data_8DFK # _entry.id 8DFK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.364 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8DFK pdb_00008dfk 10.2210/pdb8dfk/pdb WWPDB D_1000266525 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8DFK _pdbx_database_status.recvd_initial_deposition_date 2022-06-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ahmed, I.' 1 0000-0001-8816-1375 'Khaja, F.T.' 2 0000-0001-6835-6474 'Neiditch, M.B.' 3 0000-0002-7039-4469 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 7724 _citation.page_last 7724 _citation.title 'Structure-function studies reveal ComEA contains an oligomerization domain essential for transformation in gram-positive bacteria.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-022-35129-0 _citation.pdbx_database_id_PubMed 36513643 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ahmed, I.' 1 ? primary 'Hahn, J.' 2 ? primary 'Henrickson, A.' 3 0000-0003-3266-5202 primary 'Khaja, F.T.' 4 ? primary 'Demeler, B.' 5 0000-0002-2414-9518 primary 'Dubnau, D.' 6 0000-0001-9713-6120 primary 'Neiditch, M.B.' 7 0000-0002-7039-4469 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8DFK _cell.details ? _cell.formula_units_Z ? _cell.length_a 114.525 _cell.length_a_esd ? _cell.length_b 116.482 _cell.length_b_esd ? _cell.length_c 183.268 _cell.length_c_esd ? _cell.volume 2444813.639 _cell.volume_esd ? _cell.Z_PDB 56 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8DFK _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall 'I 2 2' _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ComE operon protein 1' _entity.formula_weight 16737.549 _entity.pdbx_number_of_molecules 7 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSNETIVIDIKGAVQHPGVYEMRTGDRVSQAIEKAGGTSEQADEAQVNLAEILQDGTVVYIPKKGEETAVQQGGGGSVQS DGGKGALVNINTATLEELQGISGVGPSKAEAIIAYREENGRFQTIEDITKVSGIGEKSFEKIKSSITVKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSNETIVIDIKGAVQHPGVYEMRTGDRVSQAIEKAGGTSEQADEAQVNLAEILQDGTVVYIPKKGEETAVQQGGGGSVQS DGGKGALVNINTATLEELQGISGVGPSKAEAIIAYREENGRFQTIEDITKVSGIGEKSFEKIKSSITVKLEHHHHHH ; _entity_poly.pdbx_strand_id A,B,C,D,E,F,G _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASN n 1 4 GLU n 1 5 THR n 1 6 ILE n 1 7 VAL n 1 8 ILE n 1 9 ASP n 1 10 ILE n 1 11 LYS n 1 12 GLY n 1 13 ALA n 1 14 VAL n 1 15 GLN n 1 16 HIS n 1 17 PRO n 1 18 GLY n 1 19 VAL n 1 20 TYR n 1 21 GLU n 1 22 MET n 1 23 ARG n 1 24 THR n 1 25 GLY n 1 26 ASP n 1 27 ARG n 1 28 VAL n 1 29 SER n 1 30 GLN n 1 31 ALA n 1 32 ILE n 1 33 GLU n 1 34 LYS n 1 35 ALA n 1 36 GLY n 1 37 GLY n 1 38 THR n 1 39 SER n 1 40 GLU n 1 41 GLN n 1 42 ALA n 1 43 ASP n 1 44 GLU n 1 45 ALA n 1 46 GLN n 1 47 VAL n 1 48 ASN n 1 49 LEU n 1 50 ALA n 1 51 GLU n 1 52 ILE n 1 53 LEU n 1 54 GLN n 1 55 ASP n 1 56 GLY n 1 57 THR n 1 58 VAL n 1 59 VAL n 1 60 TYR n 1 61 ILE n 1 62 PRO n 1 63 LYS n 1 64 LYS n 1 65 GLY n 1 66 GLU n 1 67 GLU n 1 68 THR n 1 69 ALA n 1 70 VAL n 1 71 GLN n 1 72 GLN n 1 73 GLY n 1 74 GLY n 1 75 GLY n 1 76 GLY n 1 77 SER n 1 78 VAL n 1 79 GLN n 1 80 SER n 1 81 ASP n 1 82 GLY n 1 83 GLY n 1 84 LYS n 1 85 GLY n 1 86 ALA n 1 87 LEU n 1 88 VAL n 1 89 ASN n 1 90 ILE n 1 91 ASN n 1 92 THR n 1 93 ALA n 1 94 THR n 1 95 LEU n 1 96 GLU n 1 97 GLU n 1 98 LEU n 1 99 GLN n 1 100 GLY n 1 101 ILE n 1 102 SER n 1 103 GLY n 1 104 VAL n 1 105 GLY n 1 106 PRO n 1 107 SER n 1 108 LYS n 1 109 ALA n 1 110 GLU n 1 111 ALA n 1 112 ILE n 1 113 ILE n 1 114 ALA n 1 115 TYR n 1 116 ARG n 1 117 GLU n 1 118 GLU n 1 119 ASN n 1 120 GLY n 1 121 ARG n 1 122 PHE n 1 123 GLN n 1 124 THR n 1 125 ILE n 1 126 GLU n 1 127 ASP n 1 128 ILE n 1 129 THR n 1 130 LYS n 1 131 VAL n 1 132 SER n 1 133 GLY n 1 134 ILE n 1 135 GLY n 1 136 GLU n 1 137 LYS n 1 138 SER n 1 139 PHE n 1 140 GLU n 1 141 LYS n 1 142 ILE n 1 143 LYS n 1 144 SER n 1 145 SER n 1 146 ILE n 1 147 THR n 1 148 VAL n 1 149 LYS n 1 150 LEU n 1 151 GLU n 1 152 HIS n 1 153 HIS n 1 154 HIS n 1 155 HIS n 1 156 HIS n 1 157 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 157 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'comEA, comE1, BSU25590' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 168 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis subsp. subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224308 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code COMEA_BACSU _struct_ref.pdbx_db_accession P39694 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SNETIVIDIKGAVQHPGVYEMRTGDRVSQAIEKAGGTSEQADEAQVNLAEILQDGTVVYIPKKGEETAVQQGGGGSVQSD GGKGALVNINTATLEELQGISGVGPSKAEAIIAYREENGRFQTIEDITKVSGIGEKSFEKIKSSITVK ; _struct_ref.pdbx_align_begin 58 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8DFK A 2 ? 149 ? P39694 58 ? 205 ? 58 205 2 1 8DFK B 2 ? 149 ? P39694 58 ? 205 ? 58 205 3 1 8DFK C 2 ? 149 ? P39694 58 ? 205 ? 58 205 4 1 8DFK D 2 ? 149 ? P39694 58 ? 205 ? 58 205 5 1 8DFK E 2 ? 149 ? P39694 58 ? 205 ? 58 205 6 1 8DFK F 2 ? 149 ? P39694 58 ? 205 ? 58 205 7 1 8DFK G 2 ? 149 ? P39694 58 ? 205 ? 58 205 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8DFK MET A 1 ? UNP P39694 ? ? 'initiating methionine' 57 1 1 8DFK LEU A 150 ? UNP P39694 ? ? 'expression tag' 206 2 1 8DFK GLU A 151 ? UNP P39694 ? ? 'expression tag' 207 3 1 8DFK HIS A 152 ? UNP P39694 ? ? 'expression tag' 208 4 1 8DFK HIS A 153 ? UNP P39694 ? ? 'expression tag' 209 5 1 8DFK HIS A 154 ? UNP P39694 ? ? 'expression tag' 210 6 1 8DFK HIS A 155 ? UNP P39694 ? ? 'expression tag' 211 7 1 8DFK HIS A 156 ? UNP P39694 ? ? 'expression tag' 212 8 1 8DFK HIS A 157 ? UNP P39694 ? ? 'expression tag' 213 9 2 8DFK MET B 1 ? UNP P39694 ? ? 'initiating methionine' 57 10 2 8DFK LEU B 150 ? UNP P39694 ? ? 'expression tag' 206 11 2 8DFK GLU B 151 ? UNP P39694 ? ? 'expression tag' 207 12 2 8DFK HIS B 152 ? UNP P39694 ? ? 'expression tag' 208 13 2 8DFK HIS B 153 ? UNP P39694 ? ? 'expression tag' 209 14 2 8DFK HIS B 154 ? UNP P39694 ? ? 'expression tag' 210 15 2 8DFK HIS B 155 ? UNP P39694 ? ? 'expression tag' 211 16 2 8DFK HIS B 156 ? UNP P39694 ? ? 'expression tag' 212 17 2 8DFK HIS B 157 ? UNP P39694 ? ? 'expression tag' 213 18 3 8DFK MET C 1 ? UNP P39694 ? ? 'initiating methionine' 57 19 3 8DFK LEU C 150 ? UNP P39694 ? ? 'expression tag' 206 20 3 8DFK GLU C 151 ? UNP P39694 ? ? 'expression tag' 207 21 3 8DFK HIS C 152 ? UNP P39694 ? ? 'expression tag' 208 22 3 8DFK HIS C 153 ? UNP P39694 ? ? 'expression tag' 209 23 3 8DFK HIS C 154 ? UNP P39694 ? ? 'expression tag' 210 24 3 8DFK HIS C 155 ? UNP P39694 ? ? 'expression tag' 211 25 3 8DFK HIS C 156 ? UNP P39694 ? ? 'expression tag' 212 26 3 8DFK HIS C 157 ? UNP P39694 ? ? 'expression tag' 213 27 4 8DFK MET D 1 ? UNP P39694 ? ? 'initiating methionine' 57 28 4 8DFK LEU D 150 ? UNP P39694 ? ? 'expression tag' 206 29 4 8DFK GLU D 151 ? UNP P39694 ? ? 'expression tag' 207 30 4 8DFK HIS D 152 ? UNP P39694 ? ? 'expression tag' 208 31 4 8DFK HIS D 153 ? UNP P39694 ? ? 'expression tag' 209 32 4 8DFK HIS D 154 ? UNP P39694 ? ? 'expression tag' 210 33 4 8DFK HIS D 155 ? UNP P39694 ? ? 'expression tag' 211 34 4 8DFK HIS D 156 ? UNP P39694 ? ? 'expression tag' 212 35 4 8DFK HIS D 157 ? UNP P39694 ? ? 'expression tag' 213 36 5 8DFK MET E 1 ? UNP P39694 ? ? 'initiating methionine' 57 37 5 8DFK LEU E 150 ? UNP P39694 ? ? 'expression tag' 206 38 5 8DFK GLU E 151 ? UNP P39694 ? ? 'expression tag' 207 39 5 8DFK HIS E 152 ? UNP P39694 ? ? 'expression tag' 208 40 5 8DFK HIS E 153 ? UNP P39694 ? ? 'expression tag' 209 41 5 8DFK HIS E 154 ? UNP P39694 ? ? 'expression tag' 210 42 5 8DFK HIS E 155 ? UNP P39694 ? ? 'expression tag' 211 43 5 8DFK HIS E 156 ? UNP P39694 ? ? 'expression tag' 212 44 5 8DFK HIS E 157 ? UNP P39694 ? ? 'expression tag' 213 45 6 8DFK MET F 1 ? UNP P39694 ? ? 'initiating methionine' 57 46 6 8DFK LEU F 150 ? UNP P39694 ? ? 'expression tag' 206 47 6 8DFK GLU F 151 ? UNP P39694 ? ? 'expression tag' 207 48 6 8DFK HIS F 152 ? UNP P39694 ? ? 'expression tag' 208 49 6 8DFK HIS F 153 ? UNP P39694 ? ? 'expression tag' 209 50 6 8DFK HIS F 154 ? UNP P39694 ? ? 'expression tag' 210 51 6 8DFK HIS F 155 ? UNP P39694 ? ? 'expression tag' 211 52 6 8DFK HIS F 156 ? UNP P39694 ? ? 'expression tag' 212 53 6 8DFK HIS F 157 ? UNP P39694 ? ? 'expression tag' 213 54 7 8DFK MET G 1 ? UNP P39694 ? ? 'initiating methionine' 57 55 7 8DFK LEU G 150 ? UNP P39694 ? ? 'expression tag' 206 56 7 8DFK GLU G 151 ? UNP P39694 ? ? 'expression tag' 207 57 7 8DFK HIS G 152 ? UNP P39694 ? ? 'expression tag' 208 58 7 8DFK HIS G 153 ? UNP P39694 ? ? 'expression tag' 209 59 7 8DFK HIS G 154 ? UNP P39694 ? ? 'expression tag' 210 60 7 8DFK HIS G 155 ? UNP P39694 ? ? 'expression tag' 211 61 7 8DFK HIS G 156 ? UNP P39694 ? ? 'expression tag' 212 62 7 8DFK HIS G 157 ? UNP P39694 ? ? 'expression tag' 213 63 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8DFK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.61 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.84 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '22% PEG 500, 0.1 M succinate [pH 5.5]' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-11-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97946 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97946 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8DFK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.20 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20483 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.15 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 3.20 _reflns_shell.d_res_low 3.26 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1011 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.516 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8DFK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.20 _refine.ls_d_res_low 36.01 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20441 _refine.ls_number_reflns_R_free 1991 _refine.ls_number_reflns_R_work 18450 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.09 _refine.ls_percent_reflns_R_free 9.74 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2562 _refine.ls_R_factor_R_free 0.2760 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2541 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.3393 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4627 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.20 _refine_hist.d_res_low 36.01 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3359 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3359 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0028 ? 3387 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5462 ? 4574 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0494 ? 531 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0027 ? 614 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 5.2520 ? 468 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' d_2 ? ? 0.492554452788 ? ? 1 'Torsion NCS' ? A ? ? ? ens_1 'X-RAY DIFFRACTION' d_3 ? ? 0.606967528423 ? ? 2 'Torsion NCS' ? A ? ? ? ens_1 'X-RAY DIFFRACTION' d_4 ? ? 0.57253854064 ? ? 3 'Torsion NCS' ? A ? ? ? ens_1 'X-RAY DIFFRACTION' d_5 ? ? 0.552527696953 ? ? 4 'Torsion NCS' ? A ? ? ? ens_1 'X-RAY DIFFRACTION' d_6 ? ? 0.638935494104 ? ? 5 'Torsion NCS' ? A ? ? ? ens_1 'X-RAY DIFFRACTION' d_7 ? ? 0.809961573781 ? ? 6 'Torsion NCS' ? A ? ? ? ens_1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.20 3.28 . . 135 1262 96.08 . . . 0.4163 . 0.3717 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.28 3.37 . . 146 1299 99.66 . . . 0.3325 . 0.3193 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.37 3.47 . . 138 1305 99.65 . . . 0.3359 . 0.2927 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.47 3.58 . . 136 1319 99.59 . . . 0.3126 . 0.2937 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.58 3.71 . . 146 1315 100.00 . . . 0.2814 . 0.2888 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.71 3.85 . . 142 1292 99.58 . . . 0.2825 . 0.2811 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.85 4.03 . . 142 1308 98.77 . . . 0.2170 . 0.2692 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.03 4.24 . . 140 1295 98.02 . . . 0.2786 . 0.2688 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.24 4.51 . . 141 1322 99.93 . . . 0.2596 . 0.2589 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.51 4.85 . . 144 1328 99.93 . . . 0.2592 . 0.2442 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.85 5.34 . . 147 1331 99.66 . . . 0.2603 . 0.2226 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.34 6.11 . . 141 1344 99.73 . . . 0.2409 . 0.2397 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.11 7.69 . . 146 1342 99.20 . . . 0.2817 . 0.2393 . . . . . . . . . . . 'X-RAY DIFFRACTION' 7.69 36.01 . . 147 1388 97.65 . . . 0.2763 . 0.2209 . . . . . . . . . . . # loop_ _struct_ncs_oper.id _struct_ncs_oper.code _struct_ncs_oper.matrix[1][1] _struct_ncs_oper.matrix[1][2] _struct_ncs_oper.matrix[1][3] _struct_ncs_oper.matrix[2][1] _struct_ncs_oper.matrix[2][2] _struct_ncs_oper.matrix[2][3] _struct_ncs_oper.matrix[3][1] _struct_ncs_oper.matrix[3][2] _struct_ncs_oper.matrix[3][3] _struct_ncs_oper.vector[1] _struct_ncs_oper.vector[2] _struct_ncs_oper.vector[3] _struct_ncs_oper.details 1 given 0.999933947875 0.00970867786597 0.00615154131853 -0.00679596416465 0.931069966014 -0.364777374927 -0.00926902139233 0.364711474952 0.931074446691 0.700861473459 -1.23722270678 18.8754901361 ? 2 given 0.999886388166 0.014374798771 0.00453606886316 -0.00556411609068 0.631658623273 -0.775226692173 -0.0140089747151 0.775113378033 0.631666842427 0.922541378025 -21.4098016849 43.7126921977 ? 3 given 0.999643822574 0.0158875782308 0.0214432471424 0.0182768901514 0.177939277581 -0.983871723743 -0.0194469348856 0.983913206717 0.177585524105 1.30178402131 -50.0238286813 55.7129550193 ? 4 given 0.99984790132 0.0158106058091 0.00736199497339 0.0106376255945 -0.218338336997 -0.975815152331 -0.0138208229766 0.975745046281 -0.21847331533 0.632044998654 -71.3076916611 56.6664758396 ? 5 given 0.996170753373 0.0795947668651 0.0361732388964 0.0768321187615 -0.599545949055 -0.796643885622 -0.041721165506 0.796372606296 -0.603365574332 7.11145415548 -92.5227957126 46.8138731362 ? 6 given 0.998731950729 0.0341939355902 -0.0369494974422 0.0118012327116 -0.872508370031 -0.488456625641 -0.0489410001825 0.487401188955 -0.87180551702 1.83762031014 -109.51464701 30.4109088452 ? # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details ens_1 d_1 ;(chain "A" and resid 60 through 122) ; ens_1 d_2 ;(chain "B" and resid 60 through 122) ; ens_1 d_3 ;(chain "C" and resid 60 through 122) ; ens_1 d_4 ;(chain "D" and resid 60 through 122) ; ens_1 d_5 ;(chain "E" and resid 60 through 122) ; ens_1 d_6 ;(chain "F" and resid 60 through 122) ; ens_1 d_7 ;chain "G" ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details ens_1 d_1 1 . A GLU 2 . A GLU 64 ? ? ? ? ? ? ens_1 d_2 1 . B GLU 2 . B GLU 64 ? ? ? ? ? ? ens_1 d_3 1 . C GLU 2 . C GLU 64 ? ? ? ? ? ? ens_1 d_4 1 . D GLU 2 . D GLU 64 ? ? ? ? ? ? ens_1 d_5 1 . E GLU 2 . E GLU 64 ? ? ? ? ? ? ens_1 d_6 1 . F GLU 2 . F GLU 64 ? ? ? ? ? ? ens_1 d_7 1 . G GLU 1 . G GLU 63 ? ? ? ? ? ? # _struct_ncs_ens.id ens_1 _struct_ncs_ens.details ? # loop_ _struct_ncs_ens_gen.ens_id _struct_ncs_ens_gen.dom_id_1 _struct_ncs_ens_gen.dom_id_2 _struct_ncs_ens_gen.oper_id ens_1 d_2 d_1 1 ens_1 d_3 d_1 2 ens_1 d_4 d_1 3 ens_1 d_5 d_1 4 ens_1 d_6 d_1 5 ens_1 d_7 d_1 6 # _struct.entry_id 8DFK _struct.title 'X-ray crystal structure of Bacillus subtilis ComEA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8DFK _struct_keywords.text 'plasma membrane, DNA binding, genetic competence, oligomerization, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? G N N 1 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 27 ? ALA A 35 ? ARG A 83 ALA A 91 1 ? 9 HELX_P HELX_P2 AA2 ASP A 43 ? VAL A 47 ? ASP A 99 VAL A 103 5 ? 5 HELX_P HELX_P3 AA3 ARG B 27 ? ALA B 35 ? ARG B 83 ALA B 91 1 ? 9 HELX_P HELX_P4 AA4 ASP B 43 ? VAL B 47 ? ASP B 99 VAL B 103 5 ? 5 HELX_P HELX_P5 AA5 ARG C 27 ? ALA C 35 ? ARG C 83 ALA C 91 1 ? 9 HELX_P HELX_P6 AA6 ASP C 43 ? VAL C 47 ? ASP C 99 VAL C 103 5 ? 5 HELX_P HELX_P7 AA7 ARG D 27 ? ALA D 35 ? ARG D 83 ALA D 91 1 ? 9 HELX_P HELX_P8 AA8 ASP D 43 ? VAL D 47 ? ASP D 99 VAL D 103 5 ? 5 HELX_P HELX_P9 AA9 ARG E 27 ? ALA E 35 ? ARG E 83 ALA E 91 1 ? 9 HELX_P HELX_P10 AB1 ASP E 43 ? VAL E 47 ? ASP E 99 VAL E 103 5 ? 5 HELX_P HELX_P11 AB2 ARG F 27 ? ALA F 35 ? ARG F 83 ALA F 91 1 ? 9 HELX_P HELX_P12 AB3 ASP F 43 ? VAL F 47 ? ASP F 99 VAL F 103 5 ? 5 HELX_P HELX_P13 AB4 ARG G 27 ? ALA G 35 ? ARG G 83 ALA G 91 1 ? 9 HELX_P HELX_P14 AB5 ASP G 43 ? VAL G 47 ? ASP G 99 VAL G 103 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? AA3 ? 2 ? AA4 ? 2 ? AA5 ? 2 ? AA6 ? 2 ? AA7 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA6 1 2 ? anti-parallel AA7 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 5 ? ILE A 10 ? THR A 61 ILE A 66 AA1 2 GLY A 18 ? ARG A 23 ? GLY A 74 ARG A 79 AA2 1 GLY B 18 ? ARG B 23 ? GLY B 74 ARG B 79 AA2 2 THR B 5 ? GLY B 12 ? THR B 61 GLY B 68 AA2 3 VAL B 58 ? ILE B 61 ? VAL B 114 ILE B 117 AA3 1 THR C 5 ? ILE C 10 ? THR C 61 ILE C 66 AA3 2 GLY C 18 ? ARG C 23 ? GLY C 74 ARG C 79 AA4 1 THR D 5 ? ILE D 10 ? THR D 61 ILE D 66 AA4 2 GLY D 18 ? ARG D 23 ? GLY D 74 ARG D 79 AA5 1 THR E 5 ? ILE E 10 ? THR E 61 ILE E 66 AA5 2 GLY E 18 ? ARG E 23 ? GLY E 74 ARG E 79 AA6 1 THR F 5 ? ILE F 10 ? THR F 61 ILE F 66 AA6 2 GLY F 18 ? ARG F 23 ? GLY F 74 ARG F 79 AA7 1 THR G 5 ? ILE G 10 ? THR G 61 ILE G 66 AA7 2 GLY G 18 ? ARG G 23 ? GLY G 74 ARG G 79 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 10 ? N ILE A 66 O GLY A 18 ? O GLY A 74 AA2 1 2 O GLY B 18 ? O GLY B 74 N ILE B 10 ? N ILE B 66 AA2 2 3 N ASP B 9 ? N ASP B 65 O VAL B 59 ? O VAL B 115 AA3 1 2 N ILE C 6 ? N ILE C 62 O MET C 22 ? O MET C 78 AA4 1 2 N ILE D 10 ? N ILE D 66 O GLY D 18 ? O GLY D 74 AA5 1 2 N ILE E 8 ? N ILE E 64 O TYR E 20 ? O TYR E 76 AA6 1 2 N ILE F 10 ? N ILE F 66 O GLY F 18 ? O GLY F 74 AA7 1 2 N ILE G 10 ? N ILE G 66 O GLY G 18 ? O GLY G 74 # _atom_sites.entry_id 8DFK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008732 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008585 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005456 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.99627 ? ? ? 14.84254 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 57 ? ? ? A . n A 1 2 SER 2 58 ? ? ? A . n A 1 3 ASN 3 59 59 ASN ASN A . n A 1 4 GLU 4 60 60 GLU GLU A . n A 1 5 THR 5 61 61 THR THR A . n A 1 6 ILE 6 62 62 ILE ILE A . n A 1 7 VAL 7 63 63 VAL VAL A . n A 1 8 ILE 8 64 64 ILE ILE A . n A 1 9 ASP 9 65 65 ASP ASP A . n A 1 10 ILE 10 66 66 ILE ILE A . n A 1 11 LYS 11 67 67 LYS LYS A . n A 1 12 GLY 12 68 68 GLY GLY A . n A 1 13 ALA 13 69 69 ALA ALA A . n A 1 14 VAL 14 70 70 VAL VAL A . n A 1 15 GLN 15 71 71 GLN GLN A . n A 1 16 HIS 16 72 72 HIS HIS A . n A 1 17 PRO 17 73 73 PRO PRO A . n A 1 18 GLY 18 74 74 GLY GLY A . n A 1 19 VAL 19 75 75 VAL VAL A . n A 1 20 TYR 20 76 76 TYR TYR A . n A 1 21 GLU 21 77 77 GLU GLU A . n A 1 22 MET 22 78 78 MET MET A . n A 1 23 ARG 23 79 79 ARG ARG A . n A 1 24 THR 24 80 80 THR THR A . n A 1 25 GLY 25 81 81 GLY GLY A . n A 1 26 ASP 26 82 82 ASP ASP A . n A 1 27 ARG 27 83 83 ARG ARG A . n A 1 28 VAL 28 84 84 VAL VAL A . n A 1 29 SER 29 85 85 SER SER A . n A 1 30 GLN 30 86 86 GLN GLN A . n A 1 31 ALA 31 87 87 ALA ALA A . n A 1 32 ILE 32 88 88 ILE ILE A . n A 1 33 GLU 33 89 89 GLU GLU A . n A 1 34 LYS 34 90 90 LYS LYS A . n A 1 35 ALA 35 91 91 ALA ALA A . n A 1 36 GLY 36 92 92 GLY GLY A . n A 1 37 GLY 37 93 93 GLY GLY A . n A 1 38 THR 38 94 94 THR THR A . n A 1 39 SER 39 95 95 SER SER A . n A 1 40 GLU 40 96 96 GLU GLU A . n A 1 41 GLN 41 97 97 GLN GLN A . n A 1 42 ALA 42 98 98 ALA ALA A . n A 1 43 ASP 43 99 99 ASP ASP A . n A 1 44 GLU 44 100 100 GLU GLU A . n A 1 45 ALA 45 101 101 ALA ALA A . n A 1 46 GLN 46 102 102 GLN GLN A . n A 1 47 VAL 47 103 103 VAL VAL A . n A 1 48 ASN 48 104 104 ASN ASN A . n A 1 49 LEU 49 105 105 LEU LEU A . n A 1 50 ALA 50 106 106 ALA ALA A . n A 1 51 GLU 51 107 107 GLU GLU A . n A 1 52 ILE 52 108 108 ILE ILE A . n A 1 53 LEU 53 109 109 LEU LEU A . n A 1 54 GLN 54 110 110 GLN GLN A . n A 1 55 ASP 55 111 111 ASP ASP A . n A 1 56 GLY 56 112 112 GLY GLY A . n A 1 57 THR 57 113 113 THR THR A . n A 1 58 VAL 58 114 114 VAL VAL A . n A 1 59 VAL 59 115 115 VAL VAL A . n A 1 60 TYR 60 116 116 TYR TYR A . n A 1 61 ILE 61 117 117 ILE ILE A . n A 1 62 PRO 62 118 118 PRO PRO A . n A 1 63 LYS 63 119 119 LYS LYS A . n A 1 64 LYS 64 120 120 LYS LYS A . n A 1 65 GLY 65 121 121 GLY GLY A . n A 1 66 GLU 66 122 122 GLU GLU A . n A 1 67 GLU 67 123 ? ? ? A . n A 1 68 THR 68 124 ? ? ? A . n A 1 69 ALA 69 125 ? ? ? A . n A 1 70 VAL 70 126 ? ? ? A . n A 1 71 GLN 71 127 ? ? ? A . n A 1 72 GLN 72 128 ? ? ? A . n A 1 73 GLY 73 129 ? ? ? A . n A 1 74 GLY 74 130 ? ? ? A . n A 1 75 GLY 75 131 ? ? ? A . n A 1 76 GLY 76 132 ? ? ? A . n A 1 77 SER 77 133 ? ? ? A . n A 1 78 VAL 78 134 ? ? ? A . n A 1 79 GLN 79 135 ? ? ? A . n A 1 80 SER 80 136 ? ? ? A . n A 1 81 ASP 81 137 ? ? ? A . n A 1 82 GLY 82 138 ? ? ? A . n A 1 83 GLY 83 139 ? ? ? A . n A 1 84 LYS 84 140 ? ? ? A . n A 1 85 GLY 85 141 ? ? ? A . n A 1 86 ALA 86 142 ? ? ? A . n A 1 87 LEU 87 143 ? ? ? A . n A 1 88 VAL 88 144 ? ? ? A . n A 1 89 ASN 89 145 ? ? ? A . n A 1 90 ILE 90 146 ? ? ? A . n A 1 91 ASN 91 147 ? ? ? A . n A 1 92 THR 92 148 ? ? ? A . n A 1 93 ALA 93 149 ? ? ? A . n A 1 94 THR 94 150 ? ? ? A . n A 1 95 LEU 95 151 ? ? ? A . n A 1 96 GLU 96 152 ? ? ? A . n A 1 97 GLU 97 153 ? ? ? A . n A 1 98 LEU 98 154 ? ? ? A . n A 1 99 GLN 99 155 ? ? ? A . n A 1 100 GLY 100 156 ? ? ? A . n A 1 101 ILE 101 157 ? ? ? A . n A 1 102 SER 102 158 ? ? ? A . n A 1 103 GLY 103 159 ? ? ? A . n A 1 104 VAL 104 160 ? ? ? A . n A 1 105 GLY 105 161 ? ? ? A . n A 1 106 PRO 106 162 ? ? ? A . n A 1 107 SER 107 163 ? ? ? A . n A 1 108 LYS 108 164 ? ? ? A . n A 1 109 ALA 109 165 ? ? ? A . n A 1 110 GLU 110 166 ? ? ? A . n A 1 111 ALA 111 167 ? ? ? A . n A 1 112 ILE 112 168 ? ? ? A . n A 1 113 ILE 113 169 ? ? ? A . n A 1 114 ALA 114 170 ? ? ? A . n A 1 115 TYR 115 171 ? ? ? A . n A 1 116 ARG 116 172 ? ? ? A . n A 1 117 GLU 117 173 ? ? ? A . n A 1 118 GLU 118 174 ? ? ? A . n A 1 119 ASN 119 175 ? ? ? A . n A 1 120 GLY 120 176 ? ? ? A . n A 1 121 ARG 121 177 ? ? ? A . n A 1 122 PHE 122 178 ? ? ? A . n A 1 123 GLN 123 179 ? ? ? A . n A 1 124 THR 124 180 ? ? ? A . n A 1 125 ILE 125 181 ? ? ? A . n A 1 126 GLU 126 182 ? ? ? A . n A 1 127 ASP 127 183 ? ? ? A . n A 1 128 ILE 128 184 ? ? ? A . n A 1 129 THR 129 185 ? ? ? A . n A 1 130 LYS 130 186 ? ? ? A . n A 1 131 VAL 131 187 ? ? ? A . n A 1 132 SER 132 188 ? ? ? A . n A 1 133 GLY 133 189 ? ? ? A . n A 1 134 ILE 134 190 ? ? ? A . n A 1 135 GLY 135 191 ? ? ? A . n A 1 136 GLU 136 192 ? ? ? A . n A 1 137 LYS 137 193 ? ? ? A . n A 1 138 SER 138 194 ? ? ? A . n A 1 139 PHE 139 195 ? ? ? A . n A 1 140 GLU 140 196 ? ? ? A . n A 1 141 LYS 141 197 ? ? ? A . n A 1 142 ILE 142 198 ? ? ? A . n A 1 143 LYS 143 199 ? ? ? A . n A 1 144 SER 144 200 ? ? ? A . n A 1 145 SER 145 201 ? ? ? A . n A 1 146 ILE 146 202 ? ? ? A . n A 1 147 THR 147 203 ? ? ? A . n A 1 148 VAL 148 204 ? ? ? A . n A 1 149 LYS 149 205 ? ? ? A . n A 1 150 LEU 150 206 ? ? ? A . n A 1 151 GLU 151 207 ? ? ? A . n A 1 152 HIS 152 208 ? ? ? A . n A 1 153 HIS 153 209 ? ? ? A . n A 1 154 HIS 154 210 ? ? ? A . n A 1 155 HIS 155 211 ? ? ? A . n A 1 156 HIS 156 212 ? ? ? A . n A 1 157 HIS 157 213 ? ? ? A . n B 1 1 MET 1 57 ? ? ? B . n B 1 2 SER 2 58 ? ? ? B . n B 1 3 ASN 3 59 59 ASN ASN B . n B 1 4 GLU 4 60 60 GLU GLU B . n B 1 5 THR 5 61 61 THR THR B . n B 1 6 ILE 6 62 62 ILE ILE B . n B 1 7 VAL 7 63 63 VAL VAL B . n B 1 8 ILE 8 64 64 ILE ILE B . n B 1 9 ASP 9 65 65 ASP ASP B . n B 1 10 ILE 10 66 66 ILE ILE B . n B 1 11 LYS 11 67 67 LYS LYS B . n B 1 12 GLY 12 68 68 GLY GLY B . n B 1 13 ALA 13 69 69 ALA ALA B . n B 1 14 VAL 14 70 70 VAL VAL B . n B 1 15 GLN 15 71 71 GLN GLN B . n B 1 16 HIS 16 72 72 HIS HIS B . n B 1 17 PRO 17 73 73 PRO PRO B . n B 1 18 GLY 18 74 74 GLY GLY B . n B 1 19 VAL 19 75 75 VAL VAL B . n B 1 20 TYR 20 76 76 TYR TYR B . n B 1 21 GLU 21 77 77 GLU GLU B . n B 1 22 MET 22 78 78 MET MET B . n B 1 23 ARG 23 79 79 ARG ARG B . n B 1 24 THR 24 80 80 THR THR B . n B 1 25 GLY 25 81 81 GLY GLY B . n B 1 26 ASP 26 82 82 ASP ASP B . n B 1 27 ARG 27 83 83 ARG ARG B . n B 1 28 VAL 28 84 84 VAL VAL B . n B 1 29 SER 29 85 85 SER SER B . n B 1 30 GLN 30 86 86 GLN GLN B . n B 1 31 ALA 31 87 87 ALA ALA B . n B 1 32 ILE 32 88 88 ILE ILE B . n B 1 33 GLU 33 89 89 GLU GLU B . n B 1 34 LYS 34 90 90 LYS LYS B . n B 1 35 ALA 35 91 91 ALA ALA B . n B 1 36 GLY 36 92 92 GLY GLY B . n B 1 37 GLY 37 93 93 GLY GLY B . n B 1 38 THR 38 94 94 THR THR B . n B 1 39 SER 39 95 95 SER SER B . n B 1 40 GLU 40 96 96 GLU GLU B . n B 1 41 GLN 41 97 97 GLN GLN B . n B 1 42 ALA 42 98 98 ALA ALA B . n B 1 43 ASP 43 99 99 ASP ASP B . n B 1 44 GLU 44 100 100 GLU GLU B . n B 1 45 ALA 45 101 101 ALA ALA B . n B 1 46 GLN 46 102 102 GLN GLN B . n B 1 47 VAL 47 103 103 VAL VAL B . n B 1 48 ASN 48 104 104 ASN ASN B . n B 1 49 LEU 49 105 105 LEU LEU B . n B 1 50 ALA 50 106 106 ALA ALA B . n B 1 51 GLU 51 107 107 GLU GLU B . n B 1 52 ILE 52 108 108 ILE ILE B . n B 1 53 LEU 53 109 109 LEU LEU B . n B 1 54 GLN 54 110 110 GLN GLN B . n B 1 55 ASP 55 111 111 ASP ASP B . n B 1 56 GLY 56 112 112 GLY GLY B . n B 1 57 THR 57 113 113 THR THR B . n B 1 58 VAL 58 114 114 VAL VAL B . n B 1 59 VAL 59 115 115 VAL VAL B . n B 1 60 TYR 60 116 116 TYR TYR B . n B 1 61 ILE 61 117 117 ILE ILE B . n B 1 62 PRO 62 118 118 PRO PRO B . n B 1 63 LYS 63 119 119 LYS LYS B . n B 1 64 LYS 64 120 120 LYS LYS B . n B 1 65 GLY 65 121 121 GLY GLY B . n B 1 66 GLU 66 122 122 GLU GLU B . n B 1 67 GLU 67 123 ? ? ? B . n B 1 68 THR 68 124 ? ? ? B . n B 1 69 ALA 69 125 ? ? ? B . n B 1 70 VAL 70 126 ? ? ? B . n B 1 71 GLN 71 127 ? ? ? B . n B 1 72 GLN 72 128 ? ? ? B . n B 1 73 GLY 73 129 ? ? ? B . n B 1 74 GLY 74 130 ? ? ? B . n B 1 75 GLY 75 131 ? ? ? B . n B 1 76 GLY 76 132 ? ? ? B . n B 1 77 SER 77 133 ? ? ? B . n B 1 78 VAL 78 134 ? ? ? B . n B 1 79 GLN 79 135 ? ? ? B . n B 1 80 SER 80 136 ? ? ? B . n B 1 81 ASP 81 137 ? ? ? B . n B 1 82 GLY 82 138 ? ? ? B . n B 1 83 GLY 83 139 ? ? ? B . n B 1 84 LYS 84 140 ? ? ? B . n B 1 85 GLY 85 141 ? ? ? B . n B 1 86 ALA 86 142 ? ? ? B . n B 1 87 LEU 87 143 ? ? ? B . n B 1 88 VAL 88 144 ? ? ? B . n B 1 89 ASN 89 145 ? ? ? B . n B 1 90 ILE 90 146 ? ? ? B . n B 1 91 ASN 91 147 ? ? ? B . n B 1 92 THR 92 148 ? ? ? B . n B 1 93 ALA 93 149 ? ? ? B . n B 1 94 THR 94 150 ? ? ? B . n B 1 95 LEU 95 151 ? ? ? B . n B 1 96 GLU 96 152 ? ? ? B . n B 1 97 GLU 97 153 ? ? ? B . n B 1 98 LEU 98 154 ? ? ? B . n B 1 99 GLN 99 155 ? ? ? B . n B 1 100 GLY 100 156 ? ? ? B . n B 1 101 ILE 101 157 ? ? ? B . n B 1 102 SER 102 158 ? ? ? B . n B 1 103 GLY 103 159 ? ? ? B . n B 1 104 VAL 104 160 ? ? ? B . n B 1 105 GLY 105 161 ? ? ? B . n B 1 106 PRO 106 162 ? ? ? B . n B 1 107 SER 107 163 ? ? ? B . n B 1 108 LYS 108 164 ? ? ? B . n B 1 109 ALA 109 165 ? ? ? B . n B 1 110 GLU 110 166 ? ? ? B . n B 1 111 ALA 111 167 ? ? ? B . n B 1 112 ILE 112 168 ? ? ? B . n B 1 113 ILE 113 169 ? ? ? B . n B 1 114 ALA 114 170 ? ? ? B . n B 1 115 TYR 115 171 ? ? ? B . n B 1 116 ARG 116 172 ? ? ? B . n B 1 117 GLU 117 173 ? ? ? B . n B 1 118 GLU 118 174 ? ? ? B . n B 1 119 ASN 119 175 ? ? ? B . n B 1 120 GLY 120 176 ? ? ? B . n B 1 121 ARG 121 177 ? ? ? B . n B 1 122 PHE 122 178 ? ? ? B . n B 1 123 GLN 123 179 ? ? ? B . n B 1 124 THR 124 180 ? ? ? B . n B 1 125 ILE 125 181 ? ? ? B . n B 1 126 GLU 126 182 ? ? ? B . n B 1 127 ASP 127 183 ? ? ? B . n B 1 128 ILE 128 184 ? ? ? B . n B 1 129 THR 129 185 ? ? ? B . n B 1 130 LYS 130 186 ? ? ? B . n B 1 131 VAL 131 187 ? ? ? B . n B 1 132 SER 132 188 ? ? ? B . n B 1 133 GLY 133 189 ? ? ? B . n B 1 134 ILE 134 190 ? ? ? B . n B 1 135 GLY 135 191 ? ? ? B . n B 1 136 GLU 136 192 ? ? ? B . n B 1 137 LYS 137 193 ? ? ? B . n B 1 138 SER 138 194 ? ? ? B . n B 1 139 PHE 139 195 ? ? ? B . n B 1 140 GLU 140 196 ? ? ? B . n B 1 141 LYS 141 197 ? ? ? B . n B 1 142 ILE 142 198 ? ? ? B . n B 1 143 LYS 143 199 ? ? ? B . n B 1 144 SER 144 200 ? ? ? B . n B 1 145 SER 145 201 ? ? ? B . n B 1 146 ILE 146 202 ? ? ? B . n B 1 147 THR 147 203 ? ? ? B . n B 1 148 VAL 148 204 ? ? ? B . n B 1 149 LYS 149 205 ? ? ? B . n B 1 150 LEU 150 206 ? ? ? B . n B 1 151 GLU 151 207 ? ? ? B . n B 1 152 HIS 152 208 ? ? ? B . n B 1 153 HIS 153 209 ? ? ? B . n B 1 154 HIS 154 210 ? ? ? B . n B 1 155 HIS 155 211 ? ? ? B . n B 1 156 HIS 156 212 ? ? ? B . n B 1 157 HIS 157 213 ? ? ? B . n C 1 1 MET 1 57 ? ? ? C . n C 1 2 SER 2 58 ? ? ? C . n C 1 3 ASN 3 59 59 ASN ASN C . n C 1 4 GLU 4 60 60 GLU GLU C . n C 1 5 THR 5 61 61 THR THR C . n C 1 6 ILE 6 62 62 ILE ILE C . n C 1 7 VAL 7 63 63 VAL VAL C . n C 1 8 ILE 8 64 64 ILE ILE C . n C 1 9 ASP 9 65 65 ASP ASP C . n C 1 10 ILE 10 66 66 ILE ILE C . n C 1 11 LYS 11 67 67 LYS LYS C . n C 1 12 GLY 12 68 68 GLY GLY C . n C 1 13 ALA 13 69 69 ALA ALA C . n C 1 14 VAL 14 70 70 VAL VAL C . n C 1 15 GLN 15 71 71 GLN GLN C . n C 1 16 HIS 16 72 72 HIS HIS C . n C 1 17 PRO 17 73 73 PRO PRO C . n C 1 18 GLY 18 74 74 GLY GLY C . n C 1 19 VAL 19 75 75 VAL VAL C . n C 1 20 TYR 20 76 76 TYR TYR C . n C 1 21 GLU 21 77 77 GLU GLU C . n C 1 22 MET 22 78 78 MET MET C . n C 1 23 ARG 23 79 79 ARG ARG C . n C 1 24 THR 24 80 80 THR THR C . n C 1 25 GLY 25 81 81 GLY GLY C . n C 1 26 ASP 26 82 82 ASP ASP C . n C 1 27 ARG 27 83 83 ARG ARG C . n C 1 28 VAL 28 84 84 VAL VAL C . n C 1 29 SER 29 85 85 SER SER C . n C 1 30 GLN 30 86 86 GLN GLN C . n C 1 31 ALA 31 87 87 ALA ALA C . n C 1 32 ILE 32 88 88 ILE ILE C . n C 1 33 GLU 33 89 89 GLU GLU C . n C 1 34 LYS 34 90 90 LYS LYS C . n C 1 35 ALA 35 91 91 ALA ALA C . n C 1 36 GLY 36 92 92 GLY GLY C . n C 1 37 GLY 37 93 93 GLY GLY C . n C 1 38 THR 38 94 94 THR THR C . n C 1 39 SER 39 95 95 SER SER C . n C 1 40 GLU 40 96 96 GLU GLU C . n C 1 41 GLN 41 97 97 GLN GLN C . n C 1 42 ALA 42 98 98 ALA ALA C . n C 1 43 ASP 43 99 99 ASP ASP C . n C 1 44 GLU 44 100 100 GLU GLU C . n C 1 45 ALA 45 101 101 ALA ALA C . n C 1 46 GLN 46 102 102 GLN GLN C . n C 1 47 VAL 47 103 103 VAL VAL C . n C 1 48 ASN 48 104 104 ASN ASN C . n C 1 49 LEU 49 105 105 LEU LEU C . n C 1 50 ALA 50 106 106 ALA ALA C . n C 1 51 GLU 51 107 107 GLU GLU C . n C 1 52 ILE 52 108 108 ILE ILE C . n C 1 53 LEU 53 109 109 LEU LEU C . n C 1 54 GLN 54 110 110 GLN GLN C . n C 1 55 ASP 55 111 111 ASP ASP C . n C 1 56 GLY 56 112 112 GLY GLY C . n C 1 57 THR 57 113 113 THR THR C . n C 1 58 VAL 58 114 114 VAL VAL C . n C 1 59 VAL 59 115 115 VAL VAL C . n C 1 60 TYR 60 116 116 TYR TYR C . n C 1 61 ILE 61 117 117 ILE ILE C . n C 1 62 PRO 62 118 118 PRO PRO C . n C 1 63 LYS 63 119 119 LYS LYS C . n C 1 64 LYS 64 120 120 LYS LYS C . n C 1 65 GLY 65 121 121 GLY GLY C . n C 1 66 GLU 66 122 122 GLU GLU C . n C 1 67 GLU 67 123 ? ? ? C . n C 1 68 THR 68 124 ? ? ? C . n C 1 69 ALA 69 125 ? ? ? C . n C 1 70 VAL 70 126 ? ? ? C . n C 1 71 GLN 71 127 ? ? ? C . n C 1 72 GLN 72 128 ? ? ? C . n C 1 73 GLY 73 129 ? ? ? C . n C 1 74 GLY 74 130 ? ? ? C . n C 1 75 GLY 75 131 ? ? ? C . n C 1 76 GLY 76 132 ? ? ? C . n C 1 77 SER 77 133 ? ? ? C . n C 1 78 VAL 78 134 ? ? ? C . n C 1 79 GLN 79 135 ? ? ? C . n C 1 80 SER 80 136 ? ? ? C . n C 1 81 ASP 81 137 ? ? ? C . n C 1 82 GLY 82 138 ? ? ? C . n C 1 83 GLY 83 139 ? ? ? C . n C 1 84 LYS 84 140 ? ? ? C . n C 1 85 GLY 85 141 ? ? ? C . n C 1 86 ALA 86 142 ? ? ? C . n C 1 87 LEU 87 143 ? ? ? C . n C 1 88 VAL 88 144 ? ? ? C . n C 1 89 ASN 89 145 ? ? ? C . n C 1 90 ILE 90 146 ? ? ? C . n C 1 91 ASN 91 147 ? ? ? C . n C 1 92 THR 92 148 ? ? ? C . n C 1 93 ALA 93 149 ? ? ? C . n C 1 94 THR 94 150 ? ? ? C . n C 1 95 LEU 95 151 ? ? ? C . n C 1 96 GLU 96 152 ? ? ? C . n C 1 97 GLU 97 153 ? ? ? C . n C 1 98 LEU 98 154 ? ? ? C . n C 1 99 GLN 99 155 ? ? ? C . n C 1 100 GLY 100 156 ? ? ? C . n C 1 101 ILE 101 157 ? ? ? C . n C 1 102 SER 102 158 ? ? ? C . n C 1 103 GLY 103 159 ? ? ? C . n C 1 104 VAL 104 160 ? ? ? C . n C 1 105 GLY 105 161 ? ? ? C . n C 1 106 PRO 106 162 ? ? ? C . n C 1 107 SER 107 163 ? ? ? C . n C 1 108 LYS 108 164 ? ? ? C . n C 1 109 ALA 109 165 ? ? ? C . n C 1 110 GLU 110 166 ? ? ? C . n C 1 111 ALA 111 167 ? ? ? C . n C 1 112 ILE 112 168 ? ? ? C . n C 1 113 ILE 113 169 ? ? ? C . n C 1 114 ALA 114 170 ? ? ? C . n C 1 115 TYR 115 171 ? ? ? C . n C 1 116 ARG 116 172 ? ? ? C . n C 1 117 GLU 117 173 ? ? ? C . n C 1 118 GLU 118 174 ? ? ? C . n C 1 119 ASN 119 175 ? ? ? C . n C 1 120 GLY 120 176 ? ? ? C . n C 1 121 ARG 121 177 ? ? ? C . n C 1 122 PHE 122 178 ? ? ? C . n C 1 123 GLN 123 179 ? ? ? C . n C 1 124 THR 124 180 ? ? ? C . n C 1 125 ILE 125 181 ? ? ? C . n C 1 126 GLU 126 182 ? ? ? C . n C 1 127 ASP 127 183 ? ? ? C . n C 1 128 ILE 128 184 ? ? ? C . n C 1 129 THR 129 185 ? ? ? C . n C 1 130 LYS 130 186 ? ? ? C . n C 1 131 VAL 131 187 ? ? ? C . n C 1 132 SER 132 188 ? ? ? C . n C 1 133 GLY 133 189 ? ? ? C . n C 1 134 ILE 134 190 ? ? ? C . n C 1 135 GLY 135 191 ? ? ? C . n C 1 136 GLU 136 192 ? ? ? C . n C 1 137 LYS 137 193 ? ? ? C . n C 1 138 SER 138 194 ? ? ? C . n C 1 139 PHE 139 195 ? ? ? C . n C 1 140 GLU 140 196 ? ? ? C . n C 1 141 LYS 141 197 ? ? ? C . n C 1 142 ILE 142 198 ? ? ? C . n C 1 143 LYS 143 199 ? ? ? C . n C 1 144 SER 144 200 ? ? ? C . n C 1 145 SER 145 201 ? ? ? C . n C 1 146 ILE 146 202 ? ? ? C . n C 1 147 THR 147 203 ? ? ? C . n C 1 148 VAL 148 204 ? ? ? C . n C 1 149 LYS 149 205 ? ? ? C . n C 1 150 LEU 150 206 ? ? ? C . n C 1 151 GLU 151 207 ? ? ? C . n C 1 152 HIS 152 208 ? ? ? C . n C 1 153 HIS 153 209 ? ? ? C . n C 1 154 HIS 154 210 ? ? ? C . n C 1 155 HIS 155 211 ? ? ? C . n C 1 156 HIS 156 212 ? ? ? C . n C 1 157 HIS 157 213 ? ? ? C . n D 1 1 MET 1 57 ? ? ? D . n D 1 2 SER 2 58 ? ? ? D . n D 1 3 ASN 3 59 59 ASN ASN D . n D 1 4 GLU 4 60 60 GLU GLU D . n D 1 5 THR 5 61 61 THR THR D . n D 1 6 ILE 6 62 62 ILE ILE D . n D 1 7 VAL 7 63 63 VAL VAL D . n D 1 8 ILE 8 64 64 ILE ILE D . n D 1 9 ASP 9 65 65 ASP ASP D . n D 1 10 ILE 10 66 66 ILE ILE D . n D 1 11 LYS 11 67 67 LYS LYS D . n D 1 12 GLY 12 68 68 GLY GLY D . n D 1 13 ALA 13 69 69 ALA ALA D . n D 1 14 VAL 14 70 70 VAL VAL D . n D 1 15 GLN 15 71 71 GLN GLN D . n D 1 16 HIS 16 72 72 HIS HIS D . n D 1 17 PRO 17 73 73 PRO PRO D . n D 1 18 GLY 18 74 74 GLY GLY D . n D 1 19 VAL 19 75 75 VAL VAL D . n D 1 20 TYR 20 76 76 TYR TYR D . n D 1 21 GLU 21 77 77 GLU GLU D . n D 1 22 MET 22 78 78 MET MET D . n D 1 23 ARG 23 79 79 ARG ARG D . n D 1 24 THR 24 80 80 THR THR D . n D 1 25 GLY 25 81 81 GLY GLY D . n D 1 26 ASP 26 82 82 ASP ASP D . n D 1 27 ARG 27 83 83 ARG ARG D . n D 1 28 VAL 28 84 84 VAL VAL D . n D 1 29 SER 29 85 85 SER SER D . n D 1 30 GLN 30 86 86 GLN GLN D . n D 1 31 ALA 31 87 87 ALA ALA D . n D 1 32 ILE 32 88 88 ILE ILE D . n D 1 33 GLU 33 89 89 GLU GLU D . n D 1 34 LYS 34 90 90 LYS LYS D . n D 1 35 ALA 35 91 91 ALA ALA D . n D 1 36 GLY 36 92 92 GLY GLY D . n D 1 37 GLY 37 93 93 GLY GLY D . n D 1 38 THR 38 94 94 THR THR D . n D 1 39 SER 39 95 95 SER SER D . n D 1 40 GLU 40 96 96 GLU GLU D . n D 1 41 GLN 41 97 97 GLN GLN D . n D 1 42 ALA 42 98 98 ALA ALA D . n D 1 43 ASP 43 99 99 ASP ASP D . n D 1 44 GLU 44 100 100 GLU GLU D . n D 1 45 ALA 45 101 101 ALA ALA D . n D 1 46 GLN 46 102 102 GLN GLN D . n D 1 47 VAL 47 103 103 VAL VAL D . n D 1 48 ASN 48 104 104 ASN ASN D . n D 1 49 LEU 49 105 105 LEU LEU D . n D 1 50 ALA 50 106 106 ALA ALA D . n D 1 51 GLU 51 107 107 GLU GLU D . n D 1 52 ILE 52 108 108 ILE ILE D . n D 1 53 LEU 53 109 109 LEU LEU D . n D 1 54 GLN 54 110 110 GLN GLN D . n D 1 55 ASP 55 111 111 ASP ASP D . n D 1 56 GLY 56 112 112 GLY GLY D . n D 1 57 THR 57 113 113 THR THR D . n D 1 58 VAL 58 114 114 VAL VAL D . n D 1 59 VAL 59 115 115 VAL VAL D . n D 1 60 TYR 60 116 116 TYR TYR D . n D 1 61 ILE 61 117 117 ILE ILE D . n D 1 62 PRO 62 118 118 PRO PRO D . n D 1 63 LYS 63 119 119 LYS LYS D . n D 1 64 LYS 64 120 120 LYS LYS D . n D 1 65 GLY 65 121 121 GLY GLY D . n D 1 66 GLU 66 122 122 GLU GLU D . n D 1 67 GLU 67 123 ? ? ? D . n D 1 68 THR 68 124 ? ? ? D . n D 1 69 ALA 69 125 ? ? ? D . n D 1 70 VAL 70 126 ? ? ? D . n D 1 71 GLN 71 127 ? ? ? D . n D 1 72 GLN 72 128 ? ? ? D . n D 1 73 GLY 73 129 ? ? ? D . n D 1 74 GLY 74 130 ? ? ? D . n D 1 75 GLY 75 131 ? ? ? D . n D 1 76 GLY 76 132 ? ? ? D . n D 1 77 SER 77 133 ? ? ? D . n D 1 78 VAL 78 134 ? ? ? D . n D 1 79 GLN 79 135 ? ? ? D . n D 1 80 SER 80 136 ? ? ? D . n D 1 81 ASP 81 137 ? ? ? D . n D 1 82 GLY 82 138 ? ? ? D . n D 1 83 GLY 83 139 ? ? ? D . n D 1 84 LYS 84 140 ? ? ? D . n D 1 85 GLY 85 141 ? ? ? D . n D 1 86 ALA 86 142 ? ? ? D . n D 1 87 LEU 87 143 ? ? ? D . n D 1 88 VAL 88 144 ? ? ? D . n D 1 89 ASN 89 145 ? ? ? D . n D 1 90 ILE 90 146 ? ? ? D . n D 1 91 ASN 91 147 ? ? ? D . n D 1 92 THR 92 148 ? ? ? D . n D 1 93 ALA 93 149 ? ? ? D . n D 1 94 THR 94 150 ? ? ? D . n D 1 95 LEU 95 151 ? ? ? D . n D 1 96 GLU 96 152 ? ? ? D . n D 1 97 GLU 97 153 ? ? ? D . n D 1 98 LEU 98 154 ? ? ? D . n D 1 99 GLN 99 155 ? ? ? D . n D 1 100 GLY 100 156 ? ? ? D . n D 1 101 ILE 101 157 ? ? ? D . n D 1 102 SER 102 158 ? ? ? D . n D 1 103 GLY 103 159 ? ? ? D . n D 1 104 VAL 104 160 ? ? ? D . n D 1 105 GLY 105 161 ? ? ? D . n D 1 106 PRO 106 162 ? ? ? D . n D 1 107 SER 107 163 ? ? ? D . n D 1 108 LYS 108 164 ? ? ? D . n D 1 109 ALA 109 165 ? ? ? D . n D 1 110 GLU 110 166 ? ? ? D . n D 1 111 ALA 111 167 ? ? ? D . n D 1 112 ILE 112 168 ? ? ? D . n D 1 113 ILE 113 169 ? ? ? D . n D 1 114 ALA 114 170 ? ? ? D . n D 1 115 TYR 115 171 ? ? ? D . n D 1 116 ARG 116 172 ? ? ? D . n D 1 117 GLU 117 173 ? ? ? D . n D 1 118 GLU 118 174 ? ? ? D . n D 1 119 ASN 119 175 ? ? ? D . n D 1 120 GLY 120 176 ? ? ? D . n D 1 121 ARG 121 177 ? ? ? D . n D 1 122 PHE 122 178 ? ? ? D . n D 1 123 GLN 123 179 ? ? ? D . n D 1 124 THR 124 180 ? ? ? D . n D 1 125 ILE 125 181 ? ? ? D . n D 1 126 GLU 126 182 ? ? ? D . n D 1 127 ASP 127 183 ? ? ? D . n D 1 128 ILE 128 184 ? ? ? D . n D 1 129 THR 129 185 ? ? ? D . n D 1 130 LYS 130 186 ? ? ? D . n D 1 131 VAL 131 187 ? ? ? D . n D 1 132 SER 132 188 ? ? ? D . n D 1 133 GLY 133 189 ? ? ? D . n D 1 134 ILE 134 190 ? ? ? D . n D 1 135 GLY 135 191 ? ? ? D . n D 1 136 GLU 136 192 ? ? ? D . n D 1 137 LYS 137 193 ? ? ? D . n D 1 138 SER 138 194 ? ? ? D . n D 1 139 PHE 139 195 ? ? ? D . n D 1 140 GLU 140 196 ? ? ? D . n D 1 141 LYS 141 197 ? ? ? D . n D 1 142 ILE 142 198 ? ? ? D . n D 1 143 LYS 143 199 ? ? ? D . n D 1 144 SER 144 200 ? ? ? D . n D 1 145 SER 145 201 ? ? ? D . n D 1 146 ILE 146 202 ? ? ? D . n D 1 147 THR 147 203 ? ? ? D . n D 1 148 VAL 148 204 ? ? ? D . n D 1 149 LYS 149 205 ? ? ? D . n D 1 150 LEU 150 206 ? ? ? D . n D 1 151 GLU 151 207 ? ? ? D . n D 1 152 HIS 152 208 ? ? ? D . n D 1 153 HIS 153 209 ? ? ? D . n D 1 154 HIS 154 210 ? ? ? D . n D 1 155 HIS 155 211 ? ? ? D . n D 1 156 HIS 156 212 ? ? ? D . n D 1 157 HIS 157 213 ? ? ? D . n E 1 1 MET 1 57 ? ? ? E . n E 1 2 SER 2 58 ? ? ? E . n E 1 3 ASN 3 59 59 ASN ASN E . n E 1 4 GLU 4 60 60 GLU GLU E . n E 1 5 THR 5 61 61 THR THR E . n E 1 6 ILE 6 62 62 ILE ILE E . n E 1 7 VAL 7 63 63 VAL VAL E . n E 1 8 ILE 8 64 64 ILE ILE E . n E 1 9 ASP 9 65 65 ASP ASP E . n E 1 10 ILE 10 66 66 ILE ILE E . n E 1 11 LYS 11 67 67 LYS LYS E . n E 1 12 GLY 12 68 68 GLY GLY E . n E 1 13 ALA 13 69 69 ALA ALA E . n E 1 14 VAL 14 70 70 VAL VAL E . n E 1 15 GLN 15 71 71 GLN GLN E . n E 1 16 HIS 16 72 72 HIS HIS E . n E 1 17 PRO 17 73 73 PRO PRO E . n E 1 18 GLY 18 74 74 GLY GLY E . n E 1 19 VAL 19 75 75 VAL VAL E . n E 1 20 TYR 20 76 76 TYR TYR E . n E 1 21 GLU 21 77 77 GLU GLU E . n E 1 22 MET 22 78 78 MET MET E . n E 1 23 ARG 23 79 79 ARG ARG E . n E 1 24 THR 24 80 80 THR THR E . n E 1 25 GLY 25 81 81 GLY GLY E . n E 1 26 ASP 26 82 82 ASP ASP E . n E 1 27 ARG 27 83 83 ARG ARG E . n E 1 28 VAL 28 84 84 VAL VAL E . n E 1 29 SER 29 85 85 SER SER E . n E 1 30 GLN 30 86 86 GLN GLN E . n E 1 31 ALA 31 87 87 ALA ALA E . n E 1 32 ILE 32 88 88 ILE ILE E . n E 1 33 GLU 33 89 89 GLU GLU E . n E 1 34 LYS 34 90 90 LYS LYS E . n E 1 35 ALA 35 91 91 ALA ALA E . n E 1 36 GLY 36 92 92 GLY GLY E . n E 1 37 GLY 37 93 93 GLY GLY E . n E 1 38 THR 38 94 94 THR THR E . n E 1 39 SER 39 95 95 SER SER E . n E 1 40 GLU 40 96 96 GLU GLU E . n E 1 41 GLN 41 97 97 GLN GLN E . n E 1 42 ALA 42 98 98 ALA ALA E . n E 1 43 ASP 43 99 99 ASP ASP E . n E 1 44 GLU 44 100 100 GLU GLU E . n E 1 45 ALA 45 101 101 ALA ALA E . n E 1 46 GLN 46 102 102 GLN GLN E . n E 1 47 VAL 47 103 103 VAL VAL E . n E 1 48 ASN 48 104 104 ASN ASN E . n E 1 49 LEU 49 105 105 LEU LEU E . n E 1 50 ALA 50 106 106 ALA ALA E . n E 1 51 GLU 51 107 107 GLU GLU E . n E 1 52 ILE 52 108 108 ILE ILE E . n E 1 53 LEU 53 109 109 LEU LEU E . n E 1 54 GLN 54 110 110 GLN GLN E . n E 1 55 ASP 55 111 111 ASP ASP E . n E 1 56 GLY 56 112 112 GLY GLY E . n E 1 57 THR 57 113 113 THR THR E . n E 1 58 VAL 58 114 114 VAL VAL E . n E 1 59 VAL 59 115 115 VAL VAL E . n E 1 60 TYR 60 116 116 TYR TYR E . n E 1 61 ILE 61 117 117 ILE ILE E . n E 1 62 PRO 62 118 118 PRO PRO E . n E 1 63 LYS 63 119 119 LYS LYS E . n E 1 64 LYS 64 120 120 LYS LYS E . n E 1 65 GLY 65 121 121 GLY GLY E . n E 1 66 GLU 66 122 122 GLU GLU E . n E 1 67 GLU 67 123 ? ? ? E . n E 1 68 THR 68 124 ? ? ? E . n E 1 69 ALA 69 125 ? ? ? E . n E 1 70 VAL 70 126 ? ? ? E . n E 1 71 GLN 71 127 ? ? ? E . n E 1 72 GLN 72 128 ? ? ? E . n E 1 73 GLY 73 129 ? ? ? E . n E 1 74 GLY 74 130 ? ? ? E . n E 1 75 GLY 75 131 ? ? ? E . n E 1 76 GLY 76 132 ? ? ? E . n E 1 77 SER 77 133 ? ? ? E . n E 1 78 VAL 78 134 ? ? ? E . n E 1 79 GLN 79 135 ? ? ? E . n E 1 80 SER 80 136 ? ? ? E . n E 1 81 ASP 81 137 ? ? ? E . n E 1 82 GLY 82 138 ? ? ? E . n E 1 83 GLY 83 139 ? ? ? E . n E 1 84 LYS 84 140 ? ? ? E . n E 1 85 GLY 85 141 ? ? ? E . n E 1 86 ALA 86 142 ? ? ? E . n E 1 87 LEU 87 143 ? ? ? E . n E 1 88 VAL 88 144 ? ? ? E . n E 1 89 ASN 89 145 ? ? ? E . n E 1 90 ILE 90 146 ? ? ? E . n E 1 91 ASN 91 147 ? ? ? E . n E 1 92 THR 92 148 ? ? ? E . n E 1 93 ALA 93 149 ? ? ? E . n E 1 94 THR 94 150 ? ? ? E . n E 1 95 LEU 95 151 ? ? ? E . n E 1 96 GLU 96 152 ? ? ? E . n E 1 97 GLU 97 153 ? ? ? E . n E 1 98 LEU 98 154 ? ? ? E . n E 1 99 GLN 99 155 ? ? ? E . n E 1 100 GLY 100 156 ? ? ? E . n E 1 101 ILE 101 157 ? ? ? E . n E 1 102 SER 102 158 ? ? ? E . n E 1 103 GLY 103 159 ? ? ? E . n E 1 104 VAL 104 160 ? ? ? E . n E 1 105 GLY 105 161 ? ? ? E . n E 1 106 PRO 106 162 ? ? ? E . n E 1 107 SER 107 163 ? ? ? E . n E 1 108 LYS 108 164 ? ? ? E . n E 1 109 ALA 109 165 ? ? ? E . n E 1 110 GLU 110 166 ? ? ? E . n E 1 111 ALA 111 167 ? ? ? E . n E 1 112 ILE 112 168 ? ? ? E . n E 1 113 ILE 113 169 ? ? ? E . n E 1 114 ALA 114 170 ? ? ? E . n E 1 115 TYR 115 171 ? ? ? E . n E 1 116 ARG 116 172 ? ? ? E . n E 1 117 GLU 117 173 ? ? ? E . n E 1 118 GLU 118 174 ? ? ? E . n E 1 119 ASN 119 175 ? ? ? E . n E 1 120 GLY 120 176 ? ? ? E . n E 1 121 ARG 121 177 ? ? ? E . n E 1 122 PHE 122 178 ? ? ? E . n E 1 123 GLN 123 179 ? ? ? E . n E 1 124 THR 124 180 ? ? ? E . n E 1 125 ILE 125 181 ? ? ? E . n E 1 126 GLU 126 182 ? ? ? E . n E 1 127 ASP 127 183 ? ? ? E . n E 1 128 ILE 128 184 ? ? ? E . n E 1 129 THR 129 185 ? ? ? E . n E 1 130 LYS 130 186 ? ? ? E . n E 1 131 VAL 131 187 ? ? ? E . n E 1 132 SER 132 188 ? ? ? E . n E 1 133 GLY 133 189 ? ? ? E . n E 1 134 ILE 134 190 ? ? ? E . n E 1 135 GLY 135 191 ? ? ? E . n E 1 136 GLU 136 192 ? ? ? E . n E 1 137 LYS 137 193 ? ? ? E . n E 1 138 SER 138 194 ? ? ? E . n E 1 139 PHE 139 195 ? ? ? E . n E 1 140 GLU 140 196 ? ? ? E . n E 1 141 LYS 141 197 ? ? ? E . n E 1 142 ILE 142 198 ? ? ? E . n E 1 143 LYS 143 199 ? ? ? E . n E 1 144 SER 144 200 ? ? ? E . n E 1 145 SER 145 201 ? ? ? E . n E 1 146 ILE 146 202 ? ? ? E . n E 1 147 THR 147 203 ? ? ? E . n E 1 148 VAL 148 204 ? ? ? E . n E 1 149 LYS 149 205 ? ? ? E . n E 1 150 LEU 150 206 ? ? ? E . n E 1 151 GLU 151 207 ? ? ? E . n E 1 152 HIS 152 208 ? ? ? E . n E 1 153 HIS 153 209 ? ? ? E . n E 1 154 HIS 154 210 ? ? ? E . n E 1 155 HIS 155 211 ? ? ? E . n E 1 156 HIS 156 212 ? ? ? E . n E 1 157 HIS 157 213 ? ? ? E . n F 1 1 MET 1 57 ? ? ? F . n F 1 2 SER 2 58 ? ? ? F . n F 1 3 ASN 3 59 59 ASN ASN F . n F 1 4 GLU 4 60 60 GLU GLU F . n F 1 5 THR 5 61 61 THR THR F . n F 1 6 ILE 6 62 62 ILE ILE F . n F 1 7 VAL 7 63 63 VAL VAL F . n F 1 8 ILE 8 64 64 ILE ILE F . n F 1 9 ASP 9 65 65 ASP ASP F . n F 1 10 ILE 10 66 66 ILE ILE F . n F 1 11 LYS 11 67 67 LYS LYS F . n F 1 12 GLY 12 68 68 GLY GLY F . n F 1 13 ALA 13 69 69 ALA ALA F . n F 1 14 VAL 14 70 70 VAL VAL F . n F 1 15 GLN 15 71 71 GLN GLN F . n F 1 16 HIS 16 72 72 HIS HIS F . n F 1 17 PRO 17 73 73 PRO PRO F . n F 1 18 GLY 18 74 74 GLY GLY F . n F 1 19 VAL 19 75 75 VAL VAL F . n F 1 20 TYR 20 76 76 TYR TYR F . n F 1 21 GLU 21 77 77 GLU GLU F . n F 1 22 MET 22 78 78 MET MET F . n F 1 23 ARG 23 79 79 ARG ARG F . n F 1 24 THR 24 80 80 THR THR F . n F 1 25 GLY 25 81 81 GLY GLY F . n F 1 26 ASP 26 82 82 ASP ASP F . n F 1 27 ARG 27 83 83 ARG ARG F . n F 1 28 VAL 28 84 84 VAL VAL F . n F 1 29 SER 29 85 85 SER SER F . n F 1 30 GLN 30 86 86 GLN GLN F . n F 1 31 ALA 31 87 87 ALA ALA F . n F 1 32 ILE 32 88 88 ILE ILE F . n F 1 33 GLU 33 89 89 GLU GLU F . n F 1 34 LYS 34 90 90 LYS LYS F . n F 1 35 ALA 35 91 91 ALA ALA F . n F 1 36 GLY 36 92 92 GLY GLY F . n F 1 37 GLY 37 93 93 GLY GLY F . n F 1 38 THR 38 94 94 THR THR F . n F 1 39 SER 39 95 95 SER SER F . n F 1 40 GLU 40 96 96 GLU GLU F . n F 1 41 GLN 41 97 97 GLN GLN F . n F 1 42 ALA 42 98 98 ALA ALA F . n F 1 43 ASP 43 99 99 ASP ASP F . n F 1 44 GLU 44 100 100 GLU GLU F . n F 1 45 ALA 45 101 101 ALA ALA F . n F 1 46 GLN 46 102 102 GLN GLN F . n F 1 47 VAL 47 103 103 VAL VAL F . n F 1 48 ASN 48 104 104 ASN ASN F . n F 1 49 LEU 49 105 105 LEU LEU F . n F 1 50 ALA 50 106 106 ALA ALA F . n F 1 51 GLU 51 107 107 GLU GLU F . n F 1 52 ILE 52 108 108 ILE ILE F . n F 1 53 LEU 53 109 109 LEU LEU F . n F 1 54 GLN 54 110 110 GLN GLN F . n F 1 55 ASP 55 111 111 ASP ASP F . n F 1 56 GLY 56 112 112 GLY GLY F . n F 1 57 THR 57 113 113 THR THR F . n F 1 58 VAL 58 114 114 VAL VAL F . n F 1 59 VAL 59 115 115 VAL VAL F . n F 1 60 TYR 60 116 116 TYR TYR F . n F 1 61 ILE 61 117 117 ILE ILE F . n F 1 62 PRO 62 118 118 PRO PRO F . n F 1 63 LYS 63 119 119 LYS LYS F . n F 1 64 LYS 64 120 120 LYS LYS F . n F 1 65 GLY 65 121 121 GLY GLY F . n F 1 66 GLU 66 122 122 GLU GLU F . n F 1 67 GLU 67 123 ? ? ? F . n F 1 68 THR 68 124 ? ? ? F . n F 1 69 ALA 69 125 ? ? ? F . n F 1 70 VAL 70 126 ? ? ? F . n F 1 71 GLN 71 127 ? ? ? F . n F 1 72 GLN 72 128 ? ? ? F . n F 1 73 GLY 73 129 ? ? ? F . n F 1 74 GLY 74 130 ? ? ? F . n F 1 75 GLY 75 131 ? ? ? F . n F 1 76 GLY 76 132 ? ? ? F . n F 1 77 SER 77 133 ? ? ? F . n F 1 78 VAL 78 134 ? ? ? F . n F 1 79 GLN 79 135 ? ? ? F . n F 1 80 SER 80 136 ? ? ? F . n F 1 81 ASP 81 137 ? ? ? F . n F 1 82 GLY 82 138 ? ? ? F . n F 1 83 GLY 83 139 ? ? ? F . n F 1 84 LYS 84 140 ? ? ? F . n F 1 85 GLY 85 141 ? ? ? F . n F 1 86 ALA 86 142 ? ? ? F . n F 1 87 LEU 87 143 ? ? ? F . n F 1 88 VAL 88 144 ? ? ? F . n F 1 89 ASN 89 145 ? ? ? F . n F 1 90 ILE 90 146 ? ? ? F . n F 1 91 ASN 91 147 ? ? ? F . n F 1 92 THR 92 148 ? ? ? F . n F 1 93 ALA 93 149 ? ? ? F . n F 1 94 THR 94 150 ? ? ? F . n F 1 95 LEU 95 151 ? ? ? F . n F 1 96 GLU 96 152 ? ? ? F . n F 1 97 GLU 97 153 ? ? ? F . n F 1 98 LEU 98 154 ? ? ? F . n F 1 99 GLN 99 155 ? ? ? F . n F 1 100 GLY 100 156 ? ? ? F . n F 1 101 ILE 101 157 ? ? ? F . n F 1 102 SER 102 158 ? ? ? F . n F 1 103 GLY 103 159 ? ? ? F . n F 1 104 VAL 104 160 ? ? ? F . n F 1 105 GLY 105 161 ? ? ? F . n F 1 106 PRO 106 162 ? ? ? F . n F 1 107 SER 107 163 ? ? ? F . n F 1 108 LYS 108 164 ? ? ? F . n F 1 109 ALA 109 165 ? ? ? F . n F 1 110 GLU 110 166 ? ? ? F . n F 1 111 ALA 111 167 ? ? ? F . n F 1 112 ILE 112 168 ? ? ? F . n F 1 113 ILE 113 169 ? ? ? F . n F 1 114 ALA 114 170 ? ? ? F . n F 1 115 TYR 115 171 ? ? ? F . n F 1 116 ARG 116 172 ? ? ? F . n F 1 117 GLU 117 173 ? ? ? F . n F 1 118 GLU 118 174 ? ? ? F . n F 1 119 ASN 119 175 ? ? ? F . n F 1 120 GLY 120 176 ? ? ? F . n F 1 121 ARG 121 177 ? ? ? F . n F 1 122 PHE 122 178 ? ? ? F . n F 1 123 GLN 123 179 ? ? ? F . n F 1 124 THR 124 180 ? ? ? F . n F 1 125 ILE 125 181 ? ? ? F . n F 1 126 GLU 126 182 ? ? ? F . n F 1 127 ASP 127 183 ? ? ? F . n F 1 128 ILE 128 184 ? ? ? F . n F 1 129 THR 129 185 ? ? ? F . n F 1 130 LYS 130 186 ? ? ? F . n F 1 131 VAL 131 187 ? ? ? F . n F 1 132 SER 132 188 ? ? ? F . n F 1 133 GLY 133 189 ? ? ? F . n F 1 134 ILE 134 190 ? ? ? F . n F 1 135 GLY 135 191 ? ? ? F . n F 1 136 GLU 136 192 ? ? ? F . n F 1 137 LYS 137 193 ? ? ? F . n F 1 138 SER 138 194 ? ? ? F . n F 1 139 PHE 139 195 ? ? ? F . n F 1 140 GLU 140 196 ? ? ? F . n F 1 141 LYS 141 197 ? ? ? F . n F 1 142 ILE 142 198 ? ? ? F . n F 1 143 LYS 143 199 ? ? ? F . n F 1 144 SER 144 200 ? ? ? F . n F 1 145 SER 145 201 ? ? ? F . n F 1 146 ILE 146 202 ? ? ? F . n F 1 147 THR 147 203 ? ? ? F . n F 1 148 VAL 148 204 ? ? ? F . n F 1 149 LYS 149 205 ? ? ? F . n F 1 150 LEU 150 206 ? ? ? F . n F 1 151 GLU 151 207 ? ? ? F . n F 1 152 HIS 152 208 ? ? ? F . n F 1 153 HIS 153 209 ? ? ? F . n F 1 154 HIS 154 210 ? ? ? F . n F 1 155 HIS 155 211 ? ? ? F . n F 1 156 HIS 156 212 ? ? ? F . n F 1 157 HIS 157 213 ? ? ? F . n G 1 1 MET 1 57 ? ? ? G . n G 1 2 SER 2 58 ? ? ? G . n G 1 3 ASN 3 59 ? ? ? G . n G 1 4 GLU 4 60 60 GLU GLU G . n G 1 5 THR 5 61 61 THR THR G . n G 1 6 ILE 6 62 62 ILE ILE G . n G 1 7 VAL 7 63 63 VAL VAL G . n G 1 8 ILE 8 64 64 ILE ILE G . n G 1 9 ASP 9 65 65 ASP ASP G . n G 1 10 ILE 10 66 66 ILE ILE G . n G 1 11 LYS 11 67 67 LYS LYS G . n G 1 12 GLY 12 68 68 GLY GLY G . n G 1 13 ALA 13 69 69 ALA ALA G . n G 1 14 VAL 14 70 70 VAL VAL G . n G 1 15 GLN 15 71 71 GLN GLN G . n G 1 16 HIS 16 72 72 HIS HIS G . n G 1 17 PRO 17 73 73 PRO PRO G . n G 1 18 GLY 18 74 74 GLY GLY G . n G 1 19 VAL 19 75 75 VAL VAL G . n G 1 20 TYR 20 76 76 TYR TYR G . n G 1 21 GLU 21 77 77 GLU GLU G . n G 1 22 MET 22 78 78 MET MET G . n G 1 23 ARG 23 79 79 ARG ARG G . n G 1 24 THR 24 80 80 THR THR G . n G 1 25 GLY 25 81 81 GLY GLY G . n G 1 26 ASP 26 82 82 ASP ASP G . n G 1 27 ARG 27 83 83 ARG ARG G . n G 1 28 VAL 28 84 84 VAL VAL G . n G 1 29 SER 29 85 85 SER SER G . n G 1 30 GLN 30 86 86 GLN GLN G . n G 1 31 ALA 31 87 87 ALA ALA G . n G 1 32 ILE 32 88 88 ILE ILE G . n G 1 33 GLU 33 89 89 GLU GLU G . n G 1 34 LYS 34 90 90 LYS LYS G . n G 1 35 ALA 35 91 91 ALA ALA G . n G 1 36 GLY 36 92 92 GLY GLY G . n G 1 37 GLY 37 93 93 GLY GLY G . n G 1 38 THR 38 94 94 THR THR G . n G 1 39 SER 39 95 95 SER SER G . n G 1 40 GLU 40 96 96 GLU GLU G . n G 1 41 GLN 41 97 97 GLN GLN G . n G 1 42 ALA 42 98 98 ALA ALA G . n G 1 43 ASP 43 99 99 ASP ASP G . n G 1 44 GLU 44 100 100 GLU GLU G . n G 1 45 ALA 45 101 101 ALA ALA G . n G 1 46 GLN 46 102 102 GLN GLN G . n G 1 47 VAL 47 103 103 VAL VAL G . n G 1 48 ASN 48 104 104 ASN ASN G . n G 1 49 LEU 49 105 105 LEU LEU G . n G 1 50 ALA 50 106 106 ALA ALA G . n G 1 51 GLU 51 107 107 GLU GLU G . n G 1 52 ILE 52 108 108 ILE ILE G . n G 1 53 LEU 53 109 109 LEU LEU G . n G 1 54 GLN 54 110 110 GLN GLN G . n G 1 55 ASP 55 111 111 ASP ASP G . n G 1 56 GLY 56 112 112 GLY GLY G . n G 1 57 THR 57 113 113 THR THR G . n G 1 58 VAL 58 114 114 VAL VAL G . n G 1 59 VAL 59 115 115 VAL VAL G . n G 1 60 TYR 60 116 116 TYR TYR G . n G 1 61 ILE 61 117 117 ILE ILE G . n G 1 62 PRO 62 118 118 PRO PRO G . n G 1 63 LYS 63 119 119 LYS LYS G . n G 1 64 LYS 64 120 120 LYS LYS G . n G 1 65 GLY 65 121 121 GLY GLY G . n G 1 66 GLU 66 122 122 GLU GLU G . n G 1 67 GLU 67 123 ? ? ? G . n G 1 68 THR 68 124 ? ? ? G . n G 1 69 ALA 69 125 ? ? ? G . n G 1 70 VAL 70 126 ? ? ? G . n G 1 71 GLN 71 127 ? ? ? G . n G 1 72 GLN 72 128 ? ? ? G . n G 1 73 GLY 73 129 ? ? ? G . n G 1 74 GLY 74 130 ? ? ? G . n G 1 75 GLY 75 131 ? ? ? G . n G 1 76 GLY 76 132 ? ? ? G . n G 1 77 SER 77 133 ? ? ? G . n G 1 78 VAL 78 134 ? ? ? G . n G 1 79 GLN 79 135 ? ? ? G . n G 1 80 SER 80 136 ? ? ? G . n G 1 81 ASP 81 137 ? ? ? G . n G 1 82 GLY 82 138 ? ? ? G . n G 1 83 GLY 83 139 ? ? ? G . n G 1 84 LYS 84 140 ? ? ? G . n G 1 85 GLY 85 141 ? ? ? G . n G 1 86 ALA 86 142 ? ? ? G . n G 1 87 LEU 87 143 ? ? ? G . n G 1 88 VAL 88 144 ? ? ? G . n G 1 89 ASN 89 145 ? ? ? G . n G 1 90 ILE 90 146 ? ? ? G . n G 1 91 ASN 91 147 ? ? ? G . n G 1 92 THR 92 148 ? ? ? G . n G 1 93 ALA 93 149 ? ? ? G . n G 1 94 THR 94 150 ? ? ? G . n G 1 95 LEU 95 151 ? ? ? G . n G 1 96 GLU 96 152 ? ? ? G . n G 1 97 GLU 97 153 ? ? ? G . n G 1 98 LEU 98 154 ? ? ? G . n G 1 99 GLN 99 155 ? ? ? G . n G 1 100 GLY 100 156 ? ? ? G . n G 1 101 ILE 101 157 ? ? ? G . n G 1 102 SER 102 158 ? ? ? G . n G 1 103 GLY 103 159 ? ? ? G . n G 1 104 VAL 104 160 ? ? ? G . n G 1 105 GLY 105 161 ? ? ? G . n G 1 106 PRO 106 162 ? ? ? G . n G 1 107 SER 107 163 ? ? ? G . n G 1 108 LYS 108 164 ? ? ? G . n G 1 109 ALA 109 165 ? ? ? G . n G 1 110 GLU 110 166 ? ? ? G . n G 1 111 ALA 111 167 ? ? ? G . n G 1 112 ILE 112 168 ? ? ? G . n G 1 113 ILE 113 169 ? ? ? G . n G 1 114 ALA 114 170 ? ? ? G . n G 1 115 TYR 115 171 ? ? ? G . n G 1 116 ARG 116 172 ? ? ? G . n G 1 117 GLU 117 173 ? ? ? G . n G 1 118 GLU 118 174 ? ? ? G . n G 1 119 ASN 119 175 ? ? ? G . n G 1 120 GLY 120 176 ? ? ? G . n G 1 121 ARG 121 177 ? ? ? G . n G 1 122 PHE 122 178 ? ? ? G . n G 1 123 GLN 123 179 ? ? ? G . n G 1 124 THR 124 180 ? ? ? G . n G 1 125 ILE 125 181 ? ? ? G . n G 1 126 GLU 126 182 ? ? ? G . n G 1 127 ASP 127 183 ? ? ? G . n G 1 128 ILE 128 184 ? ? ? G . n G 1 129 THR 129 185 ? ? ? G . n G 1 130 LYS 130 186 ? ? ? G . n G 1 131 VAL 131 187 ? ? ? G . n G 1 132 SER 132 188 ? ? ? G . n G 1 133 GLY 133 189 ? ? ? G . n G 1 134 ILE 134 190 ? ? ? G . n G 1 135 GLY 135 191 ? ? ? G . n G 1 136 GLU 136 192 ? ? ? G . n G 1 137 LYS 137 193 ? ? ? G . n G 1 138 SER 138 194 ? ? ? G . n G 1 139 PHE 139 195 ? ? ? G . n G 1 140 GLU 140 196 ? ? ? G . n G 1 141 LYS 141 197 ? ? ? G . n G 1 142 ILE 142 198 ? ? ? G . n G 1 143 LYS 143 199 ? ? ? G . n G 1 144 SER 144 200 ? ? ? G . n G 1 145 SER 145 201 ? ? ? G . n G 1 146 ILE 146 202 ? ? ? G . n G 1 147 THR 147 203 ? ? ? G . n G 1 148 VAL 148 204 ? ? ? G . n G 1 149 LYS 149 205 ? ? ? G . n G 1 150 LEU 150 206 ? ? ? G . n G 1 151 GLU 151 207 ? ? ? G . n G 1 152 HIS 152 208 ? ? ? G . n G 1 153 HIS 153 209 ? ? ? G . n G 1 154 HIS 154 210 ? ? ? G . n G 1 155 HIS 155 211 ? ? ? G . n G 1 156 HIS 156 212 ? ? ? G . n G 1 157 HIS 157 213 ? ? ? G . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email matthew.neiditch@rutgers.edu _pdbx_contact_author.name_first Matthew _pdbx_contact_author.name_last Neiditch _pdbx_contact_author.name_mi B _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7039-4469 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? dimeric 2 2 author_defined_assembly ? dimeric 2 3 author_defined_assembly ? dimeric 2 4 author_defined_assembly ? dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1 C,D 3 1 E,F 4 1 F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2022-12-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z 4 -x,-y,z 5 x+1/2,y+1/2,z+1/2 6 x+1/2,-y+1/2,-z+1/2 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 H _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 LEU _pdbx_validate_close_contact.auth_seq_id_1 105 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OD2 _pdbx_validate_close_contact.auth_asym_id_2 C _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 65 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU D 60 ? ? -116.82 56.95 2 1 GLU E 60 ? ? -109.18 55.12 3 1 GLU G 96 ? ? -68.93 0.65 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 57 ? A MET 1 2 1 Y 1 A SER 58 ? A SER 2 3 1 Y 1 A GLU 123 ? A GLU 67 4 1 Y 1 A THR 124 ? A THR 68 5 1 Y 1 A ALA 125 ? A ALA 69 6 1 Y 1 A VAL 126 ? A VAL 70 7 1 Y 1 A GLN 127 ? A GLN 71 8 1 Y 1 A GLN 128 ? A GLN 72 9 1 Y 1 A GLY 129 ? A GLY 73 10 1 Y 1 A GLY 130 ? A GLY 74 11 1 Y 1 A GLY 131 ? A GLY 75 12 1 Y 1 A GLY 132 ? A GLY 76 13 1 Y 1 A SER 133 ? A SER 77 14 1 Y 1 A VAL 134 ? A VAL 78 15 1 Y 1 A GLN 135 ? A GLN 79 16 1 Y 1 A SER 136 ? A SER 80 17 1 Y 1 A ASP 137 ? A ASP 81 18 1 Y 1 A GLY 138 ? A GLY 82 19 1 Y 1 A GLY 139 ? A GLY 83 20 1 Y 1 A LYS 140 ? A LYS 84 21 1 Y 1 A GLY 141 ? A GLY 85 22 1 Y 1 A ALA 142 ? A ALA 86 23 1 Y 1 A LEU 143 ? A LEU 87 24 1 Y 1 A VAL 144 ? A VAL 88 25 1 Y 1 A ASN 145 ? A ASN 89 26 1 Y 1 A ILE 146 ? A ILE 90 27 1 Y 1 A ASN 147 ? A ASN 91 28 1 Y 1 A THR 148 ? A THR 92 29 1 Y 1 A ALA 149 ? A ALA 93 30 1 Y 1 A THR 150 ? A THR 94 31 1 Y 1 A LEU 151 ? A LEU 95 32 1 Y 1 A GLU 152 ? A GLU 96 33 1 Y 1 A GLU 153 ? A GLU 97 34 1 Y 1 A LEU 154 ? A LEU 98 35 1 Y 1 A GLN 155 ? A GLN 99 36 1 Y 1 A GLY 156 ? A GLY 100 37 1 Y 1 A ILE 157 ? A ILE 101 38 1 Y 1 A SER 158 ? A SER 102 39 1 Y 1 A GLY 159 ? A GLY 103 40 1 Y 1 A VAL 160 ? A VAL 104 41 1 Y 1 A GLY 161 ? A GLY 105 42 1 Y 1 A PRO 162 ? A PRO 106 43 1 Y 1 A SER 163 ? A SER 107 44 1 Y 1 A LYS 164 ? A LYS 108 45 1 Y 1 A ALA 165 ? A ALA 109 46 1 Y 1 A GLU 166 ? A GLU 110 47 1 Y 1 A ALA 167 ? A ALA 111 48 1 Y 1 A ILE 168 ? A ILE 112 49 1 Y 1 A ILE 169 ? A ILE 113 50 1 Y 1 A ALA 170 ? A ALA 114 51 1 Y 1 A TYR 171 ? A TYR 115 52 1 Y 1 A ARG 172 ? A ARG 116 53 1 Y 1 A GLU 173 ? A GLU 117 54 1 Y 1 A GLU 174 ? A GLU 118 55 1 Y 1 A ASN 175 ? A ASN 119 56 1 Y 1 A GLY 176 ? A GLY 120 57 1 Y 1 A ARG 177 ? A ARG 121 58 1 Y 1 A PHE 178 ? A PHE 122 59 1 Y 1 A GLN 179 ? A GLN 123 60 1 Y 1 A THR 180 ? A THR 124 61 1 Y 1 A ILE 181 ? A ILE 125 62 1 Y 1 A GLU 182 ? A GLU 126 63 1 Y 1 A ASP 183 ? A ASP 127 64 1 Y 1 A ILE 184 ? A ILE 128 65 1 Y 1 A THR 185 ? A THR 129 66 1 Y 1 A LYS 186 ? A LYS 130 67 1 Y 1 A VAL 187 ? A VAL 131 68 1 Y 1 A SER 188 ? A SER 132 69 1 Y 1 A GLY 189 ? A GLY 133 70 1 Y 1 A ILE 190 ? A ILE 134 71 1 Y 1 A GLY 191 ? A GLY 135 72 1 Y 1 A GLU 192 ? A GLU 136 73 1 Y 1 A LYS 193 ? A LYS 137 74 1 Y 1 A SER 194 ? A SER 138 75 1 Y 1 A PHE 195 ? A PHE 139 76 1 Y 1 A GLU 196 ? A GLU 140 77 1 Y 1 A LYS 197 ? A LYS 141 78 1 Y 1 A ILE 198 ? A ILE 142 79 1 Y 1 A LYS 199 ? A LYS 143 80 1 Y 1 A SER 200 ? A SER 144 81 1 Y 1 A SER 201 ? A SER 145 82 1 Y 1 A ILE 202 ? A ILE 146 83 1 Y 1 A THR 203 ? A THR 147 84 1 Y 1 A VAL 204 ? A VAL 148 85 1 Y 1 A LYS 205 ? A LYS 149 86 1 Y 1 A LEU 206 ? A LEU 150 87 1 Y 1 A GLU 207 ? A GLU 151 88 1 Y 1 A HIS 208 ? A HIS 152 89 1 Y 1 A HIS 209 ? A HIS 153 90 1 Y 1 A HIS 210 ? A HIS 154 91 1 Y 1 A HIS 211 ? A HIS 155 92 1 Y 1 A HIS 212 ? A HIS 156 93 1 Y 1 A HIS 213 ? A HIS 157 94 1 Y 1 B MET 57 ? B MET 1 95 1 Y 1 B SER 58 ? B SER 2 96 1 Y 1 B GLU 123 ? B GLU 67 97 1 Y 1 B THR 124 ? B THR 68 98 1 Y 1 B ALA 125 ? B ALA 69 99 1 Y 1 B VAL 126 ? B VAL 70 100 1 Y 1 B GLN 127 ? B GLN 71 101 1 Y 1 B GLN 128 ? B GLN 72 102 1 Y 1 B GLY 129 ? B GLY 73 103 1 Y 1 B GLY 130 ? B GLY 74 104 1 Y 1 B GLY 131 ? B GLY 75 105 1 Y 1 B GLY 132 ? B GLY 76 106 1 Y 1 B SER 133 ? B SER 77 107 1 Y 1 B VAL 134 ? B VAL 78 108 1 Y 1 B GLN 135 ? B GLN 79 109 1 Y 1 B SER 136 ? B SER 80 110 1 Y 1 B ASP 137 ? B ASP 81 111 1 Y 1 B GLY 138 ? B GLY 82 112 1 Y 1 B GLY 139 ? B GLY 83 113 1 Y 1 B LYS 140 ? B LYS 84 114 1 Y 1 B GLY 141 ? B GLY 85 115 1 Y 1 B ALA 142 ? B ALA 86 116 1 Y 1 B LEU 143 ? B LEU 87 117 1 Y 1 B VAL 144 ? B VAL 88 118 1 Y 1 B ASN 145 ? B ASN 89 119 1 Y 1 B ILE 146 ? B ILE 90 120 1 Y 1 B ASN 147 ? B ASN 91 121 1 Y 1 B THR 148 ? B THR 92 122 1 Y 1 B ALA 149 ? B ALA 93 123 1 Y 1 B THR 150 ? B THR 94 124 1 Y 1 B LEU 151 ? B LEU 95 125 1 Y 1 B GLU 152 ? B GLU 96 126 1 Y 1 B GLU 153 ? B GLU 97 127 1 Y 1 B LEU 154 ? B LEU 98 128 1 Y 1 B GLN 155 ? B GLN 99 129 1 Y 1 B GLY 156 ? B GLY 100 130 1 Y 1 B ILE 157 ? B ILE 101 131 1 Y 1 B SER 158 ? B SER 102 132 1 Y 1 B GLY 159 ? B GLY 103 133 1 Y 1 B VAL 160 ? B VAL 104 134 1 Y 1 B GLY 161 ? B GLY 105 135 1 Y 1 B PRO 162 ? B PRO 106 136 1 Y 1 B SER 163 ? B SER 107 137 1 Y 1 B LYS 164 ? B LYS 108 138 1 Y 1 B ALA 165 ? B ALA 109 139 1 Y 1 B GLU 166 ? B GLU 110 140 1 Y 1 B ALA 167 ? B ALA 111 141 1 Y 1 B ILE 168 ? B ILE 112 142 1 Y 1 B ILE 169 ? B ILE 113 143 1 Y 1 B ALA 170 ? B ALA 114 144 1 Y 1 B TYR 171 ? B TYR 115 145 1 Y 1 B ARG 172 ? B ARG 116 146 1 Y 1 B GLU 173 ? B GLU 117 147 1 Y 1 B GLU 174 ? B GLU 118 148 1 Y 1 B ASN 175 ? B ASN 119 149 1 Y 1 B GLY 176 ? B GLY 120 150 1 Y 1 B ARG 177 ? B ARG 121 151 1 Y 1 B PHE 178 ? B PHE 122 152 1 Y 1 B GLN 179 ? B GLN 123 153 1 Y 1 B THR 180 ? B THR 124 154 1 Y 1 B ILE 181 ? B ILE 125 155 1 Y 1 B GLU 182 ? B GLU 126 156 1 Y 1 B ASP 183 ? B ASP 127 157 1 Y 1 B ILE 184 ? B ILE 128 158 1 Y 1 B THR 185 ? B THR 129 159 1 Y 1 B LYS 186 ? B LYS 130 160 1 Y 1 B VAL 187 ? B VAL 131 161 1 Y 1 B SER 188 ? B SER 132 162 1 Y 1 B GLY 189 ? B GLY 133 163 1 Y 1 B ILE 190 ? B ILE 134 164 1 Y 1 B GLY 191 ? B GLY 135 165 1 Y 1 B GLU 192 ? B GLU 136 166 1 Y 1 B LYS 193 ? B LYS 137 167 1 Y 1 B SER 194 ? B SER 138 168 1 Y 1 B PHE 195 ? B PHE 139 169 1 Y 1 B GLU 196 ? B GLU 140 170 1 Y 1 B LYS 197 ? B LYS 141 171 1 Y 1 B ILE 198 ? B ILE 142 172 1 Y 1 B LYS 199 ? B LYS 143 173 1 Y 1 B SER 200 ? B SER 144 174 1 Y 1 B SER 201 ? B SER 145 175 1 Y 1 B ILE 202 ? B ILE 146 176 1 Y 1 B THR 203 ? B THR 147 177 1 Y 1 B VAL 204 ? B VAL 148 178 1 Y 1 B LYS 205 ? B LYS 149 179 1 Y 1 B LEU 206 ? B LEU 150 180 1 Y 1 B GLU 207 ? B GLU 151 181 1 Y 1 B HIS 208 ? B HIS 152 182 1 Y 1 B HIS 209 ? B HIS 153 183 1 Y 1 B HIS 210 ? B HIS 154 184 1 Y 1 B HIS 211 ? B HIS 155 185 1 Y 1 B HIS 212 ? B HIS 156 186 1 Y 1 B HIS 213 ? B HIS 157 187 1 Y 1 C MET 57 ? C MET 1 188 1 Y 1 C SER 58 ? C SER 2 189 1 Y 1 C GLU 123 ? C GLU 67 190 1 Y 1 C THR 124 ? C THR 68 191 1 Y 1 C ALA 125 ? C ALA 69 192 1 Y 1 C VAL 126 ? C VAL 70 193 1 Y 1 C GLN 127 ? C GLN 71 194 1 Y 1 C GLN 128 ? C GLN 72 195 1 Y 1 C GLY 129 ? C GLY 73 196 1 Y 1 C GLY 130 ? C GLY 74 197 1 Y 1 C GLY 131 ? C GLY 75 198 1 Y 1 C GLY 132 ? C GLY 76 199 1 Y 1 C SER 133 ? C SER 77 200 1 Y 1 C VAL 134 ? C VAL 78 201 1 Y 1 C GLN 135 ? C GLN 79 202 1 Y 1 C SER 136 ? C SER 80 203 1 Y 1 C ASP 137 ? C ASP 81 204 1 Y 1 C GLY 138 ? C GLY 82 205 1 Y 1 C GLY 139 ? C GLY 83 206 1 Y 1 C LYS 140 ? C LYS 84 207 1 Y 1 C GLY 141 ? C GLY 85 208 1 Y 1 C ALA 142 ? C ALA 86 209 1 Y 1 C LEU 143 ? C LEU 87 210 1 Y 1 C VAL 144 ? C VAL 88 211 1 Y 1 C ASN 145 ? C ASN 89 212 1 Y 1 C ILE 146 ? C ILE 90 213 1 Y 1 C ASN 147 ? C ASN 91 214 1 Y 1 C THR 148 ? C THR 92 215 1 Y 1 C ALA 149 ? C ALA 93 216 1 Y 1 C THR 150 ? C THR 94 217 1 Y 1 C LEU 151 ? C LEU 95 218 1 Y 1 C GLU 152 ? C GLU 96 219 1 Y 1 C GLU 153 ? C GLU 97 220 1 Y 1 C LEU 154 ? C LEU 98 221 1 Y 1 C GLN 155 ? C GLN 99 222 1 Y 1 C GLY 156 ? C GLY 100 223 1 Y 1 C ILE 157 ? C ILE 101 224 1 Y 1 C SER 158 ? C SER 102 225 1 Y 1 C GLY 159 ? C GLY 103 226 1 Y 1 C VAL 160 ? C VAL 104 227 1 Y 1 C GLY 161 ? C GLY 105 228 1 Y 1 C PRO 162 ? C PRO 106 229 1 Y 1 C SER 163 ? C SER 107 230 1 Y 1 C LYS 164 ? C LYS 108 231 1 Y 1 C ALA 165 ? C ALA 109 232 1 Y 1 C GLU 166 ? C GLU 110 233 1 Y 1 C ALA 167 ? C ALA 111 234 1 Y 1 C ILE 168 ? C ILE 112 235 1 Y 1 C ILE 169 ? C ILE 113 236 1 Y 1 C ALA 170 ? C ALA 114 237 1 Y 1 C TYR 171 ? C TYR 115 238 1 Y 1 C ARG 172 ? C ARG 116 239 1 Y 1 C GLU 173 ? C GLU 117 240 1 Y 1 C GLU 174 ? C GLU 118 241 1 Y 1 C ASN 175 ? C ASN 119 242 1 Y 1 C GLY 176 ? C GLY 120 243 1 Y 1 C ARG 177 ? C ARG 121 244 1 Y 1 C PHE 178 ? C PHE 122 245 1 Y 1 C GLN 179 ? C GLN 123 246 1 Y 1 C THR 180 ? C THR 124 247 1 Y 1 C ILE 181 ? C ILE 125 248 1 Y 1 C GLU 182 ? C GLU 126 249 1 Y 1 C ASP 183 ? C ASP 127 250 1 Y 1 C ILE 184 ? C ILE 128 251 1 Y 1 C THR 185 ? C THR 129 252 1 Y 1 C LYS 186 ? C LYS 130 253 1 Y 1 C VAL 187 ? C VAL 131 254 1 Y 1 C SER 188 ? C SER 132 255 1 Y 1 C GLY 189 ? C GLY 133 256 1 Y 1 C ILE 190 ? C ILE 134 257 1 Y 1 C GLY 191 ? C GLY 135 258 1 Y 1 C GLU 192 ? C GLU 136 259 1 Y 1 C LYS 193 ? C LYS 137 260 1 Y 1 C SER 194 ? C SER 138 261 1 Y 1 C PHE 195 ? C PHE 139 262 1 Y 1 C GLU 196 ? C GLU 140 263 1 Y 1 C LYS 197 ? C LYS 141 264 1 Y 1 C ILE 198 ? C ILE 142 265 1 Y 1 C LYS 199 ? C LYS 143 266 1 Y 1 C SER 200 ? C SER 144 267 1 Y 1 C SER 201 ? C SER 145 268 1 Y 1 C ILE 202 ? C ILE 146 269 1 Y 1 C THR 203 ? C THR 147 270 1 Y 1 C VAL 204 ? C VAL 148 271 1 Y 1 C LYS 205 ? C LYS 149 272 1 Y 1 C LEU 206 ? C LEU 150 273 1 Y 1 C GLU 207 ? C GLU 151 274 1 Y 1 C HIS 208 ? C HIS 152 275 1 Y 1 C HIS 209 ? C HIS 153 276 1 Y 1 C HIS 210 ? C HIS 154 277 1 Y 1 C HIS 211 ? C HIS 155 278 1 Y 1 C HIS 212 ? C HIS 156 279 1 Y 1 C HIS 213 ? C HIS 157 280 1 Y 1 D MET 57 ? D MET 1 281 1 Y 1 D SER 58 ? D SER 2 282 1 Y 1 D GLU 123 ? D GLU 67 283 1 Y 1 D THR 124 ? D THR 68 284 1 Y 1 D ALA 125 ? D ALA 69 285 1 Y 1 D VAL 126 ? D VAL 70 286 1 Y 1 D GLN 127 ? D GLN 71 287 1 Y 1 D GLN 128 ? D GLN 72 288 1 Y 1 D GLY 129 ? D GLY 73 289 1 Y 1 D GLY 130 ? D GLY 74 290 1 Y 1 D GLY 131 ? D GLY 75 291 1 Y 1 D GLY 132 ? D GLY 76 292 1 Y 1 D SER 133 ? D SER 77 293 1 Y 1 D VAL 134 ? D VAL 78 294 1 Y 1 D GLN 135 ? D GLN 79 295 1 Y 1 D SER 136 ? D SER 80 296 1 Y 1 D ASP 137 ? D ASP 81 297 1 Y 1 D GLY 138 ? D GLY 82 298 1 Y 1 D GLY 139 ? D GLY 83 299 1 Y 1 D LYS 140 ? D LYS 84 300 1 Y 1 D GLY 141 ? D GLY 85 301 1 Y 1 D ALA 142 ? D ALA 86 302 1 Y 1 D LEU 143 ? D LEU 87 303 1 Y 1 D VAL 144 ? D VAL 88 304 1 Y 1 D ASN 145 ? D ASN 89 305 1 Y 1 D ILE 146 ? D ILE 90 306 1 Y 1 D ASN 147 ? D ASN 91 307 1 Y 1 D THR 148 ? D THR 92 308 1 Y 1 D ALA 149 ? D ALA 93 309 1 Y 1 D THR 150 ? D THR 94 310 1 Y 1 D LEU 151 ? D LEU 95 311 1 Y 1 D GLU 152 ? D GLU 96 312 1 Y 1 D GLU 153 ? D GLU 97 313 1 Y 1 D LEU 154 ? D LEU 98 314 1 Y 1 D GLN 155 ? D GLN 99 315 1 Y 1 D GLY 156 ? D GLY 100 316 1 Y 1 D ILE 157 ? D ILE 101 317 1 Y 1 D SER 158 ? D SER 102 318 1 Y 1 D GLY 159 ? D GLY 103 319 1 Y 1 D VAL 160 ? D VAL 104 320 1 Y 1 D GLY 161 ? D GLY 105 321 1 Y 1 D PRO 162 ? D PRO 106 322 1 Y 1 D SER 163 ? D SER 107 323 1 Y 1 D LYS 164 ? D LYS 108 324 1 Y 1 D ALA 165 ? D ALA 109 325 1 Y 1 D GLU 166 ? D GLU 110 326 1 Y 1 D ALA 167 ? D ALA 111 327 1 Y 1 D ILE 168 ? D ILE 112 328 1 Y 1 D ILE 169 ? D ILE 113 329 1 Y 1 D ALA 170 ? D ALA 114 330 1 Y 1 D TYR 171 ? D TYR 115 331 1 Y 1 D ARG 172 ? D ARG 116 332 1 Y 1 D GLU 173 ? D GLU 117 333 1 Y 1 D GLU 174 ? D GLU 118 334 1 Y 1 D ASN 175 ? D ASN 119 335 1 Y 1 D GLY 176 ? D GLY 120 336 1 Y 1 D ARG 177 ? D ARG 121 337 1 Y 1 D PHE 178 ? D PHE 122 338 1 Y 1 D GLN 179 ? D GLN 123 339 1 Y 1 D THR 180 ? D THR 124 340 1 Y 1 D ILE 181 ? D ILE 125 341 1 Y 1 D GLU 182 ? D GLU 126 342 1 Y 1 D ASP 183 ? D ASP 127 343 1 Y 1 D ILE 184 ? D ILE 128 344 1 Y 1 D THR 185 ? D THR 129 345 1 Y 1 D LYS 186 ? D LYS 130 346 1 Y 1 D VAL 187 ? D VAL 131 347 1 Y 1 D SER 188 ? D SER 132 348 1 Y 1 D GLY 189 ? D GLY 133 349 1 Y 1 D ILE 190 ? D ILE 134 350 1 Y 1 D GLY 191 ? D GLY 135 351 1 Y 1 D GLU 192 ? D GLU 136 352 1 Y 1 D LYS 193 ? D LYS 137 353 1 Y 1 D SER 194 ? D SER 138 354 1 Y 1 D PHE 195 ? D PHE 139 355 1 Y 1 D GLU 196 ? D GLU 140 356 1 Y 1 D LYS 197 ? D LYS 141 357 1 Y 1 D ILE 198 ? D ILE 142 358 1 Y 1 D LYS 199 ? D LYS 143 359 1 Y 1 D SER 200 ? D SER 144 360 1 Y 1 D SER 201 ? D SER 145 361 1 Y 1 D ILE 202 ? D ILE 146 362 1 Y 1 D THR 203 ? D THR 147 363 1 Y 1 D VAL 204 ? D VAL 148 364 1 Y 1 D LYS 205 ? D LYS 149 365 1 Y 1 D LEU 206 ? D LEU 150 366 1 Y 1 D GLU 207 ? D GLU 151 367 1 Y 1 D HIS 208 ? D HIS 152 368 1 Y 1 D HIS 209 ? D HIS 153 369 1 Y 1 D HIS 210 ? D HIS 154 370 1 Y 1 D HIS 211 ? D HIS 155 371 1 Y 1 D HIS 212 ? D HIS 156 372 1 Y 1 D HIS 213 ? D HIS 157 373 1 Y 1 E MET 57 ? E MET 1 374 1 Y 1 E SER 58 ? E SER 2 375 1 Y 1 E GLU 123 ? E GLU 67 376 1 Y 1 E THR 124 ? E THR 68 377 1 Y 1 E ALA 125 ? E ALA 69 378 1 Y 1 E VAL 126 ? E VAL 70 379 1 Y 1 E GLN 127 ? E GLN 71 380 1 Y 1 E GLN 128 ? E GLN 72 381 1 Y 1 E GLY 129 ? E GLY 73 382 1 Y 1 E GLY 130 ? E GLY 74 383 1 Y 1 E GLY 131 ? E GLY 75 384 1 Y 1 E GLY 132 ? E GLY 76 385 1 Y 1 E SER 133 ? E SER 77 386 1 Y 1 E VAL 134 ? E VAL 78 387 1 Y 1 E GLN 135 ? E GLN 79 388 1 Y 1 E SER 136 ? E SER 80 389 1 Y 1 E ASP 137 ? E ASP 81 390 1 Y 1 E GLY 138 ? E GLY 82 391 1 Y 1 E GLY 139 ? E GLY 83 392 1 Y 1 E LYS 140 ? E LYS 84 393 1 Y 1 E GLY 141 ? E GLY 85 394 1 Y 1 E ALA 142 ? E ALA 86 395 1 Y 1 E LEU 143 ? E LEU 87 396 1 Y 1 E VAL 144 ? E VAL 88 397 1 Y 1 E ASN 145 ? E ASN 89 398 1 Y 1 E ILE 146 ? E ILE 90 399 1 Y 1 E ASN 147 ? E ASN 91 400 1 Y 1 E THR 148 ? E THR 92 401 1 Y 1 E ALA 149 ? E ALA 93 402 1 Y 1 E THR 150 ? E THR 94 403 1 Y 1 E LEU 151 ? E LEU 95 404 1 Y 1 E GLU 152 ? E GLU 96 405 1 Y 1 E GLU 153 ? E GLU 97 406 1 Y 1 E LEU 154 ? E LEU 98 407 1 Y 1 E GLN 155 ? E GLN 99 408 1 Y 1 E GLY 156 ? E GLY 100 409 1 Y 1 E ILE 157 ? E ILE 101 410 1 Y 1 E SER 158 ? E SER 102 411 1 Y 1 E GLY 159 ? E GLY 103 412 1 Y 1 E VAL 160 ? E VAL 104 413 1 Y 1 E GLY 161 ? E GLY 105 414 1 Y 1 E PRO 162 ? E PRO 106 415 1 Y 1 E SER 163 ? E SER 107 416 1 Y 1 E LYS 164 ? E LYS 108 417 1 Y 1 E ALA 165 ? E ALA 109 418 1 Y 1 E GLU 166 ? E GLU 110 419 1 Y 1 E ALA 167 ? E ALA 111 420 1 Y 1 E ILE 168 ? E ILE 112 421 1 Y 1 E ILE 169 ? E ILE 113 422 1 Y 1 E ALA 170 ? E ALA 114 423 1 Y 1 E TYR 171 ? E TYR 115 424 1 Y 1 E ARG 172 ? E ARG 116 425 1 Y 1 E GLU 173 ? E GLU 117 426 1 Y 1 E GLU 174 ? E GLU 118 427 1 Y 1 E ASN 175 ? E ASN 119 428 1 Y 1 E GLY 176 ? E GLY 120 429 1 Y 1 E ARG 177 ? E ARG 121 430 1 Y 1 E PHE 178 ? E PHE 122 431 1 Y 1 E GLN 179 ? E GLN 123 432 1 Y 1 E THR 180 ? E THR 124 433 1 Y 1 E ILE 181 ? E ILE 125 434 1 Y 1 E GLU 182 ? E GLU 126 435 1 Y 1 E ASP 183 ? E ASP 127 436 1 Y 1 E ILE 184 ? E ILE 128 437 1 Y 1 E THR 185 ? E THR 129 438 1 Y 1 E LYS 186 ? E LYS 130 439 1 Y 1 E VAL 187 ? E VAL 131 440 1 Y 1 E SER 188 ? E SER 132 441 1 Y 1 E GLY 189 ? E GLY 133 442 1 Y 1 E ILE 190 ? E ILE 134 443 1 Y 1 E GLY 191 ? E GLY 135 444 1 Y 1 E GLU 192 ? E GLU 136 445 1 Y 1 E LYS 193 ? E LYS 137 446 1 Y 1 E SER 194 ? E SER 138 447 1 Y 1 E PHE 195 ? E PHE 139 448 1 Y 1 E GLU 196 ? E GLU 140 449 1 Y 1 E LYS 197 ? E LYS 141 450 1 Y 1 E ILE 198 ? E ILE 142 451 1 Y 1 E LYS 199 ? E LYS 143 452 1 Y 1 E SER 200 ? E SER 144 453 1 Y 1 E SER 201 ? E SER 145 454 1 Y 1 E ILE 202 ? E ILE 146 455 1 Y 1 E THR 203 ? E THR 147 456 1 Y 1 E VAL 204 ? E VAL 148 457 1 Y 1 E LYS 205 ? E LYS 149 458 1 Y 1 E LEU 206 ? E LEU 150 459 1 Y 1 E GLU 207 ? E GLU 151 460 1 Y 1 E HIS 208 ? E HIS 152 461 1 Y 1 E HIS 209 ? E HIS 153 462 1 Y 1 E HIS 210 ? E HIS 154 463 1 Y 1 E HIS 211 ? E HIS 155 464 1 Y 1 E HIS 212 ? E HIS 156 465 1 Y 1 E HIS 213 ? E HIS 157 466 1 Y 1 F MET 57 ? F MET 1 467 1 Y 1 F SER 58 ? F SER 2 468 1 Y 1 F GLU 123 ? F GLU 67 469 1 Y 1 F THR 124 ? F THR 68 470 1 Y 1 F ALA 125 ? F ALA 69 471 1 Y 1 F VAL 126 ? F VAL 70 472 1 Y 1 F GLN 127 ? F GLN 71 473 1 Y 1 F GLN 128 ? F GLN 72 474 1 Y 1 F GLY 129 ? F GLY 73 475 1 Y 1 F GLY 130 ? F GLY 74 476 1 Y 1 F GLY 131 ? F GLY 75 477 1 Y 1 F GLY 132 ? F GLY 76 478 1 Y 1 F SER 133 ? F SER 77 479 1 Y 1 F VAL 134 ? F VAL 78 480 1 Y 1 F GLN 135 ? F GLN 79 481 1 Y 1 F SER 136 ? F SER 80 482 1 Y 1 F ASP 137 ? F ASP 81 483 1 Y 1 F GLY 138 ? F GLY 82 484 1 Y 1 F GLY 139 ? F GLY 83 485 1 Y 1 F LYS 140 ? F LYS 84 486 1 Y 1 F GLY 141 ? F GLY 85 487 1 Y 1 F ALA 142 ? F ALA 86 488 1 Y 1 F LEU 143 ? F LEU 87 489 1 Y 1 F VAL 144 ? F VAL 88 490 1 Y 1 F ASN 145 ? F ASN 89 491 1 Y 1 F ILE 146 ? F ILE 90 492 1 Y 1 F ASN 147 ? F ASN 91 493 1 Y 1 F THR 148 ? F THR 92 494 1 Y 1 F ALA 149 ? F ALA 93 495 1 Y 1 F THR 150 ? F THR 94 496 1 Y 1 F LEU 151 ? F LEU 95 497 1 Y 1 F GLU 152 ? F GLU 96 498 1 Y 1 F GLU 153 ? F GLU 97 499 1 Y 1 F LEU 154 ? F LEU 98 500 1 Y 1 F GLN 155 ? F GLN 99 501 1 Y 1 F GLY 156 ? F GLY 100 502 1 Y 1 F ILE 157 ? F ILE 101 503 1 Y 1 F SER 158 ? F SER 102 504 1 Y 1 F GLY 159 ? F GLY 103 505 1 Y 1 F VAL 160 ? F VAL 104 506 1 Y 1 F GLY 161 ? F GLY 105 507 1 Y 1 F PRO 162 ? F PRO 106 508 1 Y 1 F SER 163 ? F SER 107 509 1 Y 1 F LYS 164 ? F LYS 108 510 1 Y 1 F ALA 165 ? F ALA 109 511 1 Y 1 F GLU 166 ? F GLU 110 512 1 Y 1 F ALA 167 ? F ALA 111 513 1 Y 1 F ILE 168 ? F ILE 112 514 1 Y 1 F ILE 169 ? F ILE 113 515 1 Y 1 F ALA 170 ? F ALA 114 516 1 Y 1 F TYR 171 ? F TYR 115 517 1 Y 1 F ARG 172 ? F ARG 116 518 1 Y 1 F GLU 173 ? F GLU 117 519 1 Y 1 F GLU 174 ? F GLU 118 520 1 Y 1 F ASN 175 ? F ASN 119 521 1 Y 1 F GLY 176 ? F GLY 120 522 1 Y 1 F ARG 177 ? F ARG 121 523 1 Y 1 F PHE 178 ? F PHE 122 524 1 Y 1 F GLN 179 ? F GLN 123 525 1 Y 1 F THR 180 ? F THR 124 526 1 Y 1 F ILE 181 ? F ILE 125 527 1 Y 1 F GLU 182 ? F GLU 126 528 1 Y 1 F ASP 183 ? F ASP 127 529 1 Y 1 F ILE 184 ? F ILE 128 530 1 Y 1 F THR 185 ? F THR 129 531 1 Y 1 F LYS 186 ? F LYS 130 532 1 Y 1 F VAL 187 ? F VAL 131 533 1 Y 1 F SER 188 ? F SER 132 534 1 Y 1 F GLY 189 ? F GLY 133 535 1 Y 1 F ILE 190 ? F ILE 134 536 1 Y 1 F GLY 191 ? F GLY 135 537 1 Y 1 F GLU 192 ? F GLU 136 538 1 Y 1 F LYS 193 ? F LYS 137 539 1 Y 1 F SER 194 ? F SER 138 540 1 Y 1 F PHE 195 ? F PHE 139 541 1 Y 1 F GLU 196 ? F GLU 140 542 1 Y 1 F LYS 197 ? F LYS 141 543 1 Y 1 F ILE 198 ? F ILE 142 544 1 Y 1 F LYS 199 ? F LYS 143 545 1 Y 1 F SER 200 ? F SER 144 546 1 Y 1 F SER 201 ? F SER 145 547 1 Y 1 F ILE 202 ? F ILE 146 548 1 Y 1 F THR 203 ? F THR 147 549 1 Y 1 F VAL 204 ? F VAL 148 550 1 Y 1 F LYS 205 ? F LYS 149 551 1 Y 1 F LEU 206 ? F LEU 150 552 1 Y 1 F GLU 207 ? F GLU 151 553 1 Y 1 F HIS 208 ? F HIS 152 554 1 Y 1 F HIS 209 ? F HIS 153 555 1 Y 1 F HIS 210 ? F HIS 154 556 1 Y 1 F HIS 211 ? F HIS 155 557 1 Y 1 F HIS 212 ? F HIS 156 558 1 Y 1 F HIS 213 ? F HIS 157 559 1 Y 1 G MET 57 ? G MET 1 560 1 Y 1 G SER 58 ? G SER 2 561 1 Y 1 G ASN 59 ? G ASN 3 562 1 Y 1 G GLU 123 ? G GLU 67 563 1 Y 1 G THR 124 ? G THR 68 564 1 Y 1 G ALA 125 ? G ALA 69 565 1 Y 1 G VAL 126 ? G VAL 70 566 1 Y 1 G GLN 127 ? G GLN 71 567 1 Y 1 G GLN 128 ? G GLN 72 568 1 Y 1 G GLY 129 ? G GLY 73 569 1 Y 1 G GLY 130 ? G GLY 74 570 1 Y 1 G GLY 131 ? G GLY 75 571 1 Y 1 G GLY 132 ? G GLY 76 572 1 Y 1 G SER 133 ? G SER 77 573 1 Y 1 G VAL 134 ? G VAL 78 574 1 Y 1 G GLN 135 ? G GLN 79 575 1 Y 1 G SER 136 ? G SER 80 576 1 Y 1 G ASP 137 ? G ASP 81 577 1 Y 1 G GLY 138 ? G GLY 82 578 1 Y 1 G GLY 139 ? G GLY 83 579 1 Y 1 G LYS 140 ? G LYS 84 580 1 Y 1 G GLY 141 ? G GLY 85 581 1 Y 1 G ALA 142 ? G ALA 86 582 1 Y 1 G LEU 143 ? G LEU 87 583 1 Y 1 G VAL 144 ? G VAL 88 584 1 Y 1 G ASN 145 ? G ASN 89 585 1 Y 1 G ILE 146 ? G ILE 90 586 1 Y 1 G ASN 147 ? G ASN 91 587 1 Y 1 G THR 148 ? G THR 92 588 1 Y 1 G ALA 149 ? G ALA 93 589 1 Y 1 G THR 150 ? G THR 94 590 1 Y 1 G LEU 151 ? G LEU 95 591 1 Y 1 G GLU 152 ? G GLU 96 592 1 Y 1 G GLU 153 ? G GLU 97 593 1 Y 1 G LEU 154 ? G LEU 98 594 1 Y 1 G GLN 155 ? G GLN 99 595 1 Y 1 G GLY 156 ? G GLY 100 596 1 Y 1 G ILE 157 ? G ILE 101 597 1 Y 1 G SER 158 ? G SER 102 598 1 Y 1 G GLY 159 ? G GLY 103 599 1 Y 1 G VAL 160 ? G VAL 104 600 1 Y 1 G GLY 161 ? G GLY 105 601 1 Y 1 G PRO 162 ? G PRO 106 602 1 Y 1 G SER 163 ? G SER 107 603 1 Y 1 G LYS 164 ? G LYS 108 604 1 Y 1 G ALA 165 ? G ALA 109 605 1 Y 1 G GLU 166 ? G GLU 110 606 1 Y 1 G ALA 167 ? G ALA 111 607 1 Y 1 G ILE 168 ? G ILE 112 608 1 Y 1 G ILE 169 ? G ILE 113 609 1 Y 1 G ALA 170 ? G ALA 114 610 1 Y 1 G TYR 171 ? G TYR 115 611 1 Y 1 G ARG 172 ? G ARG 116 612 1 Y 1 G GLU 173 ? G GLU 117 613 1 Y 1 G GLU 174 ? G GLU 118 614 1 Y 1 G ASN 175 ? G ASN 119 615 1 Y 1 G GLY 176 ? G GLY 120 616 1 Y 1 G ARG 177 ? G ARG 121 617 1 Y 1 G PHE 178 ? G PHE 122 618 1 Y 1 G GLN 179 ? G GLN 123 619 1 Y 1 G THR 180 ? G THR 124 620 1 Y 1 G ILE 181 ? G ILE 125 621 1 Y 1 G GLU 182 ? G GLU 126 622 1 Y 1 G ASP 183 ? G ASP 127 623 1 Y 1 G ILE 184 ? G ILE 128 624 1 Y 1 G THR 185 ? G THR 129 625 1 Y 1 G LYS 186 ? G LYS 130 626 1 Y 1 G VAL 187 ? G VAL 131 627 1 Y 1 G SER 188 ? G SER 132 628 1 Y 1 G GLY 189 ? G GLY 133 629 1 Y 1 G ILE 190 ? G ILE 134 630 1 Y 1 G GLY 191 ? G GLY 135 631 1 Y 1 G GLU 192 ? G GLU 136 632 1 Y 1 G LYS 193 ? G LYS 137 633 1 Y 1 G SER 194 ? G SER 138 634 1 Y 1 G PHE 195 ? G PHE 139 635 1 Y 1 G GLU 196 ? G GLU 140 636 1 Y 1 G LYS 197 ? G LYS 141 637 1 Y 1 G ILE 198 ? G ILE 142 638 1 Y 1 G LYS 199 ? G LYS 143 639 1 Y 1 G SER 200 ? G SER 144 640 1 Y 1 G SER 201 ? G SER 145 641 1 Y 1 G ILE 202 ? G ILE 146 642 1 Y 1 G THR 203 ? G THR 147 643 1 Y 1 G VAL 204 ? G VAL 148 644 1 Y 1 G LYS 205 ? G LYS 149 645 1 Y 1 G LEU 206 ? G LEU 150 646 1 Y 1 G GLU 207 ? G GLU 151 647 1 Y 1 G HIS 208 ? G HIS 152 648 1 Y 1 G HIS 209 ? G HIS 153 649 1 Y 1 G HIS 210 ? G HIS 154 650 1 Y 1 G HIS 211 ? G HIS 155 651 1 Y 1 G HIS 212 ? G HIS 156 652 1 Y 1 G HIS 213 ? G HIS 157 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R01GM057720 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details 'Sedimentation velocity experiments' # _space_group.name_H-M_alt 'I 2 2 2' _space_group.name_Hall 'I 2 2' _space_group.IT_number 23 _space_group.crystal_system orthorhombic _space_group.id 1 #