data_8DEG # _entry.id 8DEG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8DEG pdb_00008deg 10.2210/pdb8deg/pdb WWPDB D_1000266493 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-12-14 2 'Structure model' 1 1 2023-01-04 3 'Structure model' 1 2 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8DEG _pdbx_database_status.recvd_initial_deposition_date 2022-06-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email devicente@dnli.com _pdbx_contact_author.name_first Javier _pdbx_contact_author.name_last 'de Vicente' _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2498-0843 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Srivastava, A.' 1 ? 'Lexa, K.' 2 ? 'de Vicente, J.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 16290 _citation.page_last 16312 _citation.title ;Discovery of Potent and Selective Dual Leucine Zipper Kinase/Leucine Zipper-Bearing Kinase Inhibitors with Neuroprotective Properties in In Vitro and In Vivo Models of Amyotrophic Lateral Sclerosis. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.2c01056 _citation.pdbx_database_id_PubMed 36469401 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Craig 2nd, R.A.' 1 ? primary 'Fox, B.M.' 2 ? primary 'Hu, C.' 3 ? primary 'Lexa, K.W.' 4 ? primary 'Osipov, M.' 5 ? primary 'Thottumkara, A.P.' 6 ? primary 'Larhammar, M.' 7 ? primary 'Miyamoto, T.' 8 ? primary 'Rana, A.' 9 ? primary 'Kane, L.A.' 10 ? primary 'Yulyaningsih, E.' 11 ? primary 'Solanoy, H.' 12 ? primary 'Nguyen, H.' 13 ? primary 'Chau, R.' 14 ? primary 'Earr, T.' 15 ? primary 'Kajiwara, Y.' 16 ? primary 'Fleck, D.' 17 ? primary 'Lucas, A.' 18 ? primary 'Haddick, P.C.G.' 19 ? primary 'Takahashi, R.H.' 20 ? primary 'Tong, V.' 21 ? primary 'Wang, J.' 22 ? primary 'Canet, M.J.' 23 ? primary 'Poda, S.B.' 24 ? primary 'Scearce-Levie, K.' 25 ? primary 'Srivastava, A.' 26 ? primary 'Sweeney, Z.K.' 27 ? primary 'Xu, M.' 28 ? primary 'Zhang, R.' 29 ? primary 'He, J.' 30 ? primary 'Lei, Y.' 31 ? primary 'Zhuo, Z.' 32 ? primary 'de Vicente, J.' 33 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitogen-activated protein kinase kinase kinase 12' 36409.797 1 2.7.11.25 ? ? ? 2 non-polymer syn ;methyl (1S,4S)-5-{(4P)-4-[5-amino-6-(difluoromethoxy)pyrazin-2-yl]-6-[(1R,4R)-2-azabicyclo[2.1.1]hexan-2-yl]pyridin-2-yl}-2,5-diazabicyclo[2.2.1]heptane-2-carboxylate ; 473.476 1 ? ? ? ? 3 water nat water 18.015 30 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Dual leucine zipper bearing kinase,DLK,Leucine-zipper protein kinase,ZPK,MAPK-upstream kinase,MUK,Mixed lineage kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IFRIIHTVPPSGADPGPKRAEFMGSEDLWEVPFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVRDLKETDIKHLRKLK HPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDV VKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHL PVPSSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIKSEGTGNSHHHH HH ; _entity_poly.pdbx_seq_one_letter_code_can ;IFRIIHTVPPSGADPGPKRAEFMGSEDLWEVPFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVRDLKETDIKHLRKLK HPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDV VKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHL PVPSSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIKSEGTGNSHHHH HH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;methyl (1S,4S)-5-{(4P)-4-[5-amino-6-(difluoromethoxy)pyrazin-2-yl]-6-[(1R,4R)-2-azabicyclo[2.1.1]hexan-2-yl]pyridin-2-yl}-2,5-diazabicyclo[2.2.1]heptane-2-carboxylate ; SIQ 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 PHE n 1 3 ARG n 1 4 ILE n 1 5 ILE n 1 6 HIS n 1 7 THR n 1 8 VAL n 1 9 PRO n 1 10 PRO n 1 11 SER n 1 12 GLY n 1 13 ALA n 1 14 ASP n 1 15 PRO n 1 16 GLY n 1 17 PRO n 1 18 LYS n 1 19 ARG n 1 20 ALA n 1 21 GLU n 1 22 PHE n 1 23 MET n 1 24 GLY n 1 25 SER n 1 26 GLU n 1 27 ASP n 1 28 LEU n 1 29 TRP n 1 30 GLU n 1 31 VAL n 1 32 PRO n 1 33 PHE n 1 34 GLU n 1 35 GLU n 1 36 ILE n 1 37 LEU n 1 38 ASP n 1 39 LEU n 1 40 GLN n 1 41 TRP n 1 42 VAL n 1 43 GLY n 1 44 SER n 1 45 GLY n 1 46 ALA n 1 47 GLN n 1 48 GLY n 1 49 ALA n 1 50 VAL n 1 51 PHE n 1 52 LEU n 1 53 GLY n 1 54 ARG n 1 55 PHE n 1 56 HIS n 1 57 GLY n 1 58 GLU n 1 59 GLU n 1 60 VAL n 1 61 ALA n 1 62 VAL n 1 63 LYS n 1 64 LYS n 1 65 VAL n 1 66 ARG n 1 67 ASP n 1 68 LEU n 1 69 LYS n 1 70 GLU n 1 71 THR n 1 72 ASP n 1 73 ILE n 1 74 LYS n 1 75 HIS n 1 76 LEU n 1 77 ARG n 1 78 LYS n 1 79 LEU n 1 80 LYS n 1 81 HIS n 1 82 PRO n 1 83 ASN n 1 84 ILE n 1 85 ILE n 1 86 THR n 1 87 PHE n 1 88 LYS n 1 89 GLY n 1 90 VAL n 1 91 CYS n 1 92 THR n 1 93 GLN n 1 94 ALA n 1 95 PRO n 1 96 CYS n 1 97 TYR n 1 98 CYS n 1 99 ILE n 1 100 LEU n 1 101 MET n 1 102 GLU n 1 103 PHE n 1 104 CYS n 1 105 ALA n 1 106 GLN n 1 107 GLY n 1 108 GLN n 1 109 LEU n 1 110 TYR n 1 111 GLU n 1 112 VAL n 1 113 LEU n 1 114 ARG n 1 115 ALA n 1 116 GLY n 1 117 ARG n 1 118 PRO n 1 119 VAL n 1 120 THR n 1 121 PRO n 1 122 SER n 1 123 LEU n 1 124 LEU n 1 125 VAL n 1 126 ASP n 1 127 TRP n 1 128 SER n 1 129 MET n 1 130 GLY n 1 131 ILE n 1 132 ALA n 1 133 GLY n 1 134 GLY n 1 135 MET n 1 136 ASN n 1 137 TYR n 1 138 LEU n 1 139 HIS n 1 140 LEU n 1 141 HIS n 1 142 LYS n 1 143 ILE n 1 144 ILE n 1 145 HIS n 1 146 ARG n 1 147 ASP n 1 148 LEU n 1 149 LYS n 1 150 SER n 1 151 PRO n 1 152 ASN n 1 153 MET n 1 154 LEU n 1 155 ILE n 1 156 THR n 1 157 TYR n 1 158 ASP n 1 159 ASP n 1 160 VAL n 1 161 VAL n 1 162 LYS n 1 163 ILE n 1 164 SER n 1 165 ASP n 1 166 PHE n 1 167 GLY n 1 168 THR n 1 169 SER n 1 170 LYS n 1 171 GLU n 1 172 LEU n 1 173 SER n 1 174 ASP n 1 175 LYS n 1 176 SER n 1 177 THR n 1 178 LYS n 1 179 MET n 1 180 SER n 1 181 PHE n 1 182 ALA n 1 183 GLY n 1 184 THR n 1 185 VAL n 1 186 ALA n 1 187 TRP n 1 188 MET n 1 189 ALA n 1 190 PRO n 1 191 GLU n 1 192 VAL n 1 193 ILE n 1 194 ARG n 1 195 ASN n 1 196 GLU n 1 197 PRO n 1 198 VAL n 1 199 SER n 1 200 GLU n 1 201 LYS n 1 202 VAL n 1 203 ASP n 1 204 ILE n 1 205 TRP n 1 206 SER n 1 207 PHE n 1 208 GLY n 1 209 VAL n 1 210 VAL n 1 211 LEU n 1 212 TRP n 1 213 GLU n 1 214 LEU n 1 215 LEU n 1 216 THR n 1 217 GLY n 1 218 GLU n 1 219 ILE n 1 220 PRO n 1 221 TYR n 1 222 LYS n 1 223 ASP n 1 224 VAL n 1 225 ASP n 1 226 SER n 1 227 SER n 1 228 ALA n 1 229 ILE n 1 230 ILE n 1 231 TRP n 1 232 GLY n 1 233 VAL n 1 234 GLY n 1 235 SER n 1 236 ASN n 1 237 SER n 1 238 LEU n 1 239 HIS n 1 240 LEU n 1 241 PRO n 1 242 VAL n 1 243 PRO n 1 244 SER n 1 245 SER n 1 246 CYS n 1 247 PRO n 1 248 ASP n 1 249 GLY n 1 250 PHE n 1 251 LYS n 1 252 ILE n 1 253 LEU n 1 254 LEU n 1 255 ARG n 1 256 GLN n 1 257 CYS n 1 258 TRP n 1 259 ASN n 1 260 SER n 1 261 LYS n 1 262 PRO n 1 263 ARG n 1 264 ASN n 1 265 ARG n 1 266 PRO n 1 267 SER n 1 268 PHE n 1 269 ARG n 1 270 GLN n 1 271 ILE n 1 272 LEU n 1 273 LEU n 1 274 HIS n 1 275 LEU n 1 276 ASP n 1 277 ILE n 1 278 ALA n 1 279 SER n 1 280 ALA n 1 281 ASP n 1 282 VAL n 1 283 LEU n 1 284 SER n 1 285 THR n 1 286 PRO n 1 287 GLN n 1 288 GLU n 1 289 THR n 1 290 TYR n 1 291 PHE n 1 292 LYS n 1 293 SER n 1 294 GLN n 1 295 ALA n 1 296 GLU n 1 297 TRP n 1 298 ARG n 1 299 GLU n 1 300 GLU n 1 301 VAL n 1 302 LYS n 1 303 LEU n 1 304 HIS n 1 305 PHE n 1 306 GLU n 1 307 LYS n 1 308 ILE n 1 309 LYS n 1 310 SER n 1 311 GLU n 1 312 GLY n 1 313 THR n 1 314 GLY n 1 315 ASN n 1 316 SER n 1 317 HIS n 1 318 HIS n 1 319 HIS n 1 320 HIS n 1 321 HIS n 1 322 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 322 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MAP3K12, ZPK' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SIQ non-polymer . ;methyl (1S,4S)-5-{(4P)-4-[5-amino-6-(difluoromethoxy)pyrazin-2-yl]-6-[(1R,4R)-2-azabicyclo[2.1.1]hexan-2-yl]pyridin-2-yl}-2,5-diazabicyclo[2.2.1]heptane-2-carboxylate ; ? 'C22 H25 F2 N7 O3' 473.476 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 90 ? ? ? A . n A 1 2 PHE 2 91 ? ? ? A . n A 1 3 ARG 3 92 ? ? ? A . n A 1 4 ILE 4 93 ? ? ? A . n A 1 5 ILE 5 94 ? ? ? A . n A 1 6 HIS 6 95 ? ? ? A . n A 1 7 THR 7 96 ? ? ? A . n A 1 8 VAL 8 97 ? ? ? A . n A 1 9 PRO 9 98 ? ? ? A . n A 1 10 PRO 10 99 ? ? ? A . n A 1 11 SER 11 100 ? ? ? A . n A 1 12 GLY 12 101 ? ? ? A . n A 1 13 ALA 13 102 ? ? ? A . n A 1 14 ASP 14 103 ? ? ? A . n A 1 15 PRO 15 104 ? ? ? A . n A 1 16 GLY 16 105 ? ? ? A . n A 1 17 PRO 17 106 ? ? ? A . n A 1 18 LYS 18 107 ? ? ? A . n A 1 19 ARG 19 108 ? ? ? A . n A 1 20 ALA 20 109 ? ? ? A . n A 1 21 GLU 21 110 ? ? ? A . n A 1 22 PHE 22 111 ? ? ? A . n A 1 23 MET 23 112 ? ? ? A . n A 1 24 GLY 24 113 ? ? ? A . n A 1 25 SER 25 114 ? ? ? A . n A 1 26 GLU 26 115 ? ? ? A . n A 1 27 ASP 27 116 ? ? ? A . n A 1 28 LEU 28 117 117 LEU LEU A . n A 1 29 TRP 29 118 118 TRP TRP A . n A 1 30 GLU 30 119 119 GLU GLU A . n A 1 31 VAL 31 120 120 VAL VAL A . n A 1 32 PRO 32 121 121 PRO PRO A . n A 1 33 PHE 33 122 122 PHE PHE A . n A 1 34 GLU 34 123 123 GLU GLU A . n A 1 35 GLU 35 124 124 GLU GLU A . n A 1 36 ILE 36 125 125 ILE ILE A . n A 1 37 LEU 37 126 126 LEU LEU A . n A 1 38 ASP 38 127 127 ASP ASP A . n A 1 39 LEU 39 128 128 LEU LEU A . n A 1 40 GLN 40 129 129 GLN GLN A . n A 1 41 TRP 41 130 130 TRP TRP A . n A 1 42 VAL 42 131 131 VAL VAL A . n A 1 43 GLY 43 132 132 GLY GLY A . n A 1 44 SER 44 133 133 SER SER A . n A 1 45 GLY 45 134 134 GLY GLY A . n A 1 46 ALA 46 135 135 ALA ALA A . n A 1 47 GLN 47 136 136 GLN GLN A . n A 1 48 GLY 48 137 137 GLY GLY A . n A 1 49 ALA 49 138 138 ALA ALA A . n A 1 50 VAL 50 139 139 VAL VAL A . n A 1 51 PHE 51 140 140 PHE PHE A . n A 1 52 LEU 52 141 141 LEU LEU A . n A 1 53 GLY 53 142 142 GLY GLY A . n A 1 54 ARG 54 143 143 ARG ARG A . n A 1 55 PHE 55 144 144 PHE PHE A . n A 1 56 HIS 56 145 145 HIS HIS A . n A 1 57 GLY 57 146 146 GLY GLY A . n A 1 58 GLU 58 147 147 GLU GLU A . n A 1 59 GLU 59 148 148 GLU GLU A . n A 1 60 VAL 60 149 149 VAL VAL A . n A 1 61 ALA 61 150 150 ALA ALA A . n A 1 62 VAL 62 151 151 VAL VAL A . n A 1 63 LYS 63 152 152 LYS LYS A . n A 1 64 LYS 64 153 153 LYS LYS A . n A 1 65 VAL 65 154 154 VAL VAL A . n A 1 66 ARG 66 155 155 ARG ARG A . n A 1 67 ASP 67 156 156 ASP ASP A . n A 1 68 LEU 68 157 157 LEU LEU A . n A 1 69 LYS 69 158 158 LYS LYS A . n A 1 70 GLU 70 159 159 GLU GLU A . n A 1 71 THR 71 160 160 THR THR A . n A 1 72 ASP 72 161 161 ASP ASP A . n A 1 73 ILE 73 162 162 ILE ILE A . n A 1 74 LYS 74 163 163 LYS LYS A . n A 1 75 HIS 75 164 164 HIS HIS A . n A 1 76 LEU 76 165 165 LEU LEU A . n A 1 77 ARG 77 166 166 ARG ARG A . n A 1 78 LYS 78 167 167 LYS LYS A . n A 1 79 LEU 79 168 168 LEU LEU A . n A 1 80 LYS 80 169 169 LYS LYS A . n A 1 81 HIS 81 170 170 HIS HIS A . n A 1 82 PRO 82 171 171 PRO PRO A . n A 1 83 ASN 83 172 172 ASN ASN A . n A 1 84 ILE 84 173 173 ILE ILE A . n A 1 85 ILE 85 174 174 ILE ILE A . n A 1 86 THR 86 175 175 THR THR A . n A 1 87 PHE 87 176 176 PHE PHE A . n A 1 88 LYS 88 177 177 LYS LYS A . n A 1 89 GLY 89 178 178 GLY GLY A . n A 1 90 VAL 90 179 179 VAL VAL A . n A 1 91 CYS 91 180 180 CYS CYS A . n A 1 92 THR 92 181 181 THR THR A . n A 1 93 GLN 93 182 182 GLN GLN A . n A 1 94 ALA 94 183 183 ALA ALA A . n A 1 95 PRO 95 184 184 PRO PRO A . n A 1 96 CYS 96 185 185 CYS CYS A . n A 1 97 TYR 97 186 186 TYR TYR A . n A 1 98 CYS 98 187 187 CYS CYS A . n A 1 99 ILE 99 188 188 ILE ILE A . n A 1 100 LEU 100 189 189 LEU LEU A . n A 1 101 MET 101 190 190 MET MET A . n A 1 102 GLU 102 191 191 GLU GLU A . n A 1 103 PHE 103 192 192 PHE PHE A . n A 1 104 CYS 104 193 193 CYS CYS A . n A 1 105 ALA 105 194 194 ALA ALA A . n A 1 106 GLN 106 195 195 GLN GLN A . n A 1 107 GLY 107 196 196 GLY GLY A . n A 1 108 GLN 108 197 197 GLN GLN A . n A 1 109 LEU 109 198 198 LEU LEU A . n A 1 110 TYR 110 199 199 TYR TYR A . n A 1 111 GLU 111 200 200 GLU GLU A . n A 1 112 VAL 112 201 201 VAL VAL A . n A 1 113 LEU 113 202 202 LEU LEU A . n A 1 114 ARG 114 203 203 ARG ARG A . n A 1 115 ALA 115 204 204 ALA ALA A . n A 1 116 GLY 116 205 205 GLY GLY A . n A 1 117 ARG 117 206 206 ARG ARG A . n A 1 118 PRO 118 207 207 PRO PRO A . n A 1 119 VAL 119 208 208 VAL VAL A . n A 1 120 THR 120 209 209 THR THR A . n A 1 121 PRO 121 210 210 PRO PRO A . n A 1 122 SER 122 211 211 SER SER A . n A 1 123 LEU 123 212 212 LEU LEU A . n A 1 124 LEU 124 213 213 LEU LEU A . n A 1 125 VAL 125 214 214 VAL VAL A . n A 1 126 ASP 126 215 215 ASP ASP A . n A 1 127 TRP 127 216 216 TRP TRP A . n A 1 128 SER 128 217 217 SER SER A . n A 1 129 MET 129 218 218 MET MET A . n A 1 130 GLY 130 219 219 GLY GLY A . n A 1 131 ILE 131 220 220 ILE ILE A . n A 1 132 ALA 132 221 221 ALA ALA A . n A 1 133 GLY 133 222 222 GLY GLY A . n A 1 134 GLY 134 223 223 GLY GLY A . n A 1 135 MET 135 224 224 MET MET A . n A 1 136 ASN 136 225 225 ASN ASN A . n A 1 137 TYR 137 226 226 TYR TYR A . n A 1 138 LEU 138 227 227 LEU LEU A . n A 1 139 HIS 139 228 228 HIS HIS A . n A 1 140 LEU 140 229 229 LEU LEU A . n A 1 141 HIS 141 230 230 HIS HIS A . n A 1 142 LYS 142 231 231 LYS LYS A . n A 1 143 ILE 143 232 232 ILE ILE A . n A 1 144 ILE 144 233 233 ILE ILE A . n A 1 145 HIS 145 234 234 HIS HIS A . n A 1 146 ARG 146 235 235 ARG ARG A . n A 1 147 ASP 147 236 236 ASP ASP A . n A 1 148 LEU 148 237 237 LEU LEU A . n A 1 149 LYS 149 238 238 LYS LYS A . n A 1 150 SER 150 239 239 SER SER A . n A 1 151 PRO 151 240 240 PRO PRO A . n A 1 152 ASN 152 241 241 ASN ASN A . n A 1 153 MET 153 242 242 MET MET A . n A 1 154 LEU 154 243 243 LEU LEU A . n A 1 155 ILE 155 244 244 ILE ILE A . n A 1 156 THR 156 245 245 THR THR A . n A 1 157 TYR 157 246 246 TYR TYR A . n A 1 158 ASP 158 247 247 ASP ASP A . n A 1 159 ASP 159 248 248 ASP ASP A . n A 1 160 VAL 160 249 249 VAL VAL A . n A 1 161 VAL 161 250 250 VAL VAL A . n A 1 162 LYS 162 251 251 LYS LYS A . n A 1 163 ILE 163 252 252 ILE ILE A . n A 1 164 SER 164 253 253 SER SER A . n A 1 165 ASP 165 254 254 ASP ASP A . n A 1 166 PHE 166 255 255 PHE PHE A . n A 1 167 GLY 167 256 256 GLY GLY A . n A 1 168 THR 168 257 ? ? ? A . n A 1 169 SER 169 258 ? ? ? A . n A 1 170 LYS 170 259 ? ? ? A . n A 1 171 GLU 171 260 ? ? ? A . n A 1 172 LEU 172 261 ? ? ? A . n A 1 173 SER 173 262 ? ? ? A . n A 1 174 ASP 174 263 ? ? ? A . n A 1 175 LYS 175 264 ? ? ? A . n A 1 176 SER 176 265 ? ? ? A . n A 1 177 THR 177 266 ? ? ? A . n A 1 178 LYS 178 267 ? ? ? A . n A 1 179 MET 179 268 ? ? ? A . n A 1 180 SER 180 269 ? ? ? A . n A 1 181 PHE 181 270 ? ? ? A . n A 1 182 ALA 182 271 ? ? ? A . n A 1 183 GLY 183 272 272 GLY GLY A . n A 1 184 THR 184 273 273 THR THR A . n A 1 185 VAL 185 274 274 VAL VAL A . n A 1 186 ALA 186 275 275 ALA ALA A . n A 1 187 TRP 187 276 276 TRP TRP A . n A 1 188 MET 188 277 277 MET MET A . n A 1 189 ALA 189 278 278 ALA ALA A . n A 1 190 PRO 190 279 279 PRO PRO A . n A 1 191 GLU 191 280 280 GLU GLU A . n A 1 192 VAL 192 281 281 VAL VAL A . n A 1 193 ILE 193 282 282 ILE ILE A . n A 1 194 ARG 194 283 283 ARG ARG A . n A 1 195 ASN 195 284 284 ASN ASN A . n A 1 196 GLU 196 285 285 GLU GLU A . n A 1 197 PRO 197 286 286 PRO PRO A . n A 1 198 VAL 198 287 287 VAL VAL A . n A 1 199 SER 199 288 288 SER SER A . n A 1 200 GLU 200 289 289 GLU GLU A . n A 1 201 LYS 201 290 290 LYS LYS A . n A 1 202 VAL 202 291 291 VAL VAL A . n A 1 203 ASP 203 292 292 ASP ASP A . n A 1 204 ILE 204 293 293 ILE ILE A . n A 1 205 TRP 205 294 294 TRP TRP A . n A 1 206 SER 206 295 295 SER SER A . n A 1 207 PHE 207 296 296 PHE PHE A . n A 1 208 GLY 208 297 297 GLY GLY A . n A 1 209 VAL 209 298 298 VAL VAL A . n A 1 210 VAL 210 299 299 VAL VAL A . n A 1 211 LEU 211 300 300 LEU LEU A . n A 1 212 TRP 212 301 301 TRP TRP A . n A 1 213 GLU 213 302 302 GLU GLU A . n A 1 214 LEU 214 303 303 LEU LEU A . n A 1 215 LEU 215 304 304 LEU LEU A . n A 1 216 THR 216 305 305 THR THR A . n A 1 217 GLY 217 306 306 GLY GLY A . n A 1 218 GLU 218 307 307 GLU GLU A . n A 1 219 ILE 219 308 308 ILE ILE A . n A 1 220 PRO 220 309 309 PRO PRO A . n A 1 221 TYR 221 310 310 TYR TYR A . n A 1 222 LYS 222 311 311 LYS LYS A . n A 1 223 ASP 223 312 312 ASP ASP A . n A 1 224 VAL 224 313 313 VAL VAL A . n A 1 225 ASP 225 314 314 ASP ASP A . n A 1 226 SER 226 315 315 SER SER A . n A 1 227 SER 227 316 316 SER SER A . n A 1 228 ALA 228 317 317 ALA ALA A . n A 1 229 ILE 229 318 318 ILE ILE A . n A 1 230 ILE 230 319 319 ILE ILE A . n A 1 231 TRP 231 320 320 TRP TRP A . n A 1 232 GLY 232 321 321 GLY GLY A . n A 1 233 VAL 233 322 322 VAL VAL A . n A 1 234 GLY 234 323 323 GLY GLY A . n A 1 235 SER 235 324 324 SER SER A . n A 1 236 ASN 236 325 325 ASN ASN A . n A 1 237 SER 237 326 326 SER SER A . n A 1 238 LEU 238 327 327 LEU LEU A . n A 1 239 HIS 239 328 328 HIS HIS A . n A 1 240 LEU 240 329 329 LEU LEU A . n A 1 241 PRO 241 330 330 PRO PRO A . n A 1 242 VAL 242 331 331 VAL VAL A . n A 1 243 PRO 243 332 332 PRO PRO A . n A 1 244 SER 244 333 333 SER SER A . n A 1 245 SER 245 334 334 SER SER A . n A 1 246 CYS 246 335 335 CYS CYS A . n A 1 247 PRO 247 336 336 PRO PRO A . n A 1 248 ASP 248 337 337 ASP ASP A . n A 1 249 GLY 249 338 338 GLY GLY A . n A 1 250 PHE 250 339 339 PHE PHE A . n A 1 251 LYS 251 340 340 LYS LYS A . n A 1 252 ILE 252 341 341 ILE ILE A . n A 1 253 LEU 253 342 342 LEU LEU A . n A 1 254 LEU 254 343 343 LEU LEU A . n A 1 255 ARG 255 344 344 ARG ARG A . n A 1 256 GLN 256 345 345 GLN GLN A . n A 1 257 CYS 257 346 346 CYS CYS A . n A 1 258 TRP 258 347 347 TRP TRP A . n A 1 259 ASN 259 348 348 ASN ASN A . n A 1 260 SER 260 349 349 SER SER A . n A 1 261 LYS 261 350 350 LYS LYS A . n A 1 262 PRO 262 351 351 PRO PRO A . n A 1 263 ARG 263 352 352 ARG ARG A . n A 1 264 ASN 264 353 353 ASN ASN A . n A 1 265 ARG 265 354 354 ARG ARG A . n A 1 266 PRO 266 355 355 PRO PRO A . n A 1 267 SER 267 356 356 SER SER A . n A 1 268 PHE 268 357 357 PHE PHE A . n A 1 269 ARG 269 358 358 ARG ARG A . n A 1 270 GLN 270 359 359 GLN GLN A . n A 1 271 ILE 271 360 360 ILE ILE A . n A 1 272 LEU 272 361 361 LEU LEU A . n A 1 273 LEU 273 362 362 LEU LEU A . n A 1 274 HIS 274 363 363 HIS HIS A . n A 1 275 LEU 275 364 364 LEU LEU A . n A 1 276 ASP 276 365 365 ASP ASP A . n A 1 277 ILE 277 366 366 ILE ILE A . n A 1 278 ALA 278 367 367 ALA ALA A . n A 1 279 SER 279 368 368 SER SER A . n A 1 280 ALA 280 369 369 ALA ALA A . n A 1 281 ASP 281 370 370 ASP ASP A . n A 1 282 VAL 282 371 371 VAL VAL A . n A 1 283 LEU 283 372 372 LEU LEU A . n A 1 284 SER 284 373 373 SER SER A . n A 1 285 THR 285 374 374 THR THR A . n A 1 286 PRO 286 375 375 PRO PRO A . n A 1 287 GLN 287 376 376 GLN GLN A . n A 1 288 GLU 288 377 377 GLU GLU A . n A 1 289 THR 289 378 378 THR THR A . n A 1 290 TYR 290 379 379 TYR TYR A . n A 1 291 PHE 291 380 380 PHE PHE A . n A 1 292 LYS 292 381 381 LYS LYS A . n A 1 293 SER 293 382 382 SER SER A . n A 1 294 GLN 294 383 383 GLN GLN A . n A 1 295 ALA 295 384 384 ALA ALA A . n A 1 296 GLU 296 385 385 GLU GLU A . n A 1 297 TRP 297 386 386 TRP TRP A . n A 1 298 ARG 298 387 387 ARG ARG A . n A 1 299 GLU 299 388 388 GLU GLU A . n A 1 300 GLU 300 389 389 GLU GLU A . n A 1 301 VAL 301 390 390 VAL VAL A . n A 1 302 LYS 302 391 391 LYS LYS A . n A 1 303 LEU 303 392 392 LEU LEU A . n A 1 304 HIS 304 393 393 HIS HIS A . n A 1 305 PHE 305 394 394 PHE PHE A . n A 1 306 GLU 306 395 395 GLU GLU A . n A 1 307 LYS 307 396 396 LYS LYS A . n A 1 308 ILE 308 397 397 ILE ILE A . n A 1 309 LYS 309 398 398 LYS LYS A . n A 1 310 SER 310 399 ? ? ? A . n A 1 311 GLU 311 400 ? ? ? A . n A 1 312 GLY 312 401 ? ? ? A . n A 1 313 THR 313 402 ? ? ? A . n A 1 314 GLY 314 403 ? ? ? A . n A 1 315 ASN 315 404 ? ? ? A . n A 1 316 SER 316 405 ? ? ? A . n A 1 317 HIS 317 406 ? ? ? A . n A 1 318 HIS 318 407 ? ? ? A . n A 1 319 HIS 319 408 ? ? ? A . n A 1 320 HIS 320 409 ? ? ? A . n A 1 321 HIS 321 410 ? ? ? A . n A 1 322 HIS 322 411 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SIQ 1 501 1 SIQ LIG A . C 3 HOH 1 601 17 HOH HOH A . C 3 HOH 2 602 7 HOH HOH A . C 3 HOH 3 603 19 HOH HOH A . C 3 HOH 4 604 15 HOH HOH A . C 3 HOH 5 605 4 HOH HOH A . C 3 HOH 6 606 2 HOH HOH A . C 3 HOH 7 607 5 HOH HOH A . C 3 HOH 8 608 9 HOH HOH A . C 3 HOH 9 609 18 HOH HOH A . C 3 HOH 10 610 21 HOH HOH A . C 3 HOH 11 611 3 HOH HOH A . C 3 HOH 12 612 1 HOH HOH A . C 3 HOH 13 613 13 HOH HOH A . C 3 HOH 14 614 30 HOH HOH A . C 3 HOH 15 615 6 HOH HOH A . C 3 HOH 16 616 25 HOH HOH A . C 3 HOH 17 617 12 HOH HOH A . C 3 HOH 18 618 14 HOH HOH A . C 3 HOH 19 619 22 HOH HOH A . C 3 HOH 20 620 26 HOH HOH A . C 3 HOH 21 621 28 HOH HOH A . C 3 HOH 22 622 23 HOH HOH A . C 3 HOH 23 623 11 HOH HOH A . C 3 HOH 24 624 24 HOH HOH A . C 3 HOH 25 625 10 HOH HOH A . C 3 HOH 26 626 20 HOH HOH A . C 3 HOH 27 627 8 HOH HOH A . C 3 HOH 28 628 16 HOH HOH A . C 3 HOH 29 629 27 HOH HOH A . C 3 HOH 30 630 29 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 106.990 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8DEG _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.837 _cell.length_a_esd ? _cell.length_b 39.141 _cell.length_b_esd ? _cell.length_c 62.781 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8DEG _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8DEG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Magnesium Acetate, 0.1M HEPES pH 7.7, 18% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-04-25 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97853 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97853 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8DEG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.79 _reflns.d_resolution_low 30.43 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6597 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.1 _reflns.pdbx_Rmerge_I_obs 0.121 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.8 _reflns_shell.d_res_low 2.9 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 539 _reflns_shell.percent_possible_all 81.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.399 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.4600 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -1.2200 _refine.aniso_B[2][2] -2.0300 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] 1.9500 _refine.B_iso_max 102.670 _refine.B_iso_mean 50.2480 _refine.B_iso_min 22.480 _refine.correlation_coeff_Fo_to_Fc 0.9030 _refine.correlation_coeff_Fo_to_Fc_free 0.8430 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8DEG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7900 _refine.ls_d_res_low 30.4300 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6249 _refine.ls_number_reflns_R_free 336 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.6800 _refine.ls_percent_reflns_R_free 5.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2508 _refine.ls_R_factor_R_free 0.2966 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2484 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'Not public' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.5080 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 24.6150 _refine.overall_SU_ML 0.4400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.7900 _refine_hist.d_res_low 30.4300 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 2204 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 267 _refine_hist.pdbx_B_iso_mean_ligand 40.74 _refine_hist.pdbx_B_iso_mean_solvent 31.82 _refine_hist.pdbx_number_atoms_protein 2140 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 0.013 2236 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2097 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.225 1.656 3040 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.028 1.591 4871 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.337 5.000 265 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.943 22.243 107 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.967 15.000 383 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.963 15.000 12 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.036 0.200 281 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 2427 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 464 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.7920 _refine_ls_shell.d_res_low 2.8640 _refine_ls_shell.number_reflns_all 358 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 20 _refine_ls_shell.number_reflns_R_work 338 _refine_ls_shell.percent_reflns_obs 71.7400 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3380 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3770 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 8DEG _struct.title 'Crystal structure of DLK in complex with inhibitor DN0011197' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8DEG _struct_keywords.text 'DLK, kinase, inhibitor, SIGNALING PROTEIN, TRANSFERASE-INHIBITOR complex' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN,TRANSFERASE/INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code M3K12_HUMAN _struct_ref.pdbx_db_accession Q12852 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EDLWEVPFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCA QGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTKMSFAGTV AWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSKPRNR PSFRQILLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIKSEGT ; _struct_ref.pdbx_align_begin 115 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8DEG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 26 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 313 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q12852 _struct_ref_seq.db_align_beg 115 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 402 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 115 _struct_ref_seq.pdbx_auth_seq_align_end 402 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8DEG ILE A 1 ? UNP Q12852 ? ? 'expression tag' 90 1 1 8DEG PHE A 2 ? UNP Q12852 ? ? 'expression tag' 91 2 1 8DEG ARG A 3 ? UNP Q12852 ? ? 'expression tag' 92 3 1 8DEG ILE A 4 ? UNP Q12852 ? ? 'expression tag' 93 4 1 8DEG ILE A 5 ? UNP Q12852 ? ? 'expression tag' 94 5 1 8DEG HIS A 6 ? UNP Q12852 ? ? 'expression tag' 95 6 1 8DEG THR A 7 ? UNP Q12852 ? ? 'expression tag' 96 7 1 8DEG VAL A 8 ? UNP Q12852 ? ? 'expression tag' 97 8 1 8DEG PRO A 9 ? UNP Q12852 ? ? 'expression tag' 98 9 1 8DEG PRO A 10 ? UNP Q12852 ? ? 'expression tag' 99 10 1 8DEG SER A 11 ? UNP Q12852 ? ? 'expression tag' 100 11 1 8DEG GLY A 12 ? UNP Q12852 ? ? 'expression tag' 101 12 1 8DEG ALA A 13 ? UNP Q12852 ? ? 'expression tag' 102 13 1 8DEG ASP A 14 ? UNP Q12852 ? ? 'expression tag' 103 14 1 8DEG PRO A 15 ? UNP Q12852 ? ? 'expression tag' 104 15 1 8DEG GLY A 16 ? UNP Q12852 ? ? 'expression tag' 105 16 1 8DEG PRO A 17 ? UNP Q12852 ? ? 'expression tag' 106 17 1 8DEG LYS A 18 ? UNP Q12852 ? ? 'expression tag' 107 18 1 8DEG ARG A 19 ? UNP Q12852 ? ? 'expression tag' 108 19 1 8DEG ALA A 20 ? UNP Q12852 ? ? 'expression tag' 109 20 1 8DEG GLU A 21 ? UNP Q12852 ? ? 'expression tag' 110 21 1 8DEG PHE A 22 ? UNP Q12852 ? ? 'expression tag' 111 22 1 8DEG MET A 23 ? UNP Q12852 ? ? 'expression tag' 112 23 1 8DEG GLY A 24 ? UNP Q12852 ? ? 'expression tag' 113 24 1 8DEG SER A 25 ? UNP Q12852 ? ? 'expression tag' 114 25 1 8DEG GLY A 314 ? UNP Q12852 ? ? 'expression tag' 403 26 1 8DEG ASN A 315 ? UNP Q12852 ? ? 'expression tag' 404 27 1 8DEG SER A 316 ? UNP Q12852 ? ? 'expression tag' 405 28 1 8DEG HIS A 317 ? UNP Q12852 ? ? 'expression tag' 406 29 1 8DEG HIS A 318 ? UNP Q12852 ? ? 'expression tag' 407 30 1 8DEG HIS A 319 ? UNP Q12852 ? ? 'expression tag' 408 31 1 8DEG HIS A 320 ? UNP Q12852 ? ? 'expression tag' 409 32 1 8DEG HIS A 321 ? UNP Q12852 ? ? 'expression tag' 410 33 1 8DEG HIS A 322 ? UNP Q12852 ? ? 'expression tag' 411 34 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 32 ? ILE A 36 ? PRO A 121 ILE A 125 5 ? 5 HELX_P HELX_P2 AA2 ASP A 67 ? ASP A 72 ? ASP A 156 ASP A 161 5 ? 6 HELX_P HELX_P3 AA3 ILE A 73 ? ARG A 77 ? ILE A 162 ARG A 166 5 ? 5 HELX_P HELX_P4 AA4 LEU A 109 ? ALA A 115 ? LEU A 198 ALA A 204 1 ? 7 HELX_P HELX_P5 AA5 THR A 120 ? HIS A 141 ? THR A 209 HIS A 230 1 ? 22 HELX_P HELX_P6 AA6 LYS A 149 ? PRO A 151 ? LYS A 238 PRO A 240 5 ? 3 HELX_P HELX_P7 AA7 ALA A 189 ? ARG A 194 ? ALA A 278 ARG A 283 1 ? 6 HELX_P HELX_P8 AA8 LYS A 201 ? GLY A 217 ? LYS A 290 GLY A 306 1 ? 17 HELX_P HELX_P9 AA9 ASP A 225 ? SER A 235 ? ASP A 314 SER A 324 1 ? 11 HELX_P HELX_P10 AB1 PRO A 247 ? TRP A 258 ? PRO A 336 TRP A 347 1 ? 12 HELX_P HELX_P11 AB2 LYS A 261 ? ARG A 265 ? LYS A 350 ARG A 354 5 ? 5 HELX_P HELX_P12 AB3 SER A 267 ? SER A 284 ? SER A 356 SER A 373 1 ? 18 HELX_P HELX_P13 AB4 PRO A 286 ? LYS A 309 ? PRO A 375 LYS A 398 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 94 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 183 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 95 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 184 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.96 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 37 ? GLY A 45 ? LEU A 126 GLY A 134 AA1 2 GLY A 48 ? PHE A 55 ? GLY A 137 PHE A 144 AA1 3 GLU A 58 ? LYS A 64 ? GLU A 147 LYS A 153 AA1 4 CYS A 98 ? GLU A 102 ? CYS A 187 GLU A 191 AA1 5 PHE A 87 ? CYS A 91 ? PHE A 176 CYS A 180 AA2 1 GLY A 107 ? GLN A 108 ? GLY A 196 GLN A 197 AA2 2 MET A 153 ? ILE A 155 ? MET A 242 ILE A 244 AA2 3 VAL A 161 ? ILE A 163 ? VAL A 250 ILE A 252 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 45 ? N GLY A 134 O GLY A 48 ? O GLY A 137 AA1 2 3 N PHE A 51 ? N PHE A 140 O VAL A 62 ? O VAL A 151 AA1 3 4 N LYS A 63 ? N LYS A 152 O ILE A 99 ? O ILE A 188 AA1 4 5 O LEU A 100 ? O LEU A 189 N GLY A 89 ? N GLY A 178 AA2 1 2 N GLY A 107 ? N GLY A 196 O ILE A 155 ? O ILE A 244 AA2 2 3 N LEU A 154 ? N LEU A 243 O LYS A 162 ? O LYS A 251 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 185 ? ? -100.23 51.12 2 1 ARG A 235 ? ? 83.92 -34.80 # _pdbx_entry_details.entry_id 8DEG _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 90 ? A ILE 1 2 1 Y 1 A PHE 91 ? A PHE 2 3 1 Y 1 A ARG 92 ? A ARG 3 4 1 Y 1 A ILE 93 ? A ILE 4 5 1 Y 1 A ILE 94 ? A ILE 5 6 1 Y 1 A HIS 95 ? A HIS 6 7 1 Y 1 A THR 96 ? A THR 7 8 1 Y 1 A VAL 97 ? A VAL 8 9 1 Y 1 A PRO 98 ? A PRO 9 10 1 Y 1 A PRO 99 ? A PRO 10 11 1 Y 1 A SER 100 ? A SER 11 12 1 Y 1 A GLY 101 ? A GLY 12 13 1 Y 1 A ALA 102 ? A ALA 13 14 1 Y 1 A ASP 103 ? A ASP 14 15 1 Y 1 A PRO 104 ? A PRO 15 16 1 Y 1 A GLY 105 ? A GLY 16 17 1 Y 1 A PRO 106 ? A PRO 17 18 1 Y 1 A LYS 107 ? A LYS 18 19 1 Y 1 A ARG 108 ? A ARG 19 20 1 Y 1 A ALA 109 ? A ALA 20 21 1 Y 1 A GLU 110 ? A GLU 21 22 1 Y 1 A PHE 111 ? A PHE 22 23 1 Y 1 A MET 112 ? A MET 23 24 1 Y 1 A GLY 113 ? A GLY 24 25 1 Y 1 A SER 114 ? A SER 25 26 1 Y 1 A GLU 115 ? A GLU 26 27 1 Y 1 A ASP 116 ? A ASP 27 28 1 Y 1 A THR 257 ? A THR 168 29 1 Y 1 A SER 258 ? A SER 169 30 1 Y 1 A LYS 259 ? A LYS 170 31 1 Y 1 A GLU 260 ? A GLU 171 32 1 Y 1 A LEU 261 ? A LEU 172 33 1 Y 1 A SER 262 ? A SER 173 34 1 Y 1 A ASP 263 ? A ASP 174 35 1 Y 1 A LYS 264 ? A LYS 175 36 1 Y 1 A SER 265 ? A SER 176 37 1 Y 1 A THR 266 ? A THR 177 38 1 Y 1 A LYS 267 ? A LYS 178 39 1 Y 1 A MET 268 ? A MET 179 40 1 Y 1 A SER 269 ? A SER 180 41 1 Y 1 A PHE 270 ? A PHE 181 42 1 Y 1 A ALA 271 ? A ALA 182 43 1 Y 1 A SER 399 ? A SER 310 44 1 Y 1 A GLU 400 ? A GLU 311 45 1 Y 1 A GLY 401 ? A GLY 312 46 1 Y 1 A THR 402 ? A THR 313 47 1 Y 1 A GLY 403 ? A GLY 314 48 1 Y 1 A ASN 404 ? A ASN 315 49 1 Y 1 A SER 405 ? A SER 316 50 1 Y 1 A HIS 406 ? A HIS 317 51 1 Y 1 A HIS 407 ? A HIS 318 52 1 Y 1 A HIS 408 ? A HIS 319 53 1 Y 1 A HIS 409 ? A HIS 320 54 1 Y 1 A HIS 410 ? A HIS 321 55 1 Y 1 A HIS 411 ? A HIS 322 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SIQ C4 C Y N 304 SIQ C5 C Y N 305 SIQ C8 C N N 306 SIQ C10 C N N 307 SIQ C13 C Y N 308 SIQ C15 C Y N 309 SIQ C21 C N N 310 SIQ C26 C N S 311 SIQ C28 C N N 312 SIQ C1 C Y N 313 SIQ C2 C Y N 314 SIQ C3 C Y N 315 SIQ N6 N Y N 316 SIQ N7 N N N 317 SIQ C9 C N N 318 SIQ C11 C N N 319 SIQ C12 C N N 320 SIQ N14 N Y N 321 SIQ C16 C Y N 322 SIQ N17 N Y N 323 SIQ C18 C Y N 324 SIQ N19 N N N 325 SIQ O20 O N N 326 SIQ F22 F N N 327 SIQ F23 F N N 328 SIQ N24 N N N 329 SIQ C25 C N N 330 SIQ N27 N N N 331 SIQ C29 C N S 332 SIQ C30 C N N 333 SIQ C31 C N N 334 SIQ O32 O N N 335 SIQ O33 O N N 336 SIQ C34 C N N 337 SIQ H1 H N N 338 SIQ H2 H N N 339 SIQ H3 H N N 340 SIQ H4 H N N 341 SIQ H5 H N N 342 SIQ H6 H N N 343 SIQ H7 H N N 344 SIQ H8 H N N 345 SIQ H9 H N N 346 SIQ H10 H N N 347 SIQ H11 H N N 348 SIQ H12 H N N 349 SIQ H13 H N N 350 SIQ H14 H N N 351 SIQ H15 H N N 352 SIQ H16 H N N 353 SIQ H17 H N N 354 SIQ H18 H N N 355 SIQ H19 H N N 356 SIQ H20 H N N 357 SIQ H21 H N N 358 SIQ H22 H N N 359 SIQ H23 H N N 360 SIQ H24 H N N 361 SIQ H25 H N N 362 THR N N N N 363 THR CA C N S 364 THR C C N N 365 THR O O N N 366 THR CB C N R 367 THR OG1 O N N 368 THR CG2 C N N 369 THR OXT O N N 370 THR H H N N 371 THR H2 H N N 372 THR HA H N N 373 THR HB H N N 374 THR HG1 H N N 375 THR HG21 H N N 376 THR HG22 H N N 377 THR HG23 H N N 378 THR HXT H N N 379 TRP N N N N 380 TRP CA C N S 381 TRP C C N N 382 TRP O O N N 383 TRP CB C N N 384 TRP CG C Y N 385 TRP CD1 C Y N 386 TRP CD2 C Y N 387 TRP NE1 N Y N 388 TRP CE2 C Y N 389 TRP CE3 C Y N 390 TRP CZ2 C Y N 391 TRP CZ3 C Y N 392 TRP CH2 C Y N 393 TRP OXT O N N 394 TRP H H N N 395 TRP H2 H N N 396 TRP HA H N N 397 TRP HB2 H N N 398 TRP HB3 H N N 399 TRP HD1 H N N 400 TRP HE1 H N N 401 TRP HE3 H N N 402 TRP HZ2 H N N 403 TRP HZ3 H N N 404 TRP HH2 H N N 405 TRP HXT H N N 406 TYR N N N N 407 TYR CA C N S 408 TYR C C N N 409 TYR O O N N 410 TYR CB C N N 411 TYR CG C Y N 412 TYR CD1 C Y N 413 TYR CD2 C Y N 414 TYR CE1 C Y N 415 TYR CE2 C Y N 416 TYR CZ C Y N 417 TYR OH O N N 418 TYR OXT O N N 419 TYR H H N N 420 TYR H2 H N N 421 TYR HA H N N 422 TYR HB2 H N N 423 TYR HB3 H N N 424 TYR HD1 H N N 425 TYR HD2 H N N 426 TYR HE1 H N N 427 TYR HE2 H N N 428 TYR HH H N N 429 TYR HXT H N N 430 VAL N N N N 431 VAL CA C N S 432 VAL C C N N 433 VAL O O N N 434 VAL CB C N N 435 VAL CG1 C N N 436 VAL CG2 C N N 437 VAL OXT O N N 438 VAL H H N N 439 VAL H2 H N N 440 VAL HA H N N 441 VAL HB H N N 442 VAL HG11 H N N 443 VAL HG12 H N N 444 VAL HG13 H N N 445 VAL HG21 H N N 446 VAL HG22 H N N 447 VAL HG23 H N N 448 VAL HXT H N N 449 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SIQ C30 C26 sing N N 290 SIQ C30 C29 sing N N 291 SIQ C25 C26 sing N N 292 SIQ C25 N24 sing N N 293 SIQ C26 N27 sing N N 294 SIQ N24 C29 sing N N 295 SIQ N24 C5 sing N N 296 SIQ C12 C8 sing N N 297 SIQ C12 C10 sing N N 298 SIQ N6 C5 doub Y N 299 SIQ N6 C1 sing Y N 300 SIQ C8 N7 sing N N 301 SIQ C8 C9 sing N N 302 SIQ C29 C28 sing N N 303 SIQ C5 C4 sing Y N 304 SIQ N7 C1 sing N N 305 SIQ N7 C11 sing N N 306 SIQ C1 C2 doub Y N 307 SIQ C4 C3 doub Y N 308 SIQ N27 C28 sing N N 309 SIQ N27 C31 sing N N 310 SIQ C2 C3 sing Y N 311 SIQ O32 C31 doub N N 312 SIQ C10 C9 sing N N 313 SIQ C10 C11 sing N N 314 SIQ C3 C13 sing N N 315 SIQ C31 O33 sing N N 316 SIQ C13 C18 doub Y N 317 SIQ C13 N14 sing Y N 318 SIQ C18 N17 sing Y N 319 SIQ N14 C15 doub Y N 320 SIQ N17 C16 doub Y N 321 SIQ C15 C16 sing Y N 322 SIQ C15 O20 sing N N 323 SIQ O33 C34 sing N N 324 SIQ C16 N19 sing N N 325 SIQ O20 C21 sing N N 326 SIQ F22 C21 sing N N 327 SIQ C21 F23 sing N N 328 SIQ C4 H1 sing N N 329 SIQ C8 H2 sing N N 330 SIQ C10 H3 sing N N 331 SIQ C21 H4 sing N N 332 SIQ C26 H5 sing N N 333 SIQ C28 H6 sing N N 334 SIQ C28 H7 sing N N 335 SIQ C2 H8 sing N N 336 SIQ C9 H9 sing N N 337 SIQ C9 H10 sing N N 338 SIQ C11 H11 sing N N 339 SIQ C11 H12 sing N N 340 SIQ C12 H13 sing N N 341 SIQ C12 H14 sing N N 342 SIQ C18 H15 sing N N 343 SIQ N19 H16 sing N N 344 SIQ N19 H17 sing N N 345 SIQ C25 H18 sing N N 346 SIQ C25 H19 sing N N 347 SIQ C29 H20 sing N N 348 SIQ C30 H21 sing N N 349 SIQ C30 H22 sing N N 350 SIQ C34 H23 sing N N 351 SIQ C34 H24 sing N N 352 SIQ C34 H25 sing N N 353 THR N CA sing N N 354 THR N H sing N N 355 THR N H2 sing N N 356 THR CA C sing N N 357 THR CA CB sing N N 358 THR CA HA sing N N 359 THR C O doub N N 360 THR C OXT sing N N 361 THR CB OG1 sing N N 362 THR CB CG2 sing N N 363 THR CB HB sing N N 364 THR OG1 HG1 sing N N 365 THR CG2 HG21 sing N N 366 THR CG2 HG22 sing N N 367 THR CG2 HG23 sing N N 368 THR OXT HXT sing N N 369 TRP N CA sing N N 370 TRP N H sing N N 371 TRP N H2 sing N N 372 TRP CA C sing N N 373 TRP CA CB sing N N 374 TRP CA HA sing N N 375 TRP C O doub N N 376 TRP C OXT sing N N 377 TRP CB CG sing N N 378 TRP CB HB2 sing N N 379 TRP CB HB3 sing N N 380 TRP CG CD1 doub Y N 381 TRP CG CD2 sing Y N 382 TRP CD1 NE1 sing Y N 383 TRP CD1 HD1 sing N N 384 TRP CD2 CE2 doub Y N 385 TRP CD2 CE3 sing Y N 386 TRP NE1 CE2 sing Y N 387 TRP NE1 HE1 sing N N 388 TRP CE2 CZ2 sing Y N 389 TRP CE3 CZ3 doub Y N 390 TRP CE3 HE3 sing N N 391 TRP CZ2 CH2 doub Y N 392 TRP CZ2 HZ2 sing N N 393 TRP CZ3 CH2 sing Y N 394 TRP CZ3 HZ3 sing N N 395 TRP CH2 HH2 sing N N 396 TRP OXT HXT sing N N 397 TYR N CA sing N N 398 TYR N H sing N N 399 TYR N H2 sing N N 400 TYR CA C sing N N 401 TYR CA CB sing N N 402 TYR CA HA sing N N 403 TYR C O doub N N 404 TYR C OXT sing N N 405 TYR CB CG sing N N 406 TYR CB HB2 sing N N 407 TYR CB HB3 sing N N 408 TYR CG CD1 doub Y N 409 TYR CG CD2 sing Y N 410 TYR CD1 CE1 sing Y N 411 TYR CD1 HD1 sing N N 412 TYR CD2 CE2 doub Y N 413 TYR CD2 HD2 sing N N 414 TYR CE1 CZ doub Y N 415 TYR CE1 HE1 sing N N 416 TYR CE2 CZ sing Y N 417 TYR CE2 HE2 sing N N 418 TYR CZ OH sing N N 419 TYR OH HH sing N N 420 TYR OXT HXT sing N N 421 VAL N CA sing N N 422 VAL N H sing N N 423 VAL N H2 sing N N 424 VAL CA C sing N N 425 VAL CA CB sing N N 426 VAL CA HA sing N N 427 VAL C O doub N N 428 VAL C OXT sing N N 429 VAL CB CG1 sing N N 430 VAL CB CG2 sing N N 431 VAL CB HB sing N N 432 VAL CG1 HG11 sing N N 433 VAL CG1 HG12 sing N N 434 VAL CG1 HG13 sing N N 435 VAL CG2 HG21 sing N N 436 VAL CG2 HG22 sing N N 437 VAL CG2 HG23 sing N N 438 VAL OXT HXT sing N N 439 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id SIQ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id SIQ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details 'Not public' # _atom_sites.entry_id 8DEG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017290 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005283 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025549 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016655 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F N O S # loop_