data_8D52 # _entry.id 8D52 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8D52 pdb_00008d52 10.2210/pdb8d52/pdb WWPDB D_1000266036 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-06-14 2 'Structure model' 1 1 2023-10-25 3 'Structure model' 2 0 2023-11-15 4 'Structure model' 2 1 2023-12-27 5 'Structure model' 2 2 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Atomic model' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Database references' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 3 'Structure model' atom_site 5 3 'Structure model' atom_site_anisotrop 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' pdbx_validate_main_chain_plane 9 3 'Structure model' pdbx_validate_peptide_omega 10 3 'Structure model' struct_conn 11 4 'Structure model' citation 12 4 'Structure model' citation_author 13 5 'Structure model' pdbx_entry_details 14 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_atom_site.auth_atom_id' 2 3 'Structure model' '_atom_site.label_atom_id' 3 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 4 3 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' 5 3 'Structure model' '_chem_comp_atom.atom_id' 6 3 'Structure model' '_chem_comp_bond.atom_id_1' 7 3 'Structure model' '_chem_comp_bond.atom_id_2' 8 3 'Structure model' '_pdbx_validate_peptide_omega.auth_comp_id_1' 9 3 'Structure model' '_pdbx_validate_peptide_omega.auth_comp_id_2' 10 3 'Structure model' '_pdbx_validate_peptide_omega.auth_seq_id_1' 11 3 'Structure model' '_pdbx_validate_peptide_omega.auth_seq_id_2' 12 3 'Structure model' '_pdbx_validate_peptide_omega.omega' 13 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 14 4 'Structure model' '_citation.country' 15 4 'Structure model' '_citation.journal_abbrev' 16 4 'Structure model' '_citation.journal_id_ASTM' 17 4 'Structure model' '_citation.journal_id_CSD' 18 4 'Structure model' '_citation.journal_id_ISSN' 19 4 'Structure model' '_citation.journal_volume' 20 4 'Structure model' '_citation.page_first' 21 4 'Structure model' '_citation.page_last' 22 4 'Structure model' '_citation.pdbx_database_id_DOI' 23 4 'Structure model' '_citation.pdbx_database_id_PubMed' 24 4 'Structure model' '_citation.title' 25 4 'Structure model' '_citation.year' 26 5 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8D52 _pdbx_database_status.recvd_initial_deposition_date 2022-06-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email gellman@chem.wisc.edu _pdbx_contact_author.name_first Samuel _pdbx_contact_author.name_last Gellman _pdbx_contact_author.name_mi H _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5617-0058 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yu, Z.' 1 0000-0003-2092-9960 'Kreitler, D.F.' 2 0000-0003-4758-7913 'Gellman, S.H.' 3 0000-0001-5617-0058 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Angew.Chem.Int.Ed.Engl. _citation.journal_id_ASTM ACIEAY _citation.journal_id_CSD 0179 _citation.journal_id_ISSN 1521-3773 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 62 _citation.language ? _citation.page_first e202308100 _citation.page_last e202308100 _citation.title 'Harnessing Aromatic-Histidine Interactions through Synergistic Backbone Extension and Side Chain Modification.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/anie.202308100 _citation.pdbx_database_id_PubMed 37587780 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yu, Z.' 1 0000-0003-2092-9960 primary 'Kreitler, D.F.' 2 0000-0003-4758-7913 primary 'Chiu, Y.T.T.' 3 0000-0001-5449-8391 primary 'Xu, R.' 4 0000-0001-8477-2718 primary 'Bruchs, A.T.' 5 0000-0003-0819-3639 primary 'Bingman, C.A.' 6 0000-0002-3073-5089 primary 'Gellman, S.H.' 7 0000-0001-5617-0058 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Parathyroid hormone/parathyroid hormone-related peptide receptor' 11995.670 1 ? ? ? ? 2 polymer syn 'PTHrP[1-36]' 2833.294 1 ? 'I31 substituted by (2-naphthyl)-beta-3-homoalanine' ? 'synthetic peptide' 3 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 4 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 5 water nat water 18.015 44 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PTH/PTHrP type I receptor,PTH/PTHr receptor,Parathyroid hormone 1 receptor,PTH1 receptor' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GDDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRN GSWELVPGHNRTWANYSECVKFL ; ;GDDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRN GSWELVPGHNRTWANYSECVKFL ; A ? 2 'polypeptide(L)' no yes 'IQDLRRRFFLHHLIAE(QF0)HTAEI' IQDLRRRFFLHHLIAEXHTAEI B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 1,2-ETHANEDIOL EDO 4 'ZINC ION' ZN 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASP n 1 3 ASP n 1 4 VAL n 1 5 MET n 1 6 THR n 1 7 LYS n 1 8 GLU n 1 9 GLU n 1 10 GLN n 1 11 ILE n 1 12 PHE n 1 13 LEU n 1 14 LEU n 1 15 HIS n 1 16 ARG n 1 17 ALA n 1 18 GLN n 1 19 ALA n 1 20 GLN n 1 21 CYS n 1 22 GLU n 1 23 LYS n 1 24 ARG n 1 25 LEU n 1 26 LYS n 1 27 GLU n 1 28 VAL n 1 29 LEU n 1 30 GLN n 1 31 ARG n 1 32 PRO n 1 33 ALA n 1 34 GLY n 1 35 ARG n 1 36 PRO n 1 37 CYS n 1 38 LEU n 1 39 PRO n 1 40 GLU n 1 41 TRP n 1 42 ASP n 1 43 HIS n 1 44 ILE n 1 45 LEU n 1 46 CYS n 1 47 TRP n 1 48 PRO n 1 49 LEU n 1 50 GLY n 1 51 ALA n 1 52 PRO n 1 53 GLY n 1 54 GLU n 1 55 VAL n 1 56 VAL n 1 57 ALA n 1 58 VAL n 1 59 PRO n 1 60 CYS n 1 61 PRO n 1 62 ASP n 1 63 TYR n 1 64 ILE n 1 65 TYR n 1 66 ASP n 1 67 PHE n 1 68 ASN n 1 69 HIS n 1 70 LYS n 1 71 GLY n 1 72 HIS n 1 73 ALA n 1 74 TYR n 1 75 ARG n 1 76 ARG n 1 77 CYS n 1 78 ASP n 1 79 ARG n 1 80 ASN n 1 81 GLY n 1 82 SER n 1 83 TRP n 1 84 GLU n 1 85 LEU n 1 86 VAL n 1 87 PRO n 1 88 GLY n 1 89 HIS n 1 90 ASN n 1 91 ARG n 1 92 THR n 1 93 TRP n 1 94 ALA n 1 95 ASN n 1 96 TYR n 1 97 SER n 1 98 GLU n 1 99 CYS n 1 100 VAL n 1 101 LYS n 1 102 PHE n 1 103 LEU n 2 1 ILE n 2 2 GLN n 2 3 ASP n 2 4 LEU n 2 5 ARG n 2 6 ARG n 2 7 ARG n 2 8 PHE n 2 9 PHE n 2 10 LEU n 2 11 HIS n 2 12 HIS n 2 13 LEU n 2 14 ILE n 2 15 ALA n 2 16 GLU n 2 17 QF0 n 2 18 HIS n 2 19 THR n 2 20 ALA n 2 21 GLU n 2 22 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 103 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PTH1R, PTHR, PTHR1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 22 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 QF0 non-polymer . '(3S)-3-amino-4-(naphthalen-2-yl)butanoic acid' ? 'C14 H15 N O2' 229.274 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 28 ? ? ? A . n A 1 2 ASP 2 29 ? ? ? A . n A 1 3 ASP 3 30 30 ASP ASP A . n A 1 4 VAL 4 31 31 VAL VAL A . n A 1 5 MET 5 32 32 MET MET A . n A 1 6 THR 6 33 33 THR THR A . n A 1 7 LYS 7 34 34 LYS LYS A . n A 1 8 GLU 8 35 35 GLU GLU A . n A 1 9 GLU 9 36 36 GLU GLU A . n A 1 10 GLN 10 37 37 GLN GLN A . n A 1 11 ILE 11 38 38 ILE ILE A . n A 1 12 PHE 12 39 39 PHE PHE A . n A 1 13 LEU 13 40 40 LEU LEU A . n A 1 14 LEU 14 41 41 LEU LEU A . n A 1 15 HIS 15 42 42 HIS HIS A . n A 1 16 ARG 16 43 43 ARG ARG A . n A 1 17 ALA 17 44 44 ALA ALA A . n A 1 18 GLN 18 45 45 GLN GLN A . n A 1 19 ALA 19 46 46 ALA ALA A . n A 1 20 GLN 20 47 47 GLN GLN A . n A 1 21 CYS 21 48 48 CYS CYS A . n A 1 22 GLU 22 49 49 GLU GLU A . n A 1 23 LYS 23 50 50 LYS LYS A . n A 1 24 ARG 24 51 51 ARG ARG A . n A 1 25 LEU 25 52 52 LEU LEU A . n A 1 26 LYS 26 53 53 LYS LYS A . n A 1 27 GLU 27 54 54 GLU GLU A . n A 1 28 VAL 28 55 55 VAL VAL A . n A 1 29 LEU 29 56 56 LEU LEU A . n A 1 30 GLN 30 57 57 GLN GLN A . n A 1 31 ARG 31 58 58 ARG ARG A . n A 1 32 PRO 32 59 59 PRO PRO A . n A 1 33 ALA 33 60 60 ALA ALA A . n A 1 34 GLY 34 105 105 GLY GLY A . n A 1 35 ARG 35 106 106 ARG ARG A . n A 1 36 PRO 36 107 107 PRO PRO A . n A 1 37 CYS 37 108 108 CYS CYS A . n A 1 38 LEU 38 109 109 LEU LEU A . n A 1 39 PRO 39 110 110 PRO PRO A . n A 1 40 GLU 40 111 111 GLU GLU A . n A 1 41 TRP 41 112 112 TRP TRP A . n A 1 42 ASP 42 113 113 ASP ASP A . n A 1 43 HIS 43 114 114 HIS HIS A . n A 1 44 ILE 44 115 115 ILE ILE A . n A 1 45 LEU 45 116 116 LEU LEU A . n A 1 46 CYS 46 117 117 CYS CYS A . n A 1 47 TRP 47 118 118 TRP TRP A . n A 1 48 PRO 48 119 119 PRO PRO A . n A 1 49 LEU 49 120 120 LEU LEU A . n A 1 50 GLY 50 121 121 GLY GLY A . n A 1 51 ALA 51 122 122 ALA ALA A . n A 1 52 PRO 52 123 123 PRO PRO A . n A 1 53 GLY 53 124 124 GLY GLY A . n A 1 54 GLU 54 125 125 GLU GLU A . n A 1 55 VAL 55 126 126 VAL VAL A . n A 1 56 VAL 56 127 127 VAL VAL A . n A 1 57 ALA 57 128 128 ALA ALA A . n A 1 58 VAL 58 129 129 VAL VAL A . n A 1 59 PRO 59 130 130 PRO PRO A . n A 1 60 CYS 60 131 131 CYS CYS A . n A 1 61 PRO 61 132 132 PRO PRO A . n A 1 62 ASP 62 133 133 ASP ASP A . n A 1 63 TYR 63 134 134 TYR TYR A . n A 1 64 ILE 64 135 135 ILE ILE A . n A 1 65 TYR 65 136 136 TYR TYR A . n A 1 66 ASP 66 137 137 ASP ASP A . n A 1 67 PHE 67 138 138 PHE PHE A . n A 1 68 ASN 68 139 139 ASN ASN A . n A 1 69 HIS 69 140 140 HIS HIS A . n A 1 70 LYS 70 141 141 LYS LYS A . n A 1 71 GLY 71 142 142 GLY GLY A . n A 1 72 HIS 72 143 143 HIS HIS A . n A 1 73 ALA 73 144 144 ALA ALA A . n A 1 74 TYR 74 145 145 TYR TYR A . n A 1 75 ARG 75 146 146 ARG ARG A . n A 1 76 ARG 76 147 147 ARG ARG A . n A 1 77 CYS 77 148 148 CYS CYS A . n A 1 78 ASP 78 149 149 ASP ASP A . n A 1 79 ARG 79 150 150 ARG ARG A . n A 1 80 ASN 80 151 151 ASN ASN A . n A 1 81 GLY 81 152 152 GLY GLY A . n A 1 82 SER 82 153 153 SER SER A . n A 1 83 TRP 83 154 154 TRP TRP A . n A 1 84 GLU 84 155 155 GLU GLU A . n A 1 85 LEU 85 156 156 LEU LEU A . n A 1 86 VAL 86 157 157 VAL VAL A . n A 1 87 PRO 87 158 158 PRO PRO A . n A 1 88 GLY 88 159 159 GLY GLY A . n A 1 89 HIS 89 160 160 HIS HIS A . n A 1 90 ASN 90 161 161 ASN ASN A . n A 1 91 ARG 91 162 162 ARG ARG A . n A 1 92 THR 92 163 163 THR THR A . n A 1 93 TRP 93 164 164 TRP TRP A . n A 1 94 ALA 94 165 165 ALA ALA A . n A 1 95 ASN 95 166 166 ASN ASN A . n A 1 96 TYR 96 167 167 TYR TYR A . n A 1 97 SER 97 168 168 SER SER A . n A 1 98 GLU 98 169 169 GLU GLU A . n A 1 99 CYS 99 170 170 CYS CYS A . n A 1 100 VAL 100 171 171 VAL VAL A . n A 1 101 LYS 101 172 172 LYS LYS A . n A 1 102 PHE 102 173 173 PHE PHE A . n A 1 103 LEU 103 174 174 LEU LEU A . n B 2 1 ILE 1 15 15 ILE ILE B . n B 2 2 GLN 2 16 16 GLN GLN B . n B 2 3 ASP 3 17 17 ASP ASP B . n B 2 4 LEU 4 18 18 LEU LEU B . n B 2 5 ARG 5 19 19 ARG ARG B . n B 2 6 ARG 6 20 20 ARG ARG B . n B 2 7 ARG 7 21 21 ARG ARG B . n B 2 8 PHE 8 22 22 PHE PHE B . n B 2 9 PHE 9 23 23 PHE PHE B . n B 2 10 LEU 10 24 24 LEU LEU B . n B 2 11 HIS 11 25 25 HIS HIS B . n B 2 12 HIS 12 26 26 HIS HIS B . n B 2 13 LEU 13 27 27 LEU LEU B . n B 2 14 ILE 14 28 28 ILE ILE B . n B 2 15 ALA 15 29 29 ALA ALA B . n B 2 16 GLU 16 30 30 GLU GLU B . n B 2 17 QF0 17 31 31 QF0 NP9 B . n B 2 18 HIS 18 32 32 HIS HIS B . n B 2 19 THR 19 33 33 THR THR B . n B 2 20 ALA 20 34 34 ALA ALA B . n B 2 21 GLU 21 35 35 GLU GLU B . n B 2 22 ILE 22 36 ? ? ? B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id QF0 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id QF0 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 EDO 1 201 101 EDO EDO A . D 4 ZN 1 101 1 ZN ZN B . E 5 HOH 1 301 33 HOH HOH A . E 5 HOH 2 302 3 HOH HOH A . E 5 HOH 3 303 38 HOH HOH A . E 5 HOH 4 304 22 HOH HOH A . E 5 HOH 5 305 10 HOH HOH A . E 5 HOH 6 306 9 HOH HOH A . E 5 HOH 7 307 29 HOH HOH A . E 5 HOH 8 308 19 HOH HOH A . E 5 HOH 9 309 11 HOH HOH A . E 5 HOH 10 310 6 HOH HOH A . E 5 HOH 11 311 5 HOH HOH A . E 5 HOH 12 312 26 HOH HOH A . E 5 HOH 13 313 17 HOH HOH A . E 5 HOH 14 314 15 HOH HOH A . E 5 HOH 15 315 1 HOH HOH A . E 5 HOH 16 316 4 HOH HOH A . E 5 HOH 17 317 28 HOH HOH A . E 5 HOH 18 318 37 HOH HOH A . E 5 HOH 19 319 39 HOH HOH A . E 5 HOH 20 320 41 HOH HOH A . E 5 HOH 21 321 8 HOH HOH A . E 5 HOH 22 322 12 HOH HOH A . E 5 HOH 23 323 2 HOH HOH A . E 5 HOH 24 324 34 HOH HOH A . E 5 HOH 25 325 32 HOH HOH A . E 5 HOH 26 326 36 HOH HOH A . E 5 HOH 27 327 30 HOH HOH A . E 5 HOH 28 328 27 HOH HOH A . E 5 HOH 29 329 24 HOH HOH A . E 5 HOH 30 330 20 HOH HOH A . E 5 HOH 31 331 23 HOH HOH A . E 5 HOH 32 332 18 HOH HOH A . E 5 HOH 33 333 7 HOH HOH A . E 5 HOH 34 334 25 HOH HOH A . E 5 HOH 35 335 14 HOH HOH A . E 5 HOH 36 336 31 HOH HOH A . F 5 HOH 1 201 43 HOH HOH B . F 5 HOH 2 202 16 HOH HOH B . F 5 HOH 3 203 13 HOH HOH B . F 5 HOH 4 204 35 HOH HOH B . F 5 HOH 5 205 40 HOH HOH B . F 5 HOH 6 206 42 HOH HOH B . F 5 HOH 7 207 21 HOH HOH B . F 5 HOH 8 208 11 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A VAL 31 ? CG1 ? A VAL 4 CG1 2 1 Y 1 A VAL 31 ? CG2 ? A VAL 4 CG2 3 1 Y 1 A ARG 43 ? CD ? A ARG 16 CD 4 1 Y 1 A ARG 43 ? NE ? A ARG 16 NE 5 1 Y 1 A ARG 43 ? CZ ? A ARG 16 CZ 6 1 Y 1 A ARG 43 ? NH1 ? A ARG 16 NH1 7 1 Y 1 A ARG 43 ? NH2 ? A ARG 16 NH2 8 1 Y 1 A GLU 49 ? CG ? A GLU 22 CG 9 1 Y 1 A GLU 49 ? CD ? A GLU 22 CD 10 1 Y 1 A GLU 49 ? OE1 ? A GLU 22 OE1 11 1 Y 1 A GLU 49 ? OE2 ? A GLU 22 OE2 12 1 Y 1 A LYS 50 ? CG ? A LYS 23 CG 13 1 Y 1 A LYS 50 ? CD ? A LYS 23 CD 14 1 Y 1 A LYS 50 ? CE ? A LYS 23 CE 15 1 Y 1 A LYS 50 ? NZ ? A LYS 23 NZ 16 1 Y 1 A LYS 53 ? CD ? A LYS 26 CD 17 1 Y 1 A LYS 53 ? CE ? A LYS 26 CE 18 1 Y 1 A LYS 53 ? NZ ? A LYS 26 NZ 19 1 Y 1 A GLU 54 ? CD ? A GLU 27 CD 20 1 Y 1 A GLU 54 ? OE1 ? A GLU 27 OE1 21 1 Y 1 A GLU 54 ? OE2 ? A GLU 27 OE2 22 1 Y 1 A GLN 57 ? CG ? A GLN 30 CG 23 1 Y 1 A GLN 57 ? CD ? A GLN 30 CD 24 1 Y 1 A GLN 57 ? OE1 ? A GLN 30 OE1 25 1 Y 1 A GLN 57 ? NE2 ? A GLN 30 NE2 26 1 Y 1 A ARG 58 ? CD ? A ARG 31 CD 27 1 Y 1 A ARG 58 ? NE ? A ARG 31 NE 28 1 Y 1 A ARG 58 ? CZ ? A ARG 31 CZ 29 1 Y 1 A ARG 58 ? NH1 ? A ARG 31 NH1 30 1 Y 1 A ARG 58 ? NH2 ? A ARG 31 NH2 31 1 Y 1 A LYS 141 ? CE ? A LYS 70 CE 32 1 Y 1 A LYS 141 ? NZ ? A LYS 70 NZ 33 1 Y 1 A LYS 172 ? CG ? A LYS 101 CG 34 1 Y 1 A LYS 172 ? CD ? A LYS 101 CD 35 1 Y 1 A LYS 172 ? CE ? A LYS 101 CE 36 1 Y 1 A LYS 172 ? NZ ? A LYS 101 NZ 37 1 Y 1 B ILE 15 ? N ? B ILE 1 N 38 1 Y 1 B ILE 15 ? CB ? B ILE 1 CB 39 1 Y 1 B ILE 15 ? CG1 ? B ILE 1 CG1 40 1 Y 1 B ILE 15 ? CG2 ? B ILE 1 CG2 41 1 Y 1 B ILE 15 ? CD1 ? B ILE 1 CD1 42 1 Y 1 B GLN 16 ? CG ? B GLN 2 CG 43 1 Y 1 B GLN 16 ? CD ? B GLN 2 CD 44 1 Y 1 B GLN 16 ? OE1 ? B GLN 2 OE1 45 1 Y 1 B GLN 16 ? NE2 ? B GLN 2 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18rc7_3834 1 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? STARANISO ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8D52 _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.383 _cell.length_a_esd ? _cell.length_b 57.383 _cell.length_b_esd ? _cell.length_c 205.208 _cell.length_c_esd ? _cell.volume 585182.619 _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8D52 _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ;R 3 2" ; _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8D52 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.44 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '28 % v/v PEG Smear Low, 0.1 M tris-HCl pH 8, 0.15 M Sodium citrate, 1% ethylene glycol, 1 mM ZnSO4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details KB _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-04-06 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator DCM _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.920105 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.920105 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 42.74 _reflns.entry_id 8D52 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.02 _reflns.d_resolution_low 68.403 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7246 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 81.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.2 _reflns.pdbx_Rmerge_I_obs 0.072 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.088 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.02 _reflns_shell.d_res_low 2.163 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 361 _reflns_shell.percent_possible_all 22.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.123 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.791 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.551 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 53.52 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8D52 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.02 _refine.ls_d_res_low 48.30 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7244 _refine.ls_number_reflns_R_free 544 _refine.ls_number_reflns_R_work 6700 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 81.03 _refine.ls_percent_reflns_R_free 7.51 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2072 _refine.ls_R_factor_R_free 0.2440 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2042 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3h3g _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.8938 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2504 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.02 _refine_hist.d_res_low 48.30 _refine_hist.number_atoms_solvent 44 _refine_hist.number_atoms_total 1028 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 932 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 52 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0048 ? 1015 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8817 ? 1383 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0717 ? 140 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0035 ? 181 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.1949 ? 351 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.02 2.22 . . 50 611 30.17 . . . 0.3823 . 0.3092 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.22 2.54 . . 153 1895 93.56 . . . 0.3099 . 0.2777 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.55 3.21 . . 167 2062 99.91 . . . 0.3343 . 0.2409 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.21 48.30 . . 174 2132 99.05 . . . 0.1996 . 0.1742 . . . . . . . . . . . # _struct.entry_id 8D52 _struct.title 'Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing (2-naphthyl)-beta-3-homoalanine' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8D52 _struct_keywords.text 'parathyroid hormone 1 receptor, signaling, beta-amino acid, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PTH1R_HUMAN Q03431 ? 1 ;DDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPC LPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFL ; 29 2 UNP PTHR_HUMAN P12272 ? 2 IQDLRRRFFLHHLIAEIHTAEI 51 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8D52 A 2 ? 103 ? Q03431 29 ? 174 ? 29 174 2 2 8D52 B 1 ? 22 ? P12272 51 ? 72 ? 15 36 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8D52 GLY A 1 ? UNP Q03431 ? ? 'expression tag' 28 1 1 8D52 ? A ? ? UNP Q03431 SER 61 deletion ? 2 1 8D52 ? A ? ? UNP Q03431 ILE 62 deletion ? 3 1 8D52 ? A ? ? UNP Q03431 MET 63 deletion ? 4 1 8D52 ? A ? ? UNP Q03431 GLU 64 deletion ? 5 1 8D52 ? A ? ? UNP Q03431 SER 65 deletion ? 6 1 8D52 ? A ? ? UNP Q03431 ASP 66 deletion ? 7 1 8D52 ? A ? ? UNP Q03431 LYS 67 deletion ? 8 1 8D52 ? A ? ? UNP Q03431 GLY 68 deletion ? 9 1 8D52 ? A ? ? UNP Q03431 TRP 69 deletion ? 10 1 8D52 ? A ? ? UNP Q03431 THR 70 deletion ? 11 1 8D52 ? A ? ? UNP Q03431 SER 71 deletion ? 12 1 8D52 ? A ? ? UNP Q03431 ALA 72 deletion ? 13 1 8D52 ? A ? ? UNP Q03431 SER 73 deletion ? 14 1 8D52 ? A ? ? UNP Q03431 THR 74 deletion ? 15 1 8D52 ? A ? ? UNP Q03431 SER 75 deletion ? 16 1 8D52 ? A ? ? UNP Q03431 GLY 76 deletion ? 17 1 8D52 ? A ? ? UNP Q03431 LYS 77 deletion ? 18 1 8D52 ? A ? ? UNP Q03431 PRO 78 deletion ? 19 1 8D52 ? A ? ? UNP Q03431 ARG 79 deletion ? 20 1 8D52 ? A ? ? UNP Q03431 LYS 80 deletion ? 21 1 8D52 ? A ? ? UNP Q03431 ASP 81 deletion ? 22 1 8D52 ? A ? ? UNP Q03431 LYS 82 deletion ? 23 1 8D52 ? A ? ? UNP Q03431 ALA 83 deletion ? 24 1 8D52 ? A ? ? UNP Q03431 SER 84 deletion ? 25 1 8D52 ? A ? ? UNP Q03431 GLY 85 deletion ? 26 1 8D52 ? A ? ? UNP Q03431 LYS 86 deletion ? 27 1 8D52 ? A ? ? UNP Q03431 LEU 87 deletion ? 28 1 8D52 ? A ? ? UNP Q03431 TYR 88 deletion ? 29 1 8D52 ? A ? ? UNP Q03431 PRO 89 deletion ? 30 1 8D52 ? A ? ? UNP Q03431 GLU 90 deletion ? 31 1 8D52 ? A ? ? UNP Q03431 SER 91 deletion ? 32 1 8D52 ? A ? ? UNP Q03431 GLU 92 deletion ? 33 1 8D52 ? A ? ? UNP Q03431 GLU 93 deletion ? 34 1 8D52 ? A ? ? UNP Q03431 ASP 94 deletion ? 35 1 8D52 ? A ? ? UNP Q03431 LYS 95 deletion ? 36 1 8D52 ? A ? ? UNP Q03431 GLU 96 deletion ? 37 1 8D52 ? A ? ? UNP Q03431 ALA 97 deletion ? 38 1 8D52 ? A ? ? UNP Q03431 PRO 98 deletion ? 39 1 8D52 ? A ? ? UNP Q03431 THR 99 deletion ? 40 1 8D52 ? A ? ? UNP Q03431 GLY 100 deletion ? 41 1 8D52 ? A ? ? UNP Q03431 SER 101 deletion ? 42 1 8D52 ? A ? ? UNP Q03431 ARG 102 deletion ? 43 1 8D52 ? A ? ? UNP Q03431 TYR 103 deletion ? 44 1 8D52 ? A ? ? UNP Q03431 ARG 104 deletion ? 45 2 8D52 QF0 B 17 ? UNP P12272 ILE 67 'engineered mutation' 31 46 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 6 ? ARG A 31 ? THR A 33 ARG A 58 1 ? 26 HELX_P HELX_P2 AA2 ASP B 3 ? HIS B 18 ? ASP B 17 HIS B 32 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 48 A CYS 117 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf2 disulf ? ? A CYS 37 SG ? ? ? 1_555 A CYS 77 SG ? ? A CYS 108 A CYS 148 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? A CYS 60 SG ? ? ? 1_555 A CYS 99 SG ? ? A CYS 131 A CYS 170 1_555 ? ? ? ? ? ? ? 2.001 ? ? covale1 covale both ? B GLU 16 C ? ? ? 1_555 B QF0 17 N ? ? B GLU 30 B QF0 31 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? B QF0 17 C ? ? ? 1_555 B HIS 18 N ? ? B QF0 31 B HIS 32 1_555 ? ? ? ? ? ? ? 1.329 ? ? metalc1 metalc ? ? B HIS 12 NE2 ? ? ? 1_555 D ZN . ZN ? ? B HIS 26 B ZN 101 1_555 ? ? ? ? ? ? ? 2.047 ? ? metalc2 metalc ? ? B HIS 12 NE2 ? ? ? 1_555 D ZN . ZN ? ? B HIS 26 B ZN 101 2_555 ? ? ? ? ? ? ? 2.047 ? ? metalc3 metalc ? ? D ZN . ZN ? ? ? 1_555 F HOH . O ? ? B ZN 101 B HOH 208 1_555 ? ? ? ? ? ? ? 2.011 ? ? metalc4 metalc ? ? D ZN . ZN ? ? ? 1_555 F HOH . O ? ? B ZN 101 B HOH 208 2_555 ? ? ? ? ? ? ? 2.011 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? B HIS 12 ? B HIS 26 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 NE2 ? B HIS 12 ? B HIS 26 ? 1_555 0.0 ? 2 NE2 ? B HIS 12 ? B HIS 26 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 O ? F HOH . ? B HOH 208 ? 1_555 116.4 ? 3 NE2 ? B HIS 12 ? B HIS 26 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 O ? F HOH . ? B HOH 208 ? 1_555 116.4 ? 4 NE2 ? B HIS 12 ? B HIS 26 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 O ? F HOH . ? B HOH 208 ? 2_555 116.4 ? 5 NE2 ? B HIS 12 ? B HIS 26 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 O ? F HOH . ? B HOH 208 ? 2_555 116.4 ? 6 O ? F HOH . ? B HOH 208 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 O ? F HOH . ? B HOH 208 ? 2_555 0.0 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 QF0 B 17 ? . . . . QF0 B 31 ? 1_555 . . . . . . . ? 1 QF0 None 'Non-standard residue' 2 CYS A 21 ? CYS A 46 ? CYS A 48 ? 1_555 CYS A 117 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 37 ? CYS A 77 ? CYS A 108 ? 1_555 CYS A 148 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 60 ? CYS A 99 ? CYS A 131 ? 1_555 CYS A 170 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 40 ? TRP A 41 ? GLU A 111 TRP A 112 AA1 2 CYS A 46 ? TRP A 47 ? CYS A 117 TRP A 118 AA2 1 GLU A 54 ? PRO A 59 ? GLU A 125 PRO A 130 AA2 2 HIS A 72 ? CYS A 77 ? HIS A 143 CYS A 148 AA2 3 ALA A 94 ? ASN A 95 ? ALA A 165 ASN A 166 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 40 ? N GLU A 111 O TRP A 47 ? O TRP A 118 AA2 1 2 N VAL A 58 ? N VAL A 129 O ALA A 73 ? O ALA A 144 AA2 2 3 N TYR A 74 ? N TYR A 145 O ASN A 95 ? O ASN A 166 # _pdbx_entry_details.entry_id 8D52 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 31 ? ? -58.39 100.33 2 1 ARG A 58 ? ? -113.83 65.70 3 1 HIS A 114 ? ? 74.58 -3.74 4 1 PHE A 173 ? ? -85.57 34.35 5 1 GLN B 16 ? ? 58.04 -141.79 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 QF0 _pdbx_validate_peptide_omega.auth_asym_id_1 B _pdbx_validate_peptide_omega.auth_seq_id_1 31 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 HIS _pdbx_validate_peptide_omega.auth_asym_id_2 B _pdbx_validate_peptide_omega.auth_seq_id_2 32 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 143.20 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id QF0 _pdbx_validate_main_chain_plane.auth_asym_id B _pdbx_validate_main_chain_plane.auth_seq_id 31 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -18.78 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 B ZN 101 ? D ZN . 2 1 A HOH 317 ? E HOH . 3 1 B HOH 208 ? F HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z 3 -x+y,-x,z 4 x-y,-y,-z 5 -x,-x+y,-z 6 y,x,-z 7 x+1/3,y+2/3,z+2/3 8 -y+1/3,x-y+2/3,z+2/3 9 -x+y+1/3,-x+2/3,z+2/3 10 x-y+1/3,-y+2/3,-z+2/3 11 -x+1/3,-x+y+2/3,-z+2/3 12 y+1/3,x+2/3,-z+2/3 13 x+2/3,y+1/3,z+1/3 14 -y+2/3,x-y+1/3,z+1/3 15 -x+y+2/3,-x+1/3,z+1/3 16 x-y+2/3,-y+1/3,-z+1/3 17 -x+2/3,-x+y+1/3,-z+1/3 18 y+2/3,x+1/3,-z+1/3 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 6.940 17.477 6.352 0.600199801914 0.378183869314 0.478146111181 -0.0750897427343 0.0603110770035 0.0855193329367 6.53842222679 8.42706685812 9.84906351368 2.82202266829 3.7254331447 2.49522974655 -0.934681753233 0.590809706223 0.389759859171 0.621166947527 0.803976176645 -0.32948119611 -1.55156475266 -1.3690402485 0.808657791003 'X-RAY DIFFRACTION' 2 ? refined 17.950 20.996 19.715 0.449894949631 0.515976351154 0.648825958163 -0.196009973973 0.0908304132573 -0.0212539630226 3.31365757715 3.7128650689 3.60119720693 1.44570274355 1.88118224954 0.763125154299 -0.420248747778 0.589840596485 -0.133970115328 0.676189965488 0.151615400257 -1.11552026255 -0.659049027274 -0.927651498584 1.34883169098 'X-RAY DIFFRACTION' 3 ? refined 8.053 16.585 24.024 0.284280823644 0.194095529906 0.35399248393 -0.0279251997019 -0.0323288422724 -0.0771437500544 6.85827292921 6.30326881284 9.99798419875 0.259767806051 2.79879010383 0.215332484123 0.159403400751 -0.085240993932 -0.0755920297877 -0.296924008326 0.606961051445 -0.205860979108 -0.130658204209 -0.262220346819 0.0366335267709 'X-RAY DIFFRACTION' 4 ? refined -3.313 13.182 22.308 0.467779271395 0.71470593122 0.850443575544 -0.0446507499768 -0.0102993548198 0.0253032711758 5.26252406775 2.00823486697 2.00603369737 -2.40958628652 1.21592916557 5.23920966571 0.180462214349 -0.221420065052 0.0431369893876 -0.682514999711 -0.812612092671 1.55080039648 0.493599993996 0.765561844065 -2.05636001593 'X-RAY DIFFRACTION' 5 ? refined -2.470 7.340 11.227 0.337837650869 0.290315844583 0.343200360606 0.0303171479606 -0.0550033487625 0.020864005008 8.97143595771 7.12322476121 2.03287339276 5.68967741483 -4.93543562749 3.10309145748 -0.302296771761 0.166869742291 0.155410428412 0.448703293289 0.739656078429 0.481272436877 -0.661445366002 -0.831302131391 -0.910988414043 'X-RAY DIFFRACTION' 6 ? refined 6.363 7.004 22.385 0.474199827215 0.391729444169 0.579578735092 -0.0825914974707 -0.205792584378 0.0251513233637 4.44689236214 3.5852707845 0.662464906074 4.00074375376 1.72365256119 1.53561303138 0.249848705165 -0.216512613836 0.247692165073 -0.756674027241 -0.0226897452798 -0.788616934728 0.745315898676 0.781876676118 -0.0913957289972 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 30 A 53 '( CHAIN A AND RESID 30:53 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 54 A 124 '( CHAIN A AND RESID 54:124 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 125 A 168 '( CHAIN A AND RESID 125:168 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 169 A 174 '( CHAIN A AND RESID 169:174 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 B 15 B 29 '( CHAIN B AND RESID 15:29 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 B 30 B 35 '( CHAIN B AND RESID 30:35 )' ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 28 ? A GLY 1 2 1 Y 1 A ASP 29 ? A ASP 2 3 1 Y 1 B ILE 36 ? B ILE 22 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 QF0 C02 C Y N 300 QF0 C03 C Y N 301 QF0 C04 C Y N 302 QF0 C05 C Y N 303 QF0 C06 C Y N 304 QF0 C07 C Y N 305 QF0 C08 C Y N 306 QF0 C09 C Y N 307 QF0 C10 C Y N 308 QF0 C11 C N N 309 QF0 N N N N 310 QF0 CB C N N 311 QF0 C C N N 312 QF0 O O N N 313 QF0 CA C N S 314 QF0 C01 C Y N 315 QF0 H1 H N N 316 QF0 H9 H N N 317 QF0 H3 H N N 318 QF0 H4 H N N 319 QF0 H5 H N N 320 QF0 H6 H N N 321 QF0 H7 H N N 322 QF0 H8 H N N 323 QF0 H H N N 324 QF0 H2 H N N 325 QF0 H12 H N N 326 QF0 H13 H N N 327 QF0 HXT H N N 328 QF0 HA H N N 329 QF0 H16 H N N 330 QF0 OXT O N N 331 SER N N N N 332 SER CA C N S 333 SER C C N N 334 SER O O N N 335 SER CB C N N 336 SER OG O N N 337 SER OXT O N N 338 SER H H N N 339 SER H2 H N N 340 SER HA H N N 341 SER HB2 H N N 342 SER HB3 H N N 343 SER HG H N N 344 SER HXT H N N 345 THR N N N N 346 THR CA C N S 347 THR C C N N 348 THR O O N N 349 THR CB C N R 350 THR OG1 O N N 351 THR CG2 C N N 352 THR OXT O N N 353 THR H H N N 354 THR H2 H N N 355 THR HA H N N 356 THR HB H N N 357 THR HG1 H N N 358 THR HG21 H N N 359 THR HG22 H N N 360 THR HG23 H N N 361 THR HXT H N N 362 TRP N N N N 363 TRP CA C N S 364 TRP C C N N 365 TRP O O N N 366 TRP CB C N N 367 TRP CG C Y N 368 TRP CD1 C Y N 369 TRP CD2 C Y N 370 TRP NE1 N Y N 371 TRP CE2 C Y N 372 TRP CE3 C Y N 373 TRP CZ2 C Y N 374 TRP CZ3 C Y N 375 TRP CH2 C Y N 376 TRP OXT O N N 377 TRP H H N N 378 TRP H2 H N N 379 TRP HA H N N 380 TRP HB2 H N N 381 TRP HB3 H N N 382 TRP HD1 H N N 383 TRP HE1 H N N 384 TRP HE3 H N N 385 TRP HZ2 H N N 386 TRP HZ3 H N N 387 TRP HH2 H N N 388 TRP HXT H N N 389 TYR N N N N 390 TYR CA C N S 391 TYR C C N N 392 TYR O O N N 393 TYR CB C N N 394 TYR CG C Y N 395 TYR CD1 C Y N 396 TYR CD2 C Y N 397 TYR CE1 C Y N 398 TYR CE2 C Y N 399 TYR CZ C Y N 400 TYR OH O N N 401 TYR OXT O N N 402 TYR H H N N 403 TYR H2 H N N 404 TYR HA H N N 405 TYR HB2 H N N 406 TYR HB3 H N N 407 TYR HD1 H N N 408 TYR HD2 H N N 409 TYR HE1 H N N 410 TYR HE2 H N N 411 TYR HH H N N 412 TYR HXT H N N 413 VAL N N N N 414 VAL CA C N S 415 VAL C C N N 416 VAL O O N N 417 VAL CB C N N 418 VAL CG1 C N N 419 VAL CG2 C N N 420 VAL OXT O N N 421 VAL H H N N 422 VAL H2 H N N 423 VAL HA H N N 424 VAL HB H N N 425 VAL HG11 H N N 426 VAL HG12 H N N 427 VAL HG13 H N N 428 VAL HG21 H N N 429 VAL HG22 H N N 430 VAL HG23 H N N 431 VAL HXT H N N 432 ZN ZN ZN N N 433 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 QF0 C02 C01 doub Y N 286 QF0 C02 C03 sing Y N 287 QF0 C01 C10 sing Y N 288 QF0 C03 C04 doub Y N 289 QF0 C10 C09 doub Y N 290 QF0 C04 C09 sing Y N 291 QF0 C04 C05 sing Y N 292 QF0 C09 C08 sing Y N 293 QF0 C05 C06 doub Y N 294 QF0 C08 C07 doub Y N 295 QF0 C06 C07 sing Y N 296 QF0 C06 C11 sing N N 297 QF0 C11 CA sing N N 298 QF0 N CA sing N N 299 QF0 CA CB sing N N 300 QF0 CB C sing N N 301 QF0 C O doub N N 302 QF0 C02 H1 sing N N 303 QF0 C03 H9 sing N N 304 QF0 C05 H3 sing N N 305 QF0 C07 H4 sing N N 306 QF0 C08 H5 sing N N 307 QF0 C10 H6 sing N N 308 QF0 C11 H7 sing N N 309 QF0 C11 H8 sing N N 310 QF0 N H sing N N 311 QF0 N H2 sing N N 312 QF0 CB H12 sing N N 313 QF0 CB H13 sing N N 314 QF0 CA HA sing N N 315 QF0 C01 H16 sing N N 316 QF0 C OXT sing N N 317 QF0 OXT HXT sing N N 318 SER N CA sing N N 319 SER N H sing N N 320 SER N H2 sing N N 321 SER CA C sing N N 322 SER CA CB sing N N 323 SER CA HA sing N N 324 SER C O doub N N 325 SER C OXT sing N N 326 SER CB OG sing N N 327 SER CB HB2 sing N N 328 SER CB HB3 sing N N 329 SER OG HG sing N N 330 SER OXT HXT sing N N 331 THR N CA sing N N 332 THR N H sing N N 333 THR N H2 sing N N 334 THR CA C sing N N 335 THR CA CB sing N N 336 THR CA HA sing N N 337 THR C O doub N N 338 THR C OXT sing N N 339 THR CB OG1 sing N N 340 THR CB CG2 sing N N 341 THR CB HB sing N N 342 THR OG1 HG1 sing N N 343 THR CG2 HG21 sing N N 344 THR CG2 HG22 sing N N 345 THR CG2 HG23 sing N N 346 THR OXT HXT sing N N 347 TRP N CA sing N N 348 TRP N H sing N N 349 TRP N H2 sing N N 350 TRP CA C sing N N 351 TRP CA CB sing N N 352 TRP CA HA sing N N 353 TRP C O doub N N 354 TRP C OXT sing N N 355 TRP CB CG sing N N 356 TRP CB HB2 sing N N 357 TRP CB HB3 sing N N 358 TRP CG CD1 doub Y N 359 TRP CG CD2 sing Y N 360 TRP CD1 NE1 sing Y N 361 TRP CD1 HD1 sing N N 362 TRP CD2 CE2 doub Y N 363 TRP CD2 CE3 sing Y N 364 TRP NE1 CE2 sing Y N 365 TRP NE1 HE1 sing N N 366 TRP CE2 CZ2 sing Y N 367 TRP CE3 CZ3 doub Y N 368 TRP CE3 HE3 sing N N 369 TRP CZ2 CH2 doub Y N 370 TRP CZ2 HZ2 sing N N 371 TRP CZ3 CH2 sing Y N 372 TRP CZ3 HZ3 sing N N 373 TRP CH2 HH2 sing N N 374 TRP OXT HXT sing N N 375 TYR N CA sing N N 376 TYR N H sing N N 377 TYR N H2 sing N N 378 TYR CA C sing N N 379 TYR CA CB sing N N 380 TYR CA HA sing N N 381 TYR C O doub N N 382 TYR C OXT sing N N 383 TYR CB CG sing N N 384 TYR CB HB2 sing N N 385 TYR CB HB3 sing N N 386 TYR CG CD1 doub Y N 387 TYR CG CD2 sing Y N 388 TYR CD1 CE1 sing Y N 389 TYR CD1 HD1 sing N N 390 TYR CD2 CE2 doub Y N 391 TYR CD2 HD2 sing N N 392 TYR CE1 CZ doub Y N 393 TYR CE1 HE1 sing N N 394 TYR CE2 CZ sing Y N 395 TYR CE2 HE2 sing N N 396 TYR CZ OH sing N N 397 TYR OH HH sing N N 398 TYR OXT HXT sing N N 399 VAL N CA sing N N 400 VAL N H sing N N 401 VAL N H2 sing N N 402 VAL CA C sing N N 403 VAL CA CB sing N N 404 VAL CA HA sing N N 405 VAL C O doub N N 406 VAL C OXT sing N N 407 VAL CB CG1 sing N N 408 VAL CB CG2 sing N N 409 VAL CB HB sing N N 410 VAL CG1 HG11 sing N N 411 VAL CG1 HG12 sing N N 412 VAL CG1 HG13 sing N N 413 VAL CG2 HG21 sing N N 414 VAL CG2 HG22 sing N N 415 VAL CG2 HG23 sing N N 416 VAL OXT HXT sing N N 417 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R01-GM056414 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3H3G _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'R 3 2 :H' _space_group.name_Hall ;R 3 2" ; _space_group.IT_number 155 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 8D52 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017427 _atom_sites.fract_transf_matrix[1][2] 0.010061 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020123 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004873 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 24.64596 5.25405 ? ? 2.14387 29.76375 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #