data_8DDD # _entry.id 8DDD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.378 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8DDD pdb_00008ddd 10.2210/pdb8ddd/pdb WWPDB D_1000266437 ? ? BMRB 31027 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Intramembrane recognition between transmembrane domains of IL-9R and common gamma chain' _pdbx_database_related.db_id 31027 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8DDD _pdbx_database_status.recvd_initial_deposition_date 2022-06-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lenoir Capello, R.' 1 0000-0003-2225-3167 'Cai, T.' 2 0000-0002-0140-8329 'Chou, J.J.' 3 0000-0002-4442-0344 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 381 _citation.language ? _citation.page_first 569 _citation.page_last 576 _citation.title 'Structural basis of gamma chain family receptor sharing at the membrane level.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.add1219 _citation.pdbx_database_id_PubMed 37535730 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cai, T.' 1 0000-0002-0140-8329 primary 'Lenoir Capello, R.' 2 0000-0003-2225-3167 primary 'Pi, X.' 3 0000-0001-8835-6914 primary 'Wu, H.' 4 0000-0002-7281-8579 primary 'Chou, J.J.' 5 0000-0002-4442-0344 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cytokine receptor common subunit gamma' 3864.547 1 ? 'M271V, C282F' 'Transmembrane domain, residues 253-286' ? 2 polymer man 'Interleukin-9 receptor' 3540.373 1 ? ? 'Transmembrane domain, residues 268-298' ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Interleukin-2 receptor subunit gamma,IL-2 receptor subunit gamma,IL-2R subunit gamma,IL-2RG,gammaC,p64' 2 'IL-9 receptor,IL-9R' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no EENPSLFALEAVLIPVGTVGLIITLIFVYFWLER EENPSLFALEAVLIPVGTVGLIITLIFVYFWLER A ? 2 'polypeptide(L)' no no QWSASILVVVPIFLLLTGFVHLLFKLSPRLK QWSASILVVVPIFLLLTGFVHLLFKLSPRLK B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 GLU n 1 3 ASN n 1 4 PRO n 1 5 SER n 1 6 LEU n 1 7 PHE n 1 8 ALA n 1 9 LEU n 1 10 GLU n 1 11 ALA n 1 12 VAL n 1 13 LEU n 1 14 ILE n 1 15 PRO n 1 16 VAL n 1 17 GLY n 1 18 THR n 1 19 VAL n 1 20 GLY n 1 21 LEU n 1 22 ILE n 1 23 ILE n 1 24 THR n 1 25 LEU n 1 26 ILE n 1 27 PHE n 1 28 VAL n 1 29 TYR n 1 30 PHE n 1 31 TRP n 1 32 LEU n 1 33 GLU n 1 34 ARG n 2 1 GLN n 2 2 TRP n 2 3 SER n 2 4 ALA n 2 5 SER n 2 6 ILE n 2 7 LEU n 2 8 VAL n 2 9 VAL n 2 10 VAL n 2 11 PRO n 2 12 ILE n 2 13 PHE n 2 14 LEU n 2 15 LEU n 2 16 LEU n 2 17 THR n 2 18 GLY n 2 19 PHE n 2 20 VAL n 2 21 HIS n 2 22 LEU n 2 23 LEU n 2 24 PHE n 2 25 LYS n 2 26 LEU n 2 27 SER n 2 28 PRO n 2 29 ARG n 2 30 LEU n 2 31 LYS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 34 'house mouse' ? Il2rg ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 31 'house mouse' ? Il9r ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' C43 ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP IL2RG_MOUSE P34902 ? 1 EENPSLFALEAVLIPVGTMGLIITLIFVYCWLER 253 2 UNP IL9R_MOUSE Q01114 ? 2 QWSASILVVVPIFLLLTGFVHLLFKLSPRLK 268 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8DDD A 1 ? 34 ? P34902 253 ? 286 ? 253 286 2 2 8DDD B 1 ? 31 ? Q01114 268 ? 298 ? 268 298 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8DDD VAL A 19 ? UNP P34902 MET 271 'engineered mutation' 271 1 1 8DDD PHE A 30 ? UNP P34902 CYS 282 'engineered mutation' 282 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N TROSY-HSQC' 1 isotropic 2 1 2 '2D 1H-15N TROSY-HSQC' 1 isotropic 3 1 3 '2D 1H-15N TROSY-HSQC' 4 isotropic 4 1 4 '2D 1H-15N TROSY-HSQC' 4 isotropic 5 1 3 '2D 1H-13C HSQC' 4 isotropic 6 1 4 '2D 1H-13C HSQC' 4 isotropic 7 1 1 '3D TROSY HNCA' 1 isotropic 8 1 2 '3D TROSY HNCA' 1 isotropic 9 1 1 '3D TROSY HN(CO)CA' 1 isotropic 10 1 2 '3D TROSY HN(CO)CA' 1 isotropic 11 1 1 '3D TROSY HNCO' 1 isotropic 12 1 2 '3D TROSY HNCO' 1 isotropic 13 1 1 '3D TROSY HNCACO' 1 isotropic 14 1 2 '3D TROSY HNCACO' 1 isotropic 15 1 3 '3D 1H-15N NOESY-TROSY' 4 isotropic 16 1 4 '3D 1H-15N NOESY-TROSY' 4 isotropic 17 1 5 '3D 1H-15N NOESY-TROSY' 4 isotropic 18 1 3 '3D 1H-13C NOESY' 4 isotropic 19 1 4 '3D 1H-13C NOESY' 4 isotropic 20 1 5 '3D 1H-13C NOESY' 4 isotropic 21 1 3 '2D Methyl-Amide Intermolecular NOESY' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.15 _pdbx_nmr_exptl_sample_conditions.details 'The condition used for all NMR data collection' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label 'NMR measurements' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err 0.01 _pdbx_nmr_exptl_sample_conditions.temperature_err 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.4 mM 15N, 13C, 85%2H Transmembrane domain of the common gamma-chain receptor, 40 mM DMPC, 100 mM DH6PC, 90% H2O/10% D2O' '90% H2O/10% D2O' 'gC(15N,13C,85%2H)' bicelle '(15N,13C,85%2H)-labeled gamma-chain TMD in DMPC-DHPC Bicelles (q=0.4) for triple resonance experiments.' 2 '0.4 mM 15N, 13C, 85%2H Transmembrane domain of the Interleukin-9 receptor alpha subunit, 40 mM DMPC, 100 mM DH6PC, 90% H2O/10% D2O' '90% H2O/10% D2O' '9R(15N,13C,85%2H)' bicelle '(15N,13C,85%2H)-labeled IL-9 receptor TMD in DMPC-DHPC Bicelles (q=0.4) for triple resonance experiments.' 3 ;0.4 mM 13C Transmembrane domain of the Interleukin-9 receptor alpha subunit, 0.4 mM 15N, 2H Transmembrane domain of the common gamma-chain receptor, 80 mM deuterated DMPC, 200 mM deuterated DH6PC, 90% H2O/10% D2O ; '90% H2O/10% D2O' 'gC(15N,2H)-9R(13C)' bicelle ;(15N,2H)-labeled gamma chain TMD mixed with (13C)-labeled IL-9 receptor TMD at 1:1 molar ratio in DMPC-DHPC Bicelles (q=0.4) for detecting inter-molecular NOEs. ; 4 ;0.4 mM 13C Transmembrane domain of the common gamma-chain receptor, 0.4 mM 15N, 2H Transmembrane domain of the Interleukin-9 receptor alpha subunit, 80 mM deuterated DMPC, 200 mM deuterated DH6PC, 90% H2O/10% D2O ; '90% H2O/10% D2O' '9R(15N,2H)-gC(13C)' bicelle ;(15N,2H)-labeled IL-9 receptor TMD mixed with (13C)-labeled gamma-chain TMD at 1:1 molar ratio in DMPC-DHPC Bicelles (q=0.4) for detecting inter-molecular NOEs. ; 5 ;0.4 mM 13C Transmembrane domain of the Interleukin-9 receptor alpha subunit, 0.4 mM 15N, 2H Transmembrane domain of the common gamma-chain receptor, 80 mM deuterated DMPC, 200 mM deuterated DH6PC, 90% H2O/10% D2O ; '90% H2O/10% D2O' '9R(15N,13C)-gC(15N-13C)' bicelle ;(15N,13C)-labeled IL-9 receptor TMD mixed with (15N-13C)-labeled gamma-chain TMD at 1:1 molar ratio in DMPC-DHPC Bicelles (q=0.4) for detecting inter-molecular NOEs. ; # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE NEO' ? Bruker 700 ? 4 'AVANCE III' ? Bruker 800 ? # _pdbx_nmr_refine.entry_id 8DDD _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # _pdbx_nmr_ensemble.entry_id 8DDD _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8DDD _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 'chemical shift assignment' XEASY ? 'Bartels et al.' 4 'chemical shift calculation' TALOS+ ? 'Shen, Delaglio, Cornilescu, Bax' 5 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8DDD _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8DDD _struct.title 'Intramembrane recognition between transmembrane domains of IL-9R and common gamma chain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8DDD _struct_keywords.text 'common gamma-chain cytokine receptor, transmembrane domain, receptor sharing, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 4 ? ALA A 8 ? PRO A 256 ALA A 260 5 ? 5 HELX_P HELX_P2 AA2 LEU A 9 ? GLU A 33 ? LEU A 261 GLU A 285 1 ? 25 HELX_P HELX_P3 AA3 SER B 3 ? LEU B 26 ? SER B 270 LEU B 293 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 8DDD _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 253 253 GLU GLU A . n A 1 2 GLU 2 254 254 GLU GLU A . n A 1 3 ASN 3 255 255 ASN ASN A . n A 1 4 PRO 4 256 256 PRO PRO A . n A 1 5 SER 5 257 257 SER SER A . n A 1 6 LEU 6 258 258 LEU LEU A . n A 1 7 PHE 7 259 259 PHE PHE A . n A 1 8 ALA 8 260 260 ALA ALA A . n A 1 9 LEU 9 261 261 LEU LEU A . n A 1 10 GLU 10 262 262 GLU GLU A . n A 1 11 ALA 11 263 263 ALA ALA A . n A 1 12 VAL 12 264 264 VAL VAL A . n A 1 13 LEU 13 265 265 LEU LEU A . n A 1 14 ILE 14 266 266 ILE ILE A . n A 1 15 PRO 15 267 267 PRO PRO A . n A 1 16 VAL 16 268 268 VAL VAL A . n A 1 17 GLY 17 269 269 GLY GLY A . n A 1 18 THR 18 270 270 THR THR A . n A 1 19 VAL 19 271 271 VAL VAL A . n A 1 20 GLY 20 272 272 GLY GLY A . n A 1 21 LEU 21 273 273 LEU LEU A . n A 1 22 ILE 22 274 274 ILE ILE A . n A 1 23 ILE 23 275 275 ILE ILE A . n A 1 24 THR 24 276 276 THR THR A . n A 1 25 LEU 25 277 277 LEU LEU A . n A 1 26 ILE 26 278 278 ILE ILE A . n A 1 27 PHE 27 279 279 PHE PHE A . n A 1 28 VAL 28 280 280 VAL VAL A . n A 1 29 TYR 29 281 281 TYR TYR A . n A 1 30 PHE 30 282 282 PHE PHE A . n A 1 31 TRP 31 283 283 TRP TRP A . n A 1 32 LEU 32 284 284 LEU LEU A . n A 1 33 GLU 33 285 285 GLU GLU A . n A 1 34 ARG 34 286 286 ARG ARG A . n B 2 1 GLN 1 268 268 GLN GLN B . n B 2 2 TRP 2 269 269 TRP TRP B . n B 2 3 SER 3 270 270 SER SER B . n B 2 4 ALA 4 271 271 ALA ALA B . n B 2 5 SER 5 272 272 SER SER B . n B 2 6 ILE 6 273 273 ILE ILE B . n B 2 7 LEU 7 274 274 LEU LEU B . n B 2 8 VAL 8 275 275 VAL VAL B . n B 2 9 VAL 9 276 276 VAL VAL B . n B 2 10 VAL 10 277 277 VAL VAL B . n B 2 11 PRO 11 278 278 PRO PRO B . n B 2 12 ILE 12 279 279 ILE ILE B . n B 2 13 PHE 13 280 280 PHE PHE B . n B 2 14 LEU 14 281 281 LEU LEU B . n B 2 15 LEU 15 282 282 LEU LEU B . n B 2 16 LEU 16 283 283 LEU LEU B . n B 2 17 THR 17 284 284 THR THR B . n B 2 18 GLY 18 285 285 GLY GLY B . n B 2 19 PHE 19 286 286 PHE PHE B . n B 2 20 VAL 20 287 287 VAL VAL B . n B 2 21 HIS 21 288 288 HIS HIS B . n B 2 22 LEU 22 289 289 LEU LEU B . n B 2 23 LEU 23 290 290 LEU LEU B . n B 2 24 PHE 24 291 291 PHE PHE B . n B 2 25 LYS 25 292 292 LYS LYS B . n B 2 26 LEU 26 293 293 LEU LEU B . n B 2 27 SER 27 294 294 SER SER B . n B 2 28 PRO 28 295 295 PRO PRO B . n B 2 29 ARG 29 296 296 ARG ARG B . n B 2 30 LEU 30 297 297 LEU LEU B . n B 2 31 LYS 31 298 298 LYS LYS B . n # _pdbx_contact_author.id 3 _pdbx_contact_author.email james_chou@hms.harvard.edu _pdbx_contact_author.name_first James _pdbx_contact_author.name_last Chou _pdbx_contact_author.name_mi J _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4442-0344 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 960 ? 1 MORE -14 ? 1 'SSA (A^2)' 6380 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-07-05 2 'Structure model' 1 1 2023-08-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' citation 4 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Transmembrane domain of the common gamma-chain receptor' 0.4 ? mM '15N, 13C, 85%2H' 1 DMPC 40 ? mM 'natural abundance' 1 DH6PC 100 ? mM 'natural abundance' 2 'Transmembrane domain of the Interleukin-9 receptor alpha subunit' 0.4 ? mM '15N, 13C, 85%2H' 2 DMPC 40 ? mM 'natural abundance' 2 DH6PC 100 ? mM 'natural abundance' 3 'Transmembrane domain of the Interleukin-9 receptor alpha subunit' 0.4 ? mM 13C 3 'Transmembrane domain of the common gamma-chain receptor' 0.4 ? mM '15N, 2H' 3 DMPC 80 ? mM deuterated 3 DH6PC 200 ? mM deuterated 4 'Transmembrane domain of the common gamma-chain receptor' 0.4 ? mM 13C 4 'Transmembrane domain of the Interleukin-9 receptor alpha subunit' 0.4 ? mM '15N, 2H' 4 DMPC 80 ? mM deuterated 4 DH6PC 200 ? mM deuterated 5 'Transmembrane domain of the Interleukin-9 receptor alpha subunit' 0.4 ? mM 13C 5 'Transmembrane domain of the common gamma-chain receptor' 0.4 ? mM '15N, 2H' 5 DMPC 80 ? mM deuterated 5 DH6PC 200 ? mM deuterated # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 255 ? ? 60.04 156.63 2 2 LEU A 261 ? ? -44.24 151.15 3 2 TRP B 269 ? ? 53.81 99.86 4 2 SER B 270 ? ? -111.72 64.40 5 3 GLU A 254 ? ? 55.05 174.97 6 3 ASN A 255 ? ? 54.12 70.89 7 3 LEU A 261 ? ? -57.89 -175.02 8 4 ASN A 255 ? ? -174.77 -58.09 9 4 SER B 270 ? ? -151.07 83.47 10 5 ALA A 260 ? ? -89.55 31.93 11 5 LEU A 261 ? ? -62.25 -176.51 12 5 GLU A 285 ? ? 65.18 -76.43 13 6 ASN A 255 ? ? 53.63 89.07 14 6 ALA A 260 ? ? -93.28 31.91 15 6 SER B 294 ? ? -162.04 94.79 16 7 GLU A 254 ? ? -142.49 -38.30 17 7 PRO A 256 ? ? -91.40 33.12 18 7 ALA A 260 ? ? -91.74 35.89 19 7 LEU A 261 ? ? -43.35 151.32 20 7 GLU A 285 ? ? 61.97 148.92 21 8 GLU A 254 ? ? 55.41 73.48 22 8 ASN A 255 ? ? -169.08 117.51 23 8 ALA A 260 ? ? -88.04 43.39 24 8 PRO B 295 ? ? -91.50 32.23 25 9 LEU A 261 ? ? 38.56 106.82 26 9 TRP B 269 ? ? 58.68 94.33 27 9 SER B 270 ? ? -87.93 47.85 28 9 PRO B 295 ? ? -89.39 34.16 29 10 GLU A 285 ? ? 59.53 174.38 30 10 TRP B 269 ? ? 55.68 175.74 31 11 ALA A 260 ? ? -90.73 31.25 32 11 SER B 270 ? ? -172.40 -32.84 33 12 ASN A 255 ? ? -176.11 90.19 34 12 ALA A 260 ? ? -89.65 33.12 35 12 LEU A 261 ? ? -58.25 -173.68 36 13 PRO A 256 ? ? -68.83 69.60 37 13 LEU A 261 ? ? -61.81 -179.04 38 13 GLU A 285 ? ? 60.69 153.20 39 14 PRO A 256 ? ? -87.89 38.48 40 14 SER B 270 ? ? -53.71 104.79 41 15 PRO A 256 ? ? -84.56 36.52 42 15 ALA A 260 ? ? -91.80 39.57 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 HIS N N N N 121 HIS CA C N S 122 HIS C C N N 123 HIS O O N N 124 HIS CB C N N 125 HIS CG C Y N 126 HIS ND1 N Y N 127 HIS CD2 C Y N 128 HIS CE1 C Y N 129 HIS NE2 N Y N 130 HIS OXT O N N 131 HIS H H N N 132 HIS H2 H N N 133 HIS HA H N N 134 HIS HB2 H N N 135 HIS HB3 H N N 136 HIS HD1 H N N 137 HIS HD2 H N N 138 HIS HE1 H N N 139 HIS HE2 H N N 140 HIS HXT H N N 141 ILE N N N N 142 ILE CA C N S 143 ILE C C N N 144 ILE O O N N 145 ILE CB C N S 146 ILE CG1 C N N 147 ILE CG2 C N N 148 ILE CD1 C N N 149 ILE OXT O N N 150 ILE H H N N 151 ILE H2 H N N 152 ILE HA H N N 153 ILE HB H N N 154 ILE HG12 H N N 155 ILE HG13 H N N 156 ILE HG21 H N N 157 ILE HG22 H N N 158 ILE HG23 H N N 159 ILE HD11 H N N 160 ILE HD12 H N N 161 ILE HD13 H N N 162 ILE HXT H N N 163 LEU N N N N 164 LEU CA C N S 165 LEU C C N N 166 LEU O O N N 167 LEU CB C N N 168 LEU CG C N N 169 LEU CD1 C N N 170 LEU CD2 C N N 171 LEU OXT O N N 172 LEU H H N N 173 LEU H2 H N N 174 LEU HA H N N 175 LEU HB2 H N N 176 LEU HB3 H N N 177 LEU HG H N N 178 LEU HD11 H N N 179 LEU HD12 H N N 180 LEU HD13 H N N 181 LEU HD21 H N N 182 LEU HD22 H N N 183 LEU HD23 H N N 184 LEU HXT H N N 185 LYS N N N N 186 LYS CA C N S 187 LYS C C N N 188 LYS O O N N 189 LYS CB C N N 190 LYS CG C N N 191 LYS CD C N N 192 LYS CE C N N 193 LYS NZ N N N 194 LYS OXT O N N 195 LYS H H N N 196 LYS H2 H N N 197 LYS HA H N N 198 LYS HB2 H N N 199 LYS HB3 H N N 200 LYS HG2 H N N 201 LYS HG3 H N N 202 LYS HD2 H N N 203 LYS HD3 H N N 204 LYS HE2 H N N 205 LYS HE3 H N N 206 LYS HZ1 H N N 207 LYS HZ2 H N N 208 LYS HZ3 H N N 209 LYS HXT H N N 210 MET N N N N 211 MET CA C N S 212 MET C C N N 213 MET O O N N 214 MET CB C N N 215 MET CG C N N 216 MET SD S N N 217 MET CE C N N 218 MET OXT O N N 219 MET H H N N 220 MET H2 H N N 221 MET HA H N N 222 MET HB2 H N N 223 MET HB3 H N N 224 MET HG2 H N N 225 MET HG3 H N N 226 MET HE1 H N N 227 MET HE2 H N N 228 MET HE3 H N N 229 MET HXT H N N 230 PHE N N N N 231 PHE CA C N S 232 PHE C C N N 233 PHE O O N N 234 PHE CB C N N 235 PHE CG C Y N 236 PHE CD1 C Y N 237 PHE CD2 C Y N 238 PHE CE1 C Y N 239 PHE CE2 C Y N 240 PHE CZ C Y N 241 PHE OXT O N N 242 PHE H H N N 243 PHE H2 H N N 244 PHE HA H N N 245 PHE HB2 H N N 246 PHE HB3 H N N 247 PHE HD1 H N N 248 PHE HD2 H N N 249 PHE HE1 H N N 250 PHE HE2 H N N 251 PHE HZ H N N 252 PHE HXT H N N 253 PRO N N N N 254 PRO CA C N S 255 PRO C C N N 256 PRO O O N N 257 PRO CB C N N 258 PRO CG C N N 259 PRO CD C N N 260 PRO OXT O N N 261 PRO H H N N 262 PRO HA H N N 263 PRO HB2 H N N 264 PRO HB3 H N N 265 PRO HG2 H N N 266 PRO HG3 H N N 267 PRO HD2 H N N 268 PRO HD3 H N N 269 PRO HXT H N N 270 SER N N N N 271 SER CA C N S 272 SER C C N N 273 SER O O N N 274 SER CB C N N 275 SER OG O N N 276 SER OXT O N N 277 SER H H N N 278 SER H2 H N N 279 SER HA H N N 280 SER HB2 H N N 281 SER HB3 H N N 282 SER HG H N N 283 SER HXT H N N 284 THR N N N N 285 THR CA C N S 286 THR C C N N 287 THR O O N N 288 THR CB C N R 289 THR OG1 O N N 290 THR CG2 C N N 291 THR OXT O N N 292 THR H H N N 293 THR H2 H N N 294 THR HA H N N 295 THR HB H N N 296 THR HG1 H N N 297 THR HG21 H N N 298 THR HG22 H N N 299 THR HG23 H N N 300 THR HXT H N N 301 TRP N N N N 302 TRP CA C N S 303 TRP C C N N 304 TRP O O N N 305 TRP CB C N N 306 TRP CG C Y N 307 TRP CD1 C Y N 308 TRP CD2 C Y N 309 TRP NE1 N Y N 310 TRP CE2 C Y N 311 TRP CE3 C Y N 312 TRP CZ2 C Y N 313 TRP CZ3 C Y N 314 TRP CH2 C Y N 315 TRP OXT O N N 316 TRP H H N N 317 TRP H2 H N N 318 TRP HA H N N 319 TRP HB2 H N N 320 TRP HB3 H N N 321 TRP HD1 H N N 322 TRP HE1 H N N 323 TRP HE3 H N N 324 TRP HZ2 H N N 325 TRP HZ3 H N N 326 TRP HH2 H N N 327 TRP HXT H N N 328 TYR N N N N 329 TYR CA C N S 330 TYR C C N N 331 TYR O O N N 332 TYR CB C N N 333 TYR CG C Y N 334 TYR CD1 C Y N 335 TYR CD2 C Y N 336 TYR CE1 C Y N 337 TYR CE2 C Y N 338 TYR CZ C Y N 339 TYR OH O N N 340 TYR OXT O N N 341 TYR H H N N 342 TYR H2 H N N 343 TYR HA H N N 344 TYR HB2 H N N 345 TYR HB3 H N N 346 TYR HD1 H N N 347 TYR HD2 H N N 348 TYR HE1 H N N 349 TYR HE2 H N N 350 TYR HH H N N 351 TYR HXT H N N 352 VAL N N N N 353 VAL CA C N S 354 VAL C C N N 355 VAL O O N N 356 VAL CB C N N 357 VAL CG1 C N N 358 VAL CG2 C N N 359 VAL OXT O N N 360 VAL H H N N 361 VAL H2 H N N 362 VAL HA H N N 363 VAL HB H N N 364 VAL HG11 H N N 365 VAL HG12 H N N 366 VAL HG13 H N N 367 VAL HG21 H N N 368 VAL HG22 H N N 369 VAL HG23 H N N 370 VAL HXT H N N 371 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 HIS N CA sing N N 114 HIS N H sing N N 115 HIS N H2 sing N N 116 HIS CA C sing N N 117 HIS CA CB sing N N 118 HIS CA HA sing N N 119 HIS C O doub N N 120 HIS C OXT sing N N 121 HIS CB CG sing N N 122 HIS CB HB2 sing N N 123 HIS CB HB3 sing N N 124 HIS CG ND1 sing Y N 125 HIS CG CD2 doub Y N 126 HIS ND1 CE1 doub Y N 127 HIS ND1 HD1 sing N N 128 HIS CD2 NE2 sing Y N 129 HIS CD2 HD2 sing N N 130 HIS CE1 NE2 sing Y N 131 HIS CE1 HE1 sing N N 132 HIS NE2 HE2 sing N N 133 HIS OXT HXT sing N N 134 ILE N CA sing N N 135 ILE N H sing N N 136 ILE N H2 sing N N 137 ILE CA C sing N N 138 ILE CA CB sing N N 139 ILE CA HA sing N N 140 ILE C O doub N N 141 ILE C OXT sing N N 142 ILE CB CG1 sing N N 143 ILE CB CG2 sing N N 144 ILE CB HB sing N N 145 ILE CG1 CD1 sing N N 146 ILE CG1 HG12 sing N N 147 ILE CG1 HG13 sing N N 148 ILE CG2 HG21 sing N N 149 ILE CG2 HG22 sing N N 150 ILE CG2 HG23 sing N N 151 ILE CD1 HD11 sing N N 152 ILE CD1 HD12 sing N N 153 ILE CD1 HD13 sing N N 154 ILE OXT HXT sing N N 155 LEU N CA sing N N 156 LEU N H sing N N 157 LEU N H2 sing N N 158 LEU CA C sing N N 159 LEU CA CB sing N N 160 LEU CA HA sing N N 161 LEU C O doub N N 162 LEU C OXT sing N N 163 LEU CB CG sing N N 164 LEU CB HB2 sing N N 165 LEU CB HB3 sing N N 166 LEU CG CD1 sing N N 167 LEU CG CD2 sing N N 168 LEU CG HG sing N N 169 LEU CD1 HD11 sing N N 170 LEU CD1 HD12 sing N N 171 LEU CD1 HD13 sing N N 172 LEU CD2 HD21 sing N N 173 LEU CD2 HD22 sing N N 174 LEU CD2 HD23 sing N N 175 LEU OXT HXT sing N N 176 LYS N CA sing N N 177 LYS N H sing N N 178 LYS N H2 sing N N 179 LYS CA C sing N N 180 LYS CA CB sing N N 181 LYS CA HA sing N N 182 LYS C O doub N N 183 LYS C OXT sing N N 184 LYS CB CG sing N N 185 LYS CB HB2 sing N N 186 LYS CB HB3 sing N N 187 LYS CG CD sing N N 188 LYS CG HG2 sing N N 189 LYS CG HG3 sing N N 190 LYS CD CE sing N N 191 LYS CD HD2 sing N N 192 LYS CD HD3 sing N N 193 LYS CE NZ sing N N 194 LYS CE HE2 sing N N 195 LYS CE HE3 sing N N 196 LYS NZ HZ1 sing N N 197 LYS NZ HZ2 sing N N 198 LYS NZ HZ3 sing N N 199 LYS OXT HXT sing N N 200 MET N CA sing N N 201 MET N H sing N N 202 MET N H2 sing N N 203 MET CA C sing N N 204 MET CA CB sing N N 205 MET CA HA sing N N 206 MET C O doub N N 207 MET C OXT sing N N 208 MET CB CG sing N N 209 MET CB HB2 sing N N 210 MET CB HB3 sing N N 211 MET CG SD sing N N 212 MET CG HG2 sing N N 213 MET CG HG3 sing N N 214 MET SD CE sing N N 215 MET CE HE1 sing N N 216 MET CE HE2 sing N N 217 MET CE HE3 sing N N 218 MET OXT HXT sing N N 219 PHE N CA sing N N 220 PHE N H sing N N 221 PHE N H2 sing N N 222 PHE CA C sing N N 223 PHE CA CB sing N N 224 PHE CA HA sing N N 225 PHE C O doub N N 226 PHE C OXT sing N N 227 PHE CB CG sing N N 228 PHE CB HB2 sing N N 229 PHE CB HB3 sing N N 230 PHE CG CD1 doub Y N 231 PHE CG CD2 sing Y N 232 PHE CD1 CE1 sing Y N 233 PHE CD1 HD1 sing N N 234 PHE CD2 CE2 doub Y N 235 PHE CD2 HD2 sing N N 236 PHE CE1 CZ doub Y N 237 PHE CE1 HE1 sing N N 238 PHE CE2 CZ sing Y N 239 PHE CE2 HE2 sing N N 240 PHE CZ HZ sing N N 241 PHE OXT HXT sing N N 242 PRO N CA sing N N 243 PRO N CD sing N N 244 PRO N H sing N N 245 PRO CA C sing N N 246 PRO CA CB sing N N 247 PRO CA HA sing N N 248 PRO C O doub N N 249 PRO C OXT sing N N 250 PRO CB CG sing N N 251 PRO CB HB2 sing N N 252 PRO CB HB3 sing N N 253 PRO CG CD sing N N 254 PRO CG HG2 sing N N 255 PRO CG HG3 sing N N 256 PRO CD HD2 sing N N 257 PRO CD HD3 sing N N 258 PRO OXT HXT sing N N 259 SER N CA sing N N 260 SER N H sing N N 261 SER N H2 sing N N 262 SER CA C sing N N 263 SER CA CB sing N N 264 SER CA HA sing N N 265 SER C O doub N N 266 SER C OXT sing N N 267 SER CB OG sing N N 268 SER CB HB2 sing N N 269 SER CB HB3 sing N N 270 SER OG HG sing N N 271 SER OXT HXT sing N N 272 THR N CA sing N N 273 THR N H sing N N 274 THR N H2 sing N N 275 THR CA C sing N N 276 THR CA CB sing N N 277 THR CA HA sing N N 278 THR C O doub N N 279 THR C OXT sing N N 280 THR CB OG1 sing N N 281 THR CB CG2 sing N N 282 THR CB HB sing N N 283 THR OG1 HG1 sing N N 284 THR CG2 HG21 sing N N 285 THR CG2 HG22 sing N N 286 THR CG2 HG23 sing N N 287 THR OXT HXT sing N N 288 TRP N CA sing N N 289 TRP N H sing N N 290 TRP N H2 sing N N 291 TRP CA C sing N N 292 TRP CA CB sing N N 293 TRP CA HA sing N N 294 TRP C O doub N N 295 TRP C OXT sing N N 296 TRP CB CG sing N N 297 TRP CB HB2 sing N N 298 TRP CB HB3 sing N N 299 TRP CG CD1 doub Y N 300 TRP CG CD2 sing Y N 301 TRP CD1 NE1 sing Y N 302 TRP CD1 HD1 sing N N 303 TRP CD2 CE2 doub Y N 304 TRP CD2 CE3 sing Y N 305 TRP NE1 CE2 sing Y N 306 TRP NE1 HE1 sing N N 307 TRP CE2 CZ2 sing Y N 308 TRP CE3 CZ3 doub Y N 309 TRP CE3 HE3 sing N N 310 TRP CZ2 CH2 doub Y N 311 TRP CZ2 HZ2 sing N N 312 TRP CZ3 CH2 sing Y N 313 TRP CZ3 HZ3 sing N N 314 TRP CH2 HH2 sing N N 315 TRP OXT HXT sing N N 316 TYR N CA sing N N 317 TYR N H sing N N 318 TYR N H2 sing N N 319 TYR CA C sing N N 320 TYR CA CB sing N N 321 TYR CA HA sing N N 322 TYR C O doub N N 323 TYR C OXT sing N N 324 TYR CB CG sing N N 325 TYR CB HB2 sing N N 326 TYR CB HB3 sing N N 327 TYR CG CD1 doub Y N 328 TYR CG CD2 sing Y N 329 TYR CD1 CE1 sing Y N 330 TYR CD1 HD1 sing N N 331 TYR CD2 CE2 doub Y N 332 TYR CD2 HD2 sing N N 333 TYR CE1 CZ doub Y N 334 TYR CE1 HE1 sing N N 335 TYR CE2 CZ sing Y N 336 TYR CE2 HE2 sing N N 337 TYR CZ OH sing N N 338 TYR OH HH sing N N 339 TYR OXT HXT sing N N 340 VAL N CA sing N N 341 VAL N H sing N N 342 VAL N H2 sing N N 343 VAL CA C sing N N 344 VAL CA CB sing N N 345 VAL CA HA sing N N 346 VAL C O doub N N 347 VAL C OXT sing N N 348 VAL CB CG1 sing N N 349 VAL CB CG2 sing N N 350 VAL CB HB sing N N 351 VAL CG1 HG11 sing N N 352 VAL CG1 HG12 sing N N 353 VAL CG1 HG13 sing N N 354 VAL CG2 HG21 sing N N 355 VAL CG2 HG22 sing N N 356 VAL CG2 HG23 sing N N 357 VAL OXT HXT sing N N 358 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM140887 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' AI150709 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM132079 3 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'Inter-molecular NOEs' #