data_8D95 # _entry.id 8D95 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8D95 pdb_00008d95 10.2210/pdb8d95/pdb WWPDB D_1000266146 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'same protein with covalent inhibitor' 1DIC unspecified PDB 'same protein with covalent inhibtor' 1BIO unspecified PDB 'same protein with covalent inhibitor' 1DFP unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8D95 _pdbx_database_status.recvd_initial_deposition_date 2022-06-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Raman, K.' 1 0000-0003-1500-711X 'Babu, Y.S.' 2 0000-0002-1385-289X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Bioorg.Med.Chem. _citation.journal_id_ASTM BMECEP _citation.journal_id_CSD 1200 _citation.journal_id_ISSN 1464-3391 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 74 _citation.language ? _citation.page_first 117034 _citation.page_last 117034 _citation.title 'Scaffold hopping via ring opening enables identification of acyclic compounds as new complement Factor D inhibitors.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bmc.2022.117034 _citation.pdbx_database_id_PubMed 36272185 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, W.' 1 ? primary 'Wu, M.' 2 ? primary 'Vadlakonda, S.' 3 ? primary 'Juarez, L.' 4 ? primary 'Cheng, X.' 5 ? primary 'Muppa, S.' 6 ? primary 'Chintareddy, V.' 7 ? primary 'Vogeti, L.' 8 ? primary 'Kellogg-Yelder, D.' 9 ? primary 'Williams, J.' 10 ? primary 'Polach, K.' 11 ? primary 'Chen, X.' 12 ? primary 'Raman, K.' 13 ? primary 'Babu, Y.S.' 14 ? primary 'Kotian, P.' 15 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 114.392 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8D95 _cell.details ? _cell.formula_units_Z ? _cell.length_a 76.302 _cell.length_a_esd ? _cell.length_b 44.800 _cell.length_b_esd ? _cell.length_c 62.132 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8D95 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Complement factor D' 24596.965 1 3.4.21.46 ? ? ? 2 non-polymer syn 'N-(6-bromopyridin-2-yl)-1-[(3-cyanophenyl)acetyl]-L-prolinamide' 413.268 1 ? ? ? ? 3 water nat water 18.015 56 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Adipsin,C3 convertase activator,Properdin factor D' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPD SQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHH DGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLASA ; _entity_poly.pdbx_seq_one_letter_code_can ;ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPD SQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHH DGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLASA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 LEU n 1 3 GLY n 1 4 GLY n 1 5 ARG n 1 6 GLU n 1 7 ALA n 1 8 GLU n 1 9 ALA n 1 10 HIS n 1 11 ALA n 1 12 ARG n 1 13 PRO n 1 14 TYR n 1 15 MET n 1 16 ALA n 1 17 SER n 1 18 VAL n 1 19 GLN n 1 20 LEU n 1 21 ASN n 1 22 GLY n 1 23 ALA n 1 24 HIS n 1 25 LEU n 1 26 CYS n 1 27 GLY n 1 28 GLY n 1 29 VAL n 1 30 LEU n 1 31 VAL n 1 32 ALA n 1 33 GLU n 1 34 GLN n 1 35 TRP n 1 36 VAL n 1 37 LEU n 1 38 SER n 1 39 ALA n 1 40 ALA n 1 41 HIS n 1 42 CYS n 1 43 LEU n 1 44 GLU n 1 45 ASP n 1 46 ALA n 1 47 ALA n 1 48 ASP n 1 49 GLY n 1 50 LYS n 1 51 VAL n 1 52 GLN n 1 53 VAL n 1 54 LEU n 1 55 LEU n 1 56 GLY n 1 57 ALA n 1 58 HIS n 1 59 SER n 1 60 LEU n 1 61 SER n 1 62 GLN n 1 63 PRO n 1 64 GLU n 1 65 PRO n 1 66 SER n 1 67 LYS n 1 68 ARG n 1 69 LEU n 1 70 TYR n 1 71 ASP n 1 72 VAL n 1 73 LEU n 1 74 ARG n 1 75 ALA n 1 76 VAL n 1 77 PRO n 1 78 HIS n 1 79 PRO n 1 80 ASP n 1 81 SER n 1 82 GLN n 1 83 PRO n 1 84 ASP n 1 85 THR n 1 86 ILE n 1 87 ASP n 1 88 HIS n 1 89 ASP n 1 90 LEU n 1 91 LEU n 1 92 LEU n 1 93 LEU n 1 94 GLN n 1 95 LEU n 1 96 SER n 1 97 GLU n 1 98 LYS n 1 99 ALA n 1 100 THR n 1 101 LEU n 1 102 GLY n 1 103 PRO n 1 104 ALA n 1 105 VAL n 1 106 ARG n 1 107 PRO n 1 108 LEU n 1 109 PRO n 1 110 TRP n 1 111 GLN n 1 112 ARG n 1 113 VAL n 1 114 ASP n 1 115 ARG n 1 116 ASP n 1 117 VAL n 1 118 ALA n 1 119 PRO n 1 120 GLY n 1 121 THR n 1 122 LEU n 1 123 CYS n 1 124 ASP n 1 125 VAL n 1 126 ALA n 1 127 GLY n 1 128 TRP n 1 129 GLY n 1 130 ILE n 1 131 VAL n 1 132 ASN n 1 133 HIS n 1 134 ALA n 1 135 GLY n 1 136 ARG n 1 137 ARG n 1 138 PRO n 1 139 ASP n 1 140 SER n 1 141 LEU n 1 142 GLN n 1 143 HIS n 1 144 VAL n 1 145 LEU n 1 146 LEU n 1 147 PRO n 1 148 VAL n 1 149 LEU n 1 150 ASP n 1 151 ARG n 1 152 ALA n 1 153 THR n 1 154 CYS n 1 155 ASN n 1 156 ARG n 1 157 ARG n 1 158 THR n 1 159 HIS n 1 160 HIS n 1 161 ASP n 1 162 GLY n 1 163 ALA n 1 164 ILE n 1 165 THR n 1 166 GLU n 1 167 ARG n 1 168 LEU n 1 169 MET n 1 170 CYS n 1 171 ALA n 1 172 GLU n 1 173 SER n 1 174 ASN n 1 175 ARG n 1 176 ARG n 1 177 ASP n 1 178 SER n 1 179 CYS n 1 180 LYS n 1 181 GLY n 1 182 ASP n 1 183 SER n 1 184 GLY n 1 185 GLY n 1 186 PRO n 1 187 LEU n 1 188 VAL n 1 189 CYS n 1 190 GLY n 1 191 GLY n 1 192 VAL n 1 193 LEU n 1 194 GLU n 1 195 GLY n 1 196 VAL n 1 197 VAL n 1 198 THR n 1 199 SER n 1 200 GLY n 1 201 SER n 1 202 ARG n 1 203 VAL n 1 204 CYS n 1 205 GLY n 1 206 ASN n 1 207 ARG n 1 208 LYS n 1 209 LYS n 1 210 PRO n 1 211 GLY n 1 212 ILE n 1 213 TYR n 1 214 THR n 1 215 ARG n 1 216 VAL n 1 217 ALA n 1 218 SER n 1 219 TYR n 1 220 ALA n 1 221 ALA n 1 222 TRP n 1 223 ILE n 1 224 ASP n 1 225 SER n 1 226 VAL n 1 227 LEU n 1 228 ALA n 1 229 SER n 1 230 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 230 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CFD, DF, PFD' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line 'HEK293-E 253' _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name Human _entity_src_gen.pdbx_host_org_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ kidney _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell 'Human embryonic' _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CFAD_HUMAN _struct_ref.pdbx_db_accession P00746 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPD SQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHH DGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA ; _struct_ref.pdbx_align_begin 26 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8D95 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 228 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00746 _struct_ref_seq.db_align_beg 26 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 253 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 228 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8D95 SER A 229 ? UNP P00746 ? ? 'expression tag' 229 1 1 8D95 ALA A 230 ? UNP P00746 ? ? 'expression tag' 230 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 QIE non-polymer . 'N-(6-bromopyridin-2-yl)-1-[(3-cyanophenyl)acetyl]-L-prolinamide' ? 'C19 H17 Br N4 O2' 413.268 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8D95 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.97 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37 _exptl_crystal.description needles _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 300 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 6k' _exptl_crystal_grow.pdbx_pH_range 6.2 # _diffrn.ambient_environment ? _diffrn.ambient_temp 170 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 200K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-04-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8D95 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.16 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 30307 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.4 _reflns.pdbx_Rmerge_I_obs 0.068 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.071 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.858 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.079 _reflns.pdbx_Rpim_I_all 0.039 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.965 _reflns.pdbx_CC_star 0.991 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.32 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 20 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 815 _reflns_shell.percent_possible_all 84.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.133 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.9 _reflns_shell.pdbx_Rsym_value 0.116 _reflns_shell.pdbx_chi_squared 0.657 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.114 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.965 _reflns_shell.pdbx_CC_star 0.991 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.081 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] 0.019 _refine.aniso_B[2][2] -0.057 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -0.029 _refine.B_iso_max ? _refine.B_iso_mean 30.734 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.939 _refine.correlation_coeff_Fo_to_Fc_free 0.901 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8D95 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.166 _refine.ls_d_res_low 35.189 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9227 _refine.ls_number_reflns_R_free 510 _refine.ls_number_reflns_R_work 8717 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 89.141 _refine.ls_percent_reflns_R_free 5.527 _refine.ls_R_factor_all 0.205 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2629 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2018 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.265 _refine.ls_wR_factor_R_work 0.204 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1DIC _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.463 _refine.pdbx_overall_ESU_R_Free 0.270 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 6.926 _refine.overall_SU_ML 0.179 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work 0.9735 _refine.pdbx_average_fsc_free 0.9507 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.166 _refine_hist.d_res_low 35.189 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 1743 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1687 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.012 1725 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.016 1582 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.402 1.656 2347 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.701 1.573 3683 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.995 5.000 218 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 15.299 10.000 18 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.689 10.000 271 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.258 10.000 70 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.057 0.200 263 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 2.169 0.200 4 ? r_chiral_restr_other ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1996 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 324 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.211 0.200 294 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.199 0.200 1449 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.161 0.200 789 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.083 0.200 918 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.148 0.200 60 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.091 0.200 1 ? r_symmetry_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.207 0.200 23 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.203 0.200 65 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.267 0.200 7 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 2.348 3.070 881 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.342 3.069 880 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.816 4.566 1094 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.814 4.574 1095 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.811 3.432 844 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.809 3.432 845 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 4.186 4.996 1253 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.184 4.996 1254 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.582 53.567 1794 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 7.577 53.604 1790 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.166 2.222 779 . 4 163 21.4377 . 0.204 . 0.463 . 0.199 . . . . . 0.183 . 20 . 0.975 0.830 'X-RAY DIFFRACTION' 2.222 2.283 714 . 27 419 62.4650 . 0.213 . 0.387 . 0.202 . . . . . 0.185 . 20 . 0.975 0.909 'X-RAY DIFFRACTION' 2.283 2.349 726 . 36 592 86.5014 . 0.201 . 0.248 . 0.198 . . . . . 0.180 . 20 . 0.975 0.958 'X-RAY DIFFRACTION' 2.349 2.420 680 . 45 592 93.6765 . 0.224 . 0.315 . 0.217 . . . . . 0.200 . 20 . 0.969 0.950 'X-RAY DIFFRACTION' 2.420 2.499 691 . 51 610 95.6585 . 0.230 . 0.267 . 0.227 . . . . . 0.204 . 20 . 0.968 0.955 'X-RAY DIFFRACTION' 2.499 2.587 666 . 23 624 97.1471 . 0.219 . 0.383 . 0.213 . . . . . 0.200 . 20 . 0.974 0.878 'X-RAY DIFFRACTION' 2.587 2.684 601 . 44 545 98.0033 . 0.236 . 0.276 . 0.232 . . . . . 0.210 . 20 . 0.969 0.954 'X-RAY DIFFRACTION' 2.684 2.793 626 . 41 576 98.5623 . 0.220 . 0.296 . 0.214 . . . . . 0.199 . 20 . 0.973 0.956 'X-RAY DIFFRACTION' 2.793 2.916 581 . 30 545 98.9673 . 0.210 . 0.226 . 0.209 . . . . . 0.205 . 20 . 0.972 0.972 'X-RAY DIFFRACTION' 2.916 3.057 557 . 26 523 98.5637 . 0.222 . 0.297 . 0.219 . . . . . 0.214 . 20 . 0.969 0.948 'X-RAY DIFFRACTION' 3.057 3.221 530 . 18 510 99.6226 . 0.209 . 0.304 . 0.205 . . . . . 0.199 . 20 . 0.974 0.943 'X-RAY DIFFRACTION' 3.221 3.415 514 . 21 492 99.8055 . 0.211 . 0.288 . 0.208 . . . . . 0.203 . 20 . 0.973 0.954 'X-RAY DIFFRACTION' 3.415 3.648 480 . 26 454 100.0000 . 0.203 . 0.296 . 0.198 . . . . . 0.199 . 20 . 0.976 0.944 'X-RAY DIFFRACTION' 3.648 3.937 427 . 28 398 99.7658 . 0.188 . 0.216 . 0.186 . . . . . 0.186 . 20 . 0.980 0.978 'X-RAY DIFFRACTION' 3.937 4.307 417 . 34 380 99.2806 . 0.172 . 0.236 . 0.166 . . . . . 0.180 . 20 . 0.983 0.972 'X-RAY DIFFRACTION' 4.307 4.807 375 . 18 354 99.2000 . 0.167 . 0.172 . 0.166 . . . . . 0.188 . 20 . 0.984 0.978 'X-RAY DIFFRACTION' 4.807 5.533 340 . 18 321 99.7059 . 0.175 . 0.169 . 0.176 . . . . . 0.199 . 20 . 0.984 0.983 'X-RAY DIFFRACTION' 5.533 6.735 272 . 9 262 99.6324 . 0.229 . 0.374 . 0.226 . . . . . 0.244 . 20 . 0.972 0.980 'X-RAY DIFFRACTION' 6.735 9.356 229 . 8 220 99.5633 . 0.215 . 0.252 . 0.214 . . . . . 0.237 . 20 . 0.973 0.930 'X-RAY DIFFRACTION' 9.356 35.189 142 . 3 136 97.8873 . 0.273 . 0.640 . 0.268 . . . . . 0.317 . 20 . 0.941 0.780 # _struct.entry_id 8D95 _struct.title 'Scaffold Hopping via Ring Opening Enables Identification of Acyclic Compounds as New Complement Factor D Inhibitors' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8D95 _struct_keywords.text 'serine protease inhibitor complex, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 150 ? ARG A 157 ? ASP A 150 ARG A 157 1 ? 8 HELX_P HELX_P2 AA2 TYR A 219 ? ALA A 228 ? TYR A 219 ALA A 228 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 26 A CYS 42 1_555 ? ? ? ? ? ? ? 2.040 ? ? disulf2 disulf ? ? A CYS 123 SG ? ? ? 1_555 A CYS 189 SG ? ? A CYS 123 A CYS 189 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf3 disulf ? ? A CYS 154 SG ? ? ? 1_555 A CYS 170 SG ? ? A CYS 154 A CYS 170 1_555 ? ? ? ? ? ? ? 2.110 ? ? disulf4 disulf ? ? A CYS 179 SG ? ? ? 1_555 A CYS 204 SG ? ? A CYS 179 A CYS 204 1_555 ? ? ? ? ? ? ? 2.054 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 5 ? GLU A 6 ? ARG A 5 GLU A 6 AA1 2 GLN A 142 ? PRO A 147 ? GLN A 142 PRO A 147 AA1 3 LEU A 122 ? GLY A 127 ? LEU A 122 GLY A 127 AA1 4 PRO A 186 ? CYS A 189 ? PRO A 186 CYS A 189 AA1 5 VAL A 192 ? VAL A 197 ? VAL A 192 VAL A 197 AA1 6 GLY A 211 ? ARG A 215 ? GLY A 211 ARG A 215 AA1 7 LEU A 168 ? ALA A 171 ? LEU A 168 ALA A 171 AA2 1 MET A 15 ? LEU A 20 ? MET A 15 LEU A 20 AA2 2 ALA A 23 ? LEU A 30 ? ALA A 23 LEU A 30 AA2 3 TRP A 35 ? SER A 38 ? TRP A 35 SER A 38 AA2 4 LEU A 91 ? LEU A 95 ? LEU A 91 LEU A 95 AA2 5 ARG A 68 ? PRO A 77 ? ARG A 68 PRO A 77 AA2 6 VAL A 51 ? LEU A 55 ? VAL A 51 LEU A 55 AA2 7 MET A 15 ? LEU A 20 ? MET A 15 LEU A 20 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 5 ? N ARG A 5 O HIS A 143 ? O HIS A 143 AA1 2 3 O LEU A 146 ? O LEU A 146 N CYS A 123 ? N CYS A 123 AA1 3 4 N ASP A 124 ? N ASP A 124 O VAL A 188 ? O VAL A 188 AA1 4 5 N CYS A 189 ? N CYS A 189 O VAL A 192 ? O VAL A 192 AA1 5 6 N VAL A 196 ? N VAL A 196 O THR A 214 ? O THR A 214 AA1 6 7 O TYR A 213 ? O TYR A 213 N MET A 169 ? N MET A 169 AA2 1 2 N VAL A 18 ? N VAL A 18 O LEU A 25 ? O LEU A 25 AA2 2 3 N VAL A 29 ? N VAL A 29 O LEU A 37 ? O LEU A 37 AA2 3 4 N SER A 38 ? N SER A 38 O LEU A 91 ? O LEU A 91 AA2 4 5 O LEU A 92 ? O LEU A 92 N VAL A 76 ? N VAL A 76 AA2 5 6 O ARG A 68 ? O ARG A 68 N LEU A 55 ? N LEU A 55 AA2 6 7 O GLN A 52 ? O GLN A 52 N GLN A 19 ? N GLN A 19 # _atom_sites.entry_id 8D95 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013106 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005943 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022321 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017672 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c BR 35 35 17.182 2.172 5.237 16.580 5.639 0.261 3.986 41.433 2.956 C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 0.867 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 1 1 ILE ILE A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ASP 45 45 ? ? ? A . n A 1 46 ALA 46 46 ? ? ? A . n A 1 47 ALA 47 47 ? ? ? A . n A 1 48 ASP 48 48 ? ? ? A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 TRP 110 110 110 TRP TRP A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 CYS 123 123 123 CYS CYS A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 TRP 128 128 128 TRP TRP A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 CYS 154 154 154 CYS CYS A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 HIS 160 160 ? ? ? A . n A 1 161 ASP 161 161 ? ? ? A . n A 1 162 GLY 162 162 ? ? ? A . n A 1 163 ALA 163 163 ? ? ? A . n A 1 164 ILE 164 164 ? ? ? A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 MET 169 169 169 MET MET A . n A 1 170 CYS 170 170 170 CYS CYS A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 ARG 176 176 176 ARG ARG A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 CYS 179 179 179 CYS CYS A . n A 1 180 LYS 180 180 180 LYS LYS A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 ASP 182 182 182 ASP ASP A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 PRO 186 186 186 PRO PRO A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 CYS 189 189 189 CYS CYS A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 SER 199 199 199 SER SER A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 ARG 202 202 202 ARG ARG A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 CYS 204 204 204 CYS CYS A . n A 1 205 GLY 205 205 205 GLY GLY A . n A 1 206 ASN 206 206 206 ASN ASN A . n A 1 207 ARG 207 207 207 ARG ARG A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 PRO 210 210 210 PRO PRO A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 ILE 212 212 212 ILE ILE A . n A 1 213 TYR 213 213 213 TYR TYR A . n A 1 214 THR 214 214 214 THR THR A . n A 1 215 ARG 215 215 215 ARG ARG A . n A 1 216 VAL 216 216 216 VAL VAL A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 SER 218 218 218 SER SER A . n A 1 219 TYR 219 219 219 TYR TYR A . n A 1 220 ALA 220 220 220 ALA ALA A . n A 1 221 ALA 221 221 221 ALA ALA A . n A 1 222 TRP 222 222 222 TRP TRP A . n A 1 223 ILE 223 223 223 ILE ILE A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 VAL 226 226 226 VAL VAL A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 SER 229 229 229 SER SER A . n A 1 230 ALA 230 230 230 ALA ALA A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email rkrishnan@biocryst.com _pdbx_contact_author.name_first Krishnan _pdbx_contact_author.name_last Raman _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1500-711X # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 QIE 1 301 301 QIE BCA A . C 3 HOH 1 401 50 HOH HOH A . C 3 HOH 2 402 22 HOH HOH A . C 3 HOH 3 403 7 HOH HOH A . C 3 HOH 4 404 38 HOH HOH A . C 3 HOH 5 405 18 HOH HOH A . C 3 HOH 6 406 54 HOH HOH A . C 3 HOH 7 407 41 HOH HOH A . C 3 HOH 8 408 53 HOH HOH A . C 3 HOH 9 409 42 HOH HOH A . C 3 HOH 10 410 34 HOH HOH A . C 3 HOH 11 411 10 HOH HOH A . C 3 HOH 12 412 29 HOH HOH A . C 3 HOH 13 413 20 HOH HOH A . C 3 HOH 14 414 1 HOH HOH A . C 3 HOH 15 415 48 HOH HOH A . C 3 HOH 16 416 43 HOH HOH A . C 3 HOH 17 417 17 HOH HOH A . C 3 HOH 18 418 55 HOH HOH A . C 3 HOH 19 419 46 HOH HOH A . C 3 HOH 20 420 8 HOH HOH A . C 3 HOH 21 421 21 HOH HOH A . C 3 HOH 22 422 4 HOH HOH A . C 3 HOH 23 423 12 HOH HOH A . C 3 HOH 24 424 30 HOH HOH A . C 3 HOH 25 425 35 HOH HOH A . C 3 HOH 26 426 3 HOH HOH A . C 3 HOH 27 427 19 HOH HOH A . C 3 HOH 28 428 2 HOH HOH A . C 3 HOH 29 429 15 HOH HOH A . C 3 HOH 30 430 14 HOH HOH A . C 3 HOH 31 431 49 HOH HOH A . C 3 HOH 32 432 6 HOH HOH A . C 3 HOH 33 433 52 HOH HOH A . C 3 HOH 34 434 39 HOH HOH A . C 3 HOH 35 435 56 HOH HOH A . C 3 HOH 36 436 9 HOH HOH A . C 3 HOH 37 437 28 HOH HOH A . C 3 HOH 38 438 47 HOH HOH A . C 3 HOH 39 439 37 HOH HOH A . C 3 HOH 40 440 57 HOH HOH A . C 3 HOH 41 441 5 HOH HOH A . C 3 HOH 42 442 11 HOH HOH A . C 3 HOH 43 443 26 HOH HOH A . C 3 HOH 44 444 23 HOH HOH A . C 3 HOH 45 445 25 HOH HOH A . C 3 HOH 46 446 13 HOH HOH A . C 3 HOH 47 447 36 HOH HOH A . C 3 HOH 48 448 40 HOH HOH A . C 3 HOH 49 449 33 HOH HOH A . C 3 HOH 50 450 27 HOH HOH A . C 3 HOH 51 451 31 HOH HOH A . C 3 HOH 52 452 24 HOH HOH A . C 3 HOH 53 453 58 HOH HOH A . C 3 HOH 54 454 44 HOH HOH A . C 3 HOH 55 455 51 HOH HOH A . C 3 HOH 56 456 45 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 447 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-02 2 'Structure model' 1 1 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0352 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 8D95 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 433 ? ? 1_555 O A HOH 433 ? ? 2_555 2.06 2 1 NH1 A ARG 175 ? ? 1_555 O A SER 229 ? ? 3_455 2.11 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 10 ? ? 80.52 9.68 2 1 THR A 158 ? ? 109.60 -71.99 3 1 SER A 173 ? ? -144.52 57.25 4 1 ARG A 175 ? ? 70.98 -2.25 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 LEU _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 43 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 44 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -148.96 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 5 ? ? 0.077 'SIDE CHAIN' 2 1 ARG A 12 ? ? 0.083 'SIDE CHAIN' 3 1 ARG A 68 ? ? 0.141 'SIDE CHAIN' 4 1 ARG A 151 ? ? 0.123 'SIDE CHAIN' 5 1 ARG A 176 ? ? 0.189 'SIDE CHAIN' # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id ASN _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 174 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id O _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id A _pdbx_unobs_or_zero_occ_atoms.label_comp_id ASN _pdbx_unobs_or_zero_occ_atoms.label_seq_id 174 _pdbx_unobs_or_zero_occ_atoms.label_atom_id O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 45 ? A ASP 45 2 1 Y 1 A ALA 46 ? A ALA 46 3 1 Y 1 A ALA 47 ? A ALA 47 4 1 Y 1 A ASP 48 ? A ASP 48 5 1 Y 1 A HIS 160 ? A HIS 160 6 1 Y 1 A ASP 161 ? A ASP 161 7 1 Y 1 A GLY 162 ? A GLY 162 8 1 Y 1 A ALA 163 ? A ALA 163 9 1 Y 1 A ILE 164 ? A ILE 164 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 QIE C C N N 267 QIE N N N N 268 QIE C21 C Y N 269 QIE C20 C Y N 270 QIE C22 C Y N 271 QIE C23 C Y N 272 QIE C24 C Y N 273 QIE C19 C Y N 274 QIE C17 C N N 275 QIE C16 C N N 276 QIE O18 O N N 277 QIE N1 N N N 278 QIE C5 C N N 279 QIE C4 C N N 280 QIE C3 C N N 281 QIE C2 C N S 282 QIE C6 C N N 283 QIE O8 O N N 284 QIE N7 N N N 285 QIE C9 C Y N 286 QIE N14 N Y N 287 QIE C13 C Y N 288 QIE BR15 BR N N 289 QIE C12 C Y N 290 QIE C11 C Y N 291 QIE C10 C Y N 292 QIE H1 H N N 293 QIE H2 H N N 294 QIE H3 H N N 295 QIE H4 H N N 296 QIE H5 H N N 297 QIE H6 H N N 298 QIE H7 H N N 299 QIE H8 H N N 300 QIE H9 H N N 301 QIE H10 H N N 302 QIE H11 H N N 303 QIE H12 H N N 304 QIE H13 H N N 305 QIE H14 H N N 306 QIE H15 H N N 307 QIE H16 H N N 308 QIE H17 H N N 309 SER N N N N 310 SER CA C N S 311 SER C C N N 312 SER O O N N 313 SER CB C N N 314 SER OG O N N 315 SER OXT O N N 316 SER H H N N 317 SER H2 H N N 318 SER HA H N N 319 SER HB2 H N N 320 SER HB3 H N N 321 SER HG H N N 322 SER HXT H N N 323 THR N N N N 324 THR CA C N S 325 THR C C N N 326 THR O O N N 327 THR CB C N R 328 THR OG1 O N N 329 THR CG2 C N N 330 THR OXT O N N 331 THR H H N N 332 THR H2 H N N 333 THR HA H N N 334 THR HB H N N 335 THR HG1 H N N 336 THR HG21 H N N 337 THR HG22 H N N 338 THR HG23 H N N 339 THR HXT H N N 340 TRP N N N N 341 TRP CA C N S 342 TRP C C N N 343 TRP O O N N 344 TRP CB C N N 345 TRP CG C Y N 346 TRP CD1 C Y N 347 TRP CD2 C Y N 348 TRP NE1 N Y N 349 TRP CE2 C Y N 350 TRP CE3 C Y N 351 TRP CZ2 C Y N 352 TRP CZ3 C Y N 353 TRP CH2 C Y N 354 TRP OXT O N N 355 TRP H H N N 356 TRP H2 H N N 357 TRP HA H N N 358 TRP HB2 H N N 359 TRP HB3 H N N 360 TRP HD1 H N N 361 TRP HE1 H N N 362 TRP HE3 H N N 363 TRP HZ2 H N N 364 TRP HZ3 H N N 365 TRP HH2 H N N 366 TRP HXT H N N 367 TYR N N N N 368 TYR CA C N S 369 TYR C C N N 370 TYR O O N N 371 TYR CB C N N 372 TYR CG C Y N 373 TYR CD1 C Y N 374 TYR CD2 C Y N 375 TYR CE1 C Y N 376 TYR CE2 C Y N 377 TYR CZ C Y N 378 TYR OH O N N 379 TYR OXT O N N 380 TYR H H N N 381 TYR H2 H N N 382 TYR HA H N N 383 TYR HB2 H N N 384 TYR HB3 H N N 385 TYR HD1 H N N 386 TYR HD2 H N N 387 TYR HE1 H N N 388 TYR HE2 H N N 389 TYR HH H N N 390 TYR HXT H N N 391 VAL N N N N 392 VAL CA C N S 393 VAL C C N N 394 VAL O O N N 395 VAL CB C N N 396 VAL CG1 C N N 397 VAL CG2 C N N 398 VAL OXT O N N 399 VAL H H N N 400 VAL H2 H N N 401 VAL HA H N N 402 VAL HB H N N 403 VAL HG11 H N N 404 VAL HG12 H N N 405 VAL HG13 H N N 406 VAL HG21 H N N 407 VAL HG22 H N N 408 VAL HG23 H N N 409 VAL HXT H N N 410 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 QIE BR15 C13 sing N N 254 QIE C13 N14 doub Y N 255 QIE C13 C12 sing Y N 256 QIE N14 C9 sing Y N 257 QIE C23 C24 doub Y N 258 QIE C23 C22 sing Y N 259 QIE C24 C19 sing Y N 260 QIE C22 C21 doub Y N 261 QIE N7 C9 sing N N 262 QIE N7 C6 sing N N 263 QIE O18 C16 doub N N 264 QIE C12 C11 doub Y N 265 QIE C9 C10 doub Y N 266 QIE C2 C6 sing N N 267 QIE C2 N1 sing N N 268 QIE C2 C3 sing N N 269 QIE C16 N1 sing N N 270 QIE C16 C17 sing N N 271 QIE C19 C17 sing N N 272 QIE C19 C20 doub Y N 273 QIE C21 C20 sing Y N 274 QIE C21 C sing N N 275 QIE C6 O8 doub N N 276 QIE N1 C5 sing N N 277 QIE C11 C10 sing Y N 278 QIE C N trip N N 279 QIE C4 C3 sing N N 280 QIE C4 C5 sing N N 281 QIE C20 H1 sing N N 282 QIE C22 H2 sing N N 283 QIE C23 H3 sing N N 284 QIE C24 H4 sing N N 285 QIE C17 H5 sing N N 286 QIE C17 H6 sing N N 287 QIE C5 H7 sing N N 288 QIE C5 H8 sing N N 289 QIE C4 H9 sing N N 290 QIE C4 H10 sing N N 291 QIE C3 H11 sing N N 292 QIE C3 H12 sing N N 293 QIE C2 H13 sing N N 294 QIE N7 H14 sing N N 295 QIE C12 H15 sing N N 296 QIE C11 H16 sing N N 297 QIE C10 H17 sing N N 298 SER N CA sing N N 299 SER N H sing N N 300 SER N H2 sing N N 301 SER CA C sing N N 302 SER CA CB sing N N 303 SER CA HA sing N N 304 SER C O doub N N 305 SER C OXT sing N N 306 SER CB OG sing N N 307 SER CB HB2 sing N N 308 SER CB HB3 sing N N 309 SER OG HG sing N N 310 SER OXT HXT sing N N 311 THR N CA sing N N 312 THR N H sing N N 313 THR N H2 sing N N 314 THR CA C sing N N 315 THR CA CB sing N N 316 THR CA HA sing N N 317 THR C O doub N N 318 THR C OXT sing N N 319 THR CB OG1 sing N N 320 THR CB CG2 sing N N 321 THR CB HB sing N N 322 THR OG1 HG1 sing N N 323 THR CG2 HG21 sing N N 324 THR CG2 HG22 sing N N 325 THR CG2 HG23 sing N N 326 THR OXT HXT sing N N 327 TRP N CA sing N N 328 TRP N H sing N N 329 TRP N H2 sing N N 330 TRP CA C sing N N 331 TRP CA CB sing N N 332 TRP CA HA sing N N 333 TRP C O doub N N 334 TRP C OXT sing N N 335 TRP CB CG sing N N 336 TRP CB HB2 sing N N 337 TRP CB HB3 sing N N 338 TRP CG CD1 doub Y N 339 TRP CG CD2 sing Y N 340 TRP CD1 NE1 sing Y N 341 TRP CD1 HD1 sing N N 342 TRP CD2 CE2 doub Y N 343 TRP CD2 CE3 sing Y N 344 TRP NE1 CE2 sing Y N 345 TRP NE1 HE1 sing N N 346 TRP CE2 CZ2 sing Y N 347 TRP CE3 CZ3 doub Y N 348 TRP CE3 HE3 sing N N 349 TRP CZ2 CH2 doub Y N 350 TRP CZ2 HZ2 sing N N 351 TRP CZ3 CH2 sing Y N 352 TRP CZ3 HZ3 sing N N 353 TRP CH2 HH2 sing N N 354 TRP OXT HXT sing N N 355 TYR N CA sing N N 356 TYR N H sing N N 357 TYR N H2 sing N N 358 TYR CA C sing N N 359 TYR CA CB sing N N 360 TYR CA HA sing N N 361 TYR C O doub N N 362 TYR C OXT sing N N 363 TYR CB CG sing N N 364 TYR CB HB2 sing N N 365 TYR CB HB3 sing N N 366 TYR CG CD1 doub Y N 367 TYR CG CD2 sing Y N 368 TYR CD1 CE1 sing Y N 369 TYR CD1 HD1 sing N N 370 TYR CD2 CE2 doub Y N 371 TYR CD2 HD2 sing N N 372 TYR CE1 CZ doub Y N 373 TYR CE1 HE1 sing N N 374 TYR CE2 CZ sing Y N 375 TYR CE2 HE2 sing N N 376 TYR CZ OH sing N N 377 TYR OH HH sing N N 378 TYR OXT HXT sing N N 379 VAL N CA sing N N 380 VAL N H sing N N 381 VAL N H2 sing N N 382 VAL CA C sing N N 383 VAL CA CB sing N N 384 VAL CA HA sing N N 385 VAL C O doub N N 386 VAL C OXT sing N N 387 VAL CB CG1 sing N N 388 VAL CB CG2 sing N N 389 VAL CB HB sing N N 390 VAL CG1 HG11 sing N N 391 VAL CG1 HG12 sing N N 392 VAL CG1 HG13 sing N N 393 VAL CG2 HG21 sing N N 394 VAL CG2 HG22 sing N N 395 VAL CG2 HG23 sing N N 396 VAL OXT HXT sing N N 397 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id QIE _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id QIE _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-(6-bromopyridin-2-yl)-1-[(3-cyanophenyl)acetyl]-L-prolinamide' QIE 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1DIC _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #