 sing Y N 260 TRP NE1 HE1 sing N N 261 TRP CE2 CZ2 sing Y N 262 TRP CE3 CZ3 doub Y N 263 TRP CE3 HE3 sing N N 264 TRP CZ2 CH2 doub Y N 265 TRP CZ2 HZ2 sing N N 266 TRP CZ3 CH2 sing Y N 267 TRP CZ3 HZ3 sing N N 268 TRP CH2 HH2 sing N N 269 TRP OXT HXT sing N N 270 VAL N CA sing N N 271 VAL N H sing N N 272 VAL N H2 sing N N 273 VAL CA C sing N N 274 VAL CA CB sing N N 275 VAL CA HA sing N N 276 VAL C O doub N N 277 VAL C OXT sing N N 278 VAL CB CG1 sing N N 279 VAL CB CG2 sing N N 280 VAL CB HB sing N N 281 VAL CG1 HG11 sing N N 282 VAL CG1 HG12 sing N N 283 VAL CG1 HG13 sing N N 284 VAL CG2 HG21 sing N N 285 VAL CG2 HG22 sing N N 286 VAL CG2 HG23 sing N N 287 VAL OXT HXT sing N N 288 # _pdbx_audit_support.funding_organization 'Howard Hughes Medical Institute (HHMI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'Design model' # _space_group.name_H-M_alt 'P 41 21 2' _space_group.name_Hall 'P 4abw 2nw' _space_group.IT_number 92 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 8D08 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.027881 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027881 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.002283 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_