data_8DFZ # _entry.id 8DFZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8DFZ pdb_00008dfz 10.2210/pdb8dfz/pdb WWPDB D_1000266548 ? ? BMRB 31028 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'same peptide without Ser 18 modification' 2KUY unspecified BMRB 'NMR shows why a small chemical change almost abolishes the antimicrobial activity of GccF' 31028 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8DFZ _pdbx_database_status.recvd_initial_deposition_date 2022-06-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Harjes, E.' 1 0000-0002-3643-9432 'Edwards, P.J.B.' 2 0000-0003-3776-7582 'Norris, G.' 3 0000-0001-9231-4389 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 62 _citation.language ? _citation.page_first 2669 _citation.page_last 2676 _citation.title 'NMR Shows Why a Small Chemical Change Almost Abolishes the Antimicrobial Activity of Glycocin F.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.3c00197 _citation.pdbx_database_id_PubMed 37531216 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Harjes, E.' 1 0000-0002-3643-9432 primary 'Edwards, P.J.B.' 2 ? primary 'Bisset, S.W.' 3 ? primary 'Patchett, M.L.' 4 ? primary 'Jameson, G.B.' 5 0000-0003-4839-0784 primary 'Yang, S.H.' 6 ? primary 'Navo, C.D.' 7 0000-0003-0161-412X primary 'Harris, P.W.R.' 8 0000-0002-2579-4543 primary 'Brimble, M.A.' 9 0000-0002-7086-4096 primary 'Norris, G.E.' 10 0000-0001-9231-4389 # _cell.angle_alpha 90.000000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000000 _cell.angle_gamma_esd ? _cell.entry_id 8DFZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000000 _cell.length_a_esd ? _cell.length_b 1.000000 _cell.length_b_esd ? _cell.length_c 1.000000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8DFZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bacteriocin glycocin F' 4820.406 1 ? ? ? ? 2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name GccF # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'KPAWCWYTLAMCGAGYD(EW6)GTCDYMYSHCFGIKHHSSGSSSYHC' _entity_poly.pdbx_seq_one_letter_code_can KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGIKHHSSGSSSYHC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 PRO n 1 3 ALA n 1 4 TRP n 1 5 CYS n 1 6 TRP n 1 7 TYR n 1 8 THR n 1 9 LEU n 1 10 ALA n 1 11 MET n 1 12 CYS n 1 13 GLY n 1 14 ALA n 1 15 GLY n 1 16 TYR n 1 17 ASP n 1 18 EW6 n 1 19 GLY n 1 20 THR n 1 21 CYS n 1 22 ASP n 1 23 TYR n 1 24 MET n 1 25 TYR n 1 26 SER n 1 27 HIS n 1 28 CYS n 1 29 PHE n 1 30 GLY n 1 31 ILE n 1 32 LYS n 1 33 HIS n 1 34 HIS n 1 35 SER n 1 36 SER n 1 37 GLY n 1 38 SER n 1 39 SER n 1 40 SER n 1 41 TYR n 1 42 HIS n 1 43 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 43 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene gccF _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactiplantibacillus plantarum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1590 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Lactiplantibacillus plantarum' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 1590 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GCCF_LACPN _struct_ref.pdbx_db_accession E9K9Z1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGIKHHSSGSSSYHC _struct_ref.pdbx_align_begin 22 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8DFZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 43 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession E9K9Z1 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 64 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 43 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EW6 'L-peptide linking' n alpha-methyl-L-serine '(2S)-2-azanyl-2-methyl-3-oxidanyl-propanoic acid' 'C4 H9 N O3' 119.119 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 TOCSY 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D DQF-COSY' 1 isotropic 4 1 1 '2D 1H-13C HSQC' 1 isotropic 5 1 1 HMBC 1 isotropic 6 1 1 '3D 1H-13C TOCSY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 307 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM natural abundabnce GccF modified, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 'natural abbundance' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '40% d3-acetonitrile / water with 0.2% d3-acetic acid' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'Bruker Avance' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 8DFZ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 8DFZ _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8DFZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement YASARA ? 'Elmer Krieger' 2 'structure calculation' YASARA ? 'Elmer Krieger' 3 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 4 'peak picking' ATNOS ? Hermann # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8DFZ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8DFZ _struct.title 'NMR shows why a small chemical change almost abolishes the antimicrobial activity of GccF' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8DFZ _struct_keywords.text 'GccF, antimicrobial, bacteriostatic, ANTIMICROBIAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 2 ? CYS A 12 ? PRO A 2 CYS A 12 1 ? 11 HELX_P HELX_P2 AA2 GLY A 13 ? GLY A 15 ? GLY A 13 GLY A 15 5 ? 3 HELX_P HELX_P3 AA3 THR A 20 ? PHE A 29 ? THR A 20 PHE A 29 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 5 A CYS 28 1_555 ? ? ? ? ? ? ? 2.017 ? ? disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 12 A CYS 21 1_555 ? ? ? ? ? ? ? 2.018 ? ? covale1 covale both ? A ASP 17 C ? ? ? 1_555 A EW6 18 N ? ? A ASP 17 A EW6 18 1_555 ? ? ? ? ? ? ? 1.375 ? ? covale2 covale both ? A EW6 18 C ? ? ? 1_555 A GLY 19 N ? ? A EW6 18 A GLY 19 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale3 covale one ? A EW6 18 OG ? ? ? 1_555 B NAG . C1 ? ? A EW6 18 A NAG 101 1_555 ? ? ? ? ? ? ? 1.457 ? ? covale4 covale one ? A CYS 43 SG ? ? ? 1_555 C NAG . C1 ? ? A CYS 43 A NAG 102 1_555 ? ? ? ? ? ? ? 1.865 ? S-Glycosylation # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 _database_PDB_matrix.entry_id 8DFZ # _atom_sites.entry_id 8DFZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 EW6 18 18 18 EW6 EW6 A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 CYS 43 43 43 CYS CYS A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email G.Norris@massey.ac.nz _pdbx_contact_author.name_first Gillian _pdbx_contact_author.name_last Norris _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9231-4389 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 101 44 NAG NAG A . C 2 NAG 1 102 45 NAG NAG A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id EW6 _pdbx_struct_mod_residue.label_seq_id 18 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id EW6 _pdbx_struct_mod_residue.auth_seq_id 18 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-07-05 2 'Structure model' 1 1 2023-08-16 3 'Structure model' 1 2 2023-09-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' citation 4 2 'Structure model' citation_author 5 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' # _pdbx_entry_details.entry_id 8DFZ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'GccF modified' _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundabnce' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A MET 24 ? ? CA A MET 24 ? ? CB A MET 24 ? ? 99.12 110.60 -11.48 1.80 N 2 3 N A MET 24 ? ? CA A MET 24 ? ? CB A MET 24 ? ? 99.70 110.60 -10.90 1.80 N 3 6 N A MET 24 ? ? CA A MET 24 ? ? CB A MET 24 ? ? 99.71 110.60 -10.89 1.80 N 4 7 N A MET 24 ? ? CA A MET 24 ? ? CB A MET 24 ? ? 99.44 110.60 -11.16 1.80 N 5 10 N A MET 24 ? ? CA A MET 24 ? ? CB A MET 24 ? ? 99.59 110.60 -11.01 1.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 17 ? ? 24.82 -95.87 2 1 THR A 20 ? ? -105.48 -62.01 3 1 HIS A 33 ? ? -118.19 70.34 4 1 SER A 40 ? ? -117.17 51.67 5 1 HIS A 42 ? ? -151.67 32.27 6 2 ASP A 17 ? ? 22.23 -89.98 7 2 THR A 20 ? ? -101.49 -61.87 8 2 HIS A 34 ? ? -151.07 22.18 9 2 SER A 39 ? ? -151.85 29.47 10 2 TYR A 41 ? ? 61.17 -69.54 11 2 HIS A 42 ? ? -141.11 24.09 12 3 ASP A 17 ? ? 31.34 -86.67 13 3 THR A 20 ? ? -103.25 -62.30 14 3 HIS A 34 ? ? -153.94 17.79 15 3 TYR A 41 ? ? 65.04 -33.06 16 4 ASP A 17 ? ? 23.78 -88.99 17 4 THR A 20 ? ? -101.50 -62.06 18 4 TYR A 41 ? ? 65.79 -51.66 19 4 HIS A 42 ? ? -142.48 19.01 20 5 ASP A 17 ? ? 36.46 -87.85 21 5 THR A 20 ? ? -102.75 -62.30 22 5 HIS A 34 ? ? -149.40 42.96 23 5 SER A 40 ? ? -73.96 48.80 24 6 ASP A 17 ? ? 33.32 -88.43 25 6 THR A 20 ? ? -102.84 -61.99 26 6 SER A 36 ? ? 58.27 -161.72 27 6 SER A 39 ? ? 55.34 18.20 28 6 TYR A 41 ? ? -73.01 21.21 29 6 HIS A 42 ? ? -141.82 25.14 30 7 ASP A 17 ? ? 36.68 -93.59 31 7 THR A 20 ? ? -102.91 -62.29 32 7 HIS A 34 ? ? -150.34 40.40 33 7 SER A 38 ? ? 70.88 156.01 34 7 SER A 39 ? ? 59.09 6.95 35 7 HIS A 42 ? ? -144.56 22.53 36 8 ASP A 17 ? ? 23.85 -88.81 37 8 THR A 20 ? ? -101.21 -62.24 38 8 HIS A 33 ? ? -109.96 52.54 39 8 HIS A 42 ? ? -151.93 19.44 40 9 ASP A 17 ? ? 21.86 -89.69 41 9 THR A 20 ? ? -100.98 -62.31 42 9 HIS A 33 ? ? -119.24 77.39 43 9 HIS A 34 ? ? -151.74 40.13 44 9 HIS A 42 ? ? -146.85 20.74 45 10 ASP A 17 ? ? 23.22 -89.25 46 10 THR A 20 ? ? -102.15 -62.45 47 10 HIS A 34 ? ? -153.35 39.24 48 10 HIS A 42 ? ? -160.52 31.15 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASP N N N N 14 ASP CA C N S 15 ASP C C N N 16 ASP O O N N 17 ASP CB C N N 18 ASP CG C N N 19 ASP OD1 O N N 20 ASP OD2 O N N 21 ASP OXT O N N 22 ASP H H N N 23 ASP H2 H N N 24 ASP HA H N N 25 ASP HB2 H N N 26 ASP HB3 H N N 27 ASP HD2 H N N 28 ASP HXT H N N 29 CYS N N N N 30 CYS CA C N R 31 CYS C C N N 32 CYS O O N N 33 CYS CB C N N 34 CYS SG S N N 35 CYS OXT O N N 36 CYS H H N N 37 CYS H2 H N N 38 CYS HA H N N 39 CYS HB2 H N N 40 CYS HB3 H N N 41 CYS HG H N N 42 CYS HXT H N N 43 EW6 N N N N 44 EW6 CA C N S 45 EW6 C C N N 46 EW6 O O N N 47 EW6 CB C N N 48 EW6 C4 C N N 49 EW6 OG O N N 50 EW6 H H N N 51 EW6 H2 H N N 52 EW6 HB2 H N N 53 EW6 HB3 H N N 54 EW6 H7 H N N 55 EW6 H8 H N N 56 EW6 H9 H N N 57 EW6 HG H N N 58 EW6 OXT O N N 59 EW6 HXT H N N 60 GLY N N N N 61 GLY CA C N N 62 GLY C C N N 63 GLY O O N N 64 GLY OXT O N N 65 GLY H H N N 66 GLY H2 H N N 67 GLY HA2 H N N 68 GLY HA3 H N N 69 GLY HXT H N N 70 HIS N N N N 71 HIS CA C N S 72 HIS C C N N 73 HIS O O N N 74 HIS CB C N N 75 HIS CG C Y N 76 HIS ND1 N Y N 77 HIS CD2 C Y N 78 HIS CE1 C Y N 79 HIS NE2 N Y N 80 HIS OXT O N N 81 HIS H H N N 82 HIS H2 H N N 83 HIS HA H N N 84 HIS HB2 H N N 85 HIS HB3 H N N 86 HIS HD1 H N N 87 HIS HD2 H N N 88 HIS HE1 H N N 89 HIS HE2 H N N 90 HIS HXT H N N 91 ILE N N N N 92 ILE CA C N S 93 ILE C C N N 94 ILE O O N N 95 ILE CB C N S 96 ILE CG1 C N N 97 ILE CG2 C N N 98 ILE CD1 C N N 99 ILE OXT O N N 100 ILE H H N N 101 ILE H2 H N N 102 ILE HA H N N 103 ILE HB H N N 104 ILE HG12 H N N 105 ILE HG13 H N N 106 ILE HG21 H N N 107 ILE HG22 H N N 108 ILE HG23 H N N 109 ILE HD11 H N N 110 ILE HD12 H N N 111 ILE HD13 H N N 112 ILE HXT H N N 113 LEU N N N N 114 LEU CA C N S 115 LEU C C N N 116 LEU O O N N 117 LEU CB C N N 118 LEU CG C N N 119 LEU CD1 C N N 120 LEU CD2 C N N 121 LEU OXT O N N 122 LEU H H N N 123 LEU H2 H N N 124 LEU HA H N N 125 LEU HB2 H N N 126 LEU HB3 H N N 127 LEU HG H N N 128 LEU HD11 H N N 129 LEU HD12 H N N 130 LEU HD13 H N N 131 LEU HD21 H N N 132 LEU HD22 H N N 133 LEU HD23 H N N 134 LEU HXT H N N 135 LYS N N N N 136 LYS CA C N S 137 LYS C C N N 138 LYS O O N N 139 LYS CB C N N 140 LYS CG C N N 141 LYS CD C N N 142 LYS CE C N N 143 LYS NZ N N N 144 LYS OXT O N N 145 LYS H H N N 146 LYS H2 H N N 147 LYS HA H N N 148 LYS HB2 H N N 149 LYS HB3 H N N 150 LYS HG2 H N N 151 LYS HG3 H N N 152 LYS HD2 H N N 153 LYS HD3 H N N 154 LYS HE2 H N N 155 LYS HE3 H N N 156 LYS HZ1 H N N 157 LYS HZ2 H N N 158 LYS HZ3 H N N 159 LYS HXT H N N 160 MET N N N N 161 MET CA C N S 162 MET C C N N 163 MET O O N N 164 MET CB C N N 165 MET CG C N N 166 MET SD S N N 167 MET CE C N N 168 MET OXT O N N 169 MET H H N N 170 MET H2 H N N 171 MET HA H N N 172 MET HB2 H N N 173 MET HB3 H N N 174 MET HG2 H N N 175 MET HG3 H N N 176 MET HE1 H N N 177 MET HE2 H N N 178 MET HE3 H N N 179 MET HXT H N N 180 NAG C1 C N R 181 NAG C2 C N R 182 NAG C3 C N R 183 NAG C4 C N S 184 NAG C5 C N R 185 NAG C6 C N N 186 NAG C7 C N N 187 NAG C8 C N N 188 NAG N2 N N N 189 NAG O1 O N N 190 NAG O3 O N N 191 NAG O4 O N N 192 NAG O5 O N N 193 NAG O6 O N N 194 NAG O7 O N N 195 NAG H1 H N N 196 NAG H2 H N N 197 NAG H3 H N N 198 NAG H4 H N N 199 NAG H5 H N N 200 NAG H61 H N N 201 NAG H62 H N N 202 NAG H81 H N N 203 NAG H82 H N N 204 NAG H83 H N N 205 NAG HN2 H N N 206 NAG HO1 H N N 207 NAG HO3 H N N 208 NAG HO4 H N N 209 NAG HO6 H N N 210 PHE N N N N 211 PHE CA C N S 212 PHE C C N N 213 PHE O O N N 214 PHE CB C N N 215 PHE CG C Y N 216 PHE CD1 C Y N 217 PHE CD2 C Y N 218 PHE CE1 C Y N 219 PHE CE2 C Y N 220 PHE CZ C Y N 221 PHE OXT O N N 222 PHE H H N N 223 PHE H2 H N N 224 PHE HA H N N 225 PHE HB2 H N N 226 PHE HB3 H N N 227 PHE HD1 H N N 228 PHE HD2 H N N 229 PHE HE1 H N N 230 PHE HE2 H N N 231 PHE HZ H N N 232 PHE HXT H N N 233 PRO N N N N 234 PRO CA C N S 235 PRO C C N N 236 PRO O O N N 237 PRO CB C N N 238 PRO CG C N N 239 PRO CD C N N 240 PRO OXT O N N 241 PRO H H N N 242 PRO HA H N N 243 PRO HB2 H N N 244 PRO HB3 H N N 245 PRO HG2 H N N 246 PRO HG3 H N N 247 PRO HD2 H N N 248 PRO HD3 H N N 249 PRO HXT H N N 250 SER N N N N 251 SER CA C N S 252 SER C C N N 253 SER O O N N 254 SER CB C N N 255 SER OG O N N 256 SER OXT O N N 257 SER H H N N 258 SER H2 H N N 259 SER HA H N N 260 SER HB2 H N N 261 SER HB3 H N N 262 SER HG H N N 263 SER HXT H N N 264 THR N N N N 265 THR CA C N S 266 THR C C N N 267 THR O O N N 268 THR CB C N R 269 THR OG1 O N N 270 THR CG2 C N N 271 THR OXT O N N 272 THR H H N N 273 THR H2 H N N 274 THR HA H N N 275 THR HB H N N 276 THR HG1 H N N 277 THR HG21 H N N 278 THR HG22 H N N 279 THR HG23 H N N 280 THR HXT H N N 281 TRP N N N N 282 TRP CA C N S 283 TRP C C N N 284 TRP O O N N 285 TRP CB C N N 286 TRP CG C Y N 287 TRP CD1 C Y N 288 TRP CD2 C Y N 289 TRP NE1 N Y N 290 TRP CE2 C Y N 291 TRP CE3 C Y N 292 TRP CZ2 C Y N 293 TRP CZ3 C Y N 294 TRP CH2 C Y N 295 TRP OXT O N N 296 TRP H H N N 297 TRP H2 H N N 298 TRP HA H N N 299 TRP HB2 H N N 300 TRP HB3 H N N 301 TRP HD1 H N N 302 TRP HE1 H N N 303 TRP HE3 H N N 304 TRP HZ2 H N N 305 TRP HZ3 H N N 306 TRP HH2 H N N 307 TRP HXT H N N 308 TYR N N N N 309 TYR CA C N S 310 TYR C C N N 311 TYR O O N N 312 TYR CB C N N 313 TYR CG C Y N 314 TYR CD1 C Y N 315 TYR CD2 C Y N 316 TYR CE1 C Y N 317 TYR CE2 C Y N 318 TYR CZ C Y N 319 TYR OH O N N 320 TYR OXT O N N 321 TYR H H N N 322 TYR H2 H N N 323 TYR HA H N N 324 TYR HB2 H N N 325 TYR HB3 H N N 326 TYR HD1 H N N 327 TYR HD2 H N N 328 TYR HE1 H N N 329 TYR HE2 H N N 330 TYR HH H N N 331 TYR HXT H N N 332 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASP N CA sing N N 13 ASP N H sing N N 14 ASP N H2 sing N N 15 ASP CA C sing N N 16 ASP CA CB sing N N 17 ASP CA HA sing N N 18 ASP C O doub N N 19 ASP C OXT sing N N 20 ASP CB CG sing N N 21 ASP CB HB2 sing N N 22 ASP CB HB3 sing N N 23 ASP CG OD1 doub N N 24 ASP CG OD2 sing N N 25 ASP OD2 HD2 sing N N 26 ASP OXT HXT sing N N 27 CYS N CA sing N N 28 CYS N H sing N N 29 CYS N H2 sing N N 30 CYS CA C sing N N 31 CYS CA CB sing N N 32 CYS CA HA sing N N 33 CYS C O doub N N 34 CYS C OXT sing N N 35 CYS CB SG sing N N 36 CYS CB HB2 sing N N 37 CYS CB HB3 sing N N 38 CYS SG HG sing N N 39 CYS OXT HXT sing N N 40 EW6 O C doub N N 41 EW6 C CA sing N N 42 EW6 N CA sing N N 43 EW6 CA CB sing N N 44 EW6 CA C4 sing N N 45 EW6 CB OG sing N N 46 EW6 N H sing N N 47 EW6 N H2 sing N N 48 EW6 CB HB2 sing N N 49 EW6 CB HB3 sing N N 50 EW6 C4 H7 sing N N 51 EW6 C4 H8 sing N N 52 EW6 C4 H9 sing N N 53 EW6 OG HG sing N N 54 EW6 C OXT sing N N 55 EW6 OXT HXT sing N N 56 GLY N CA sing N N 57 GLY N H sing N N 58 GLY N H2 sing N N 59 GLY CA C sing N N 60 GLY CA HA2 sing N N 61 GLY CA HA3 sing N N 62 GLY C O doub N N 63 GLY C OXT sing N N 64 GLY OXT HXT sing N N 65 HIS N CA sing N N 66 HIS N H sing N N 67 HIS N H2 sing N N 68 HIS CA C sing N N 69 HIS CA CB sing N N 70 HIS CA HA sing N N 71 HIS C O doub N N 72 HIS C OXT sing N N 73 HIS CB CG sing N N 74 HIS CB HB2 sing N N 75 HIS CB HB3 sing N N 76 HIS CG ND1 sing Y N 77 HIS CG CD2 doub Y N 78 HIS ND1 CE1 doub Y N 79 HIS ND1 HD1 sing N N 80 HIS CD2 NE2 sing Y N 81 HIS CD2 HD2 sing N N 82 HIS CE1 NE2 sing Y N 83 HIS CE1 HE1 sing N N 84 HIS NE2 HE2 sing N N 85 HIS OXT HXT sing N N 86 ILE N CA sing N N 87 ILE N H sing N N 88 ILE N H2 sing N N 89 ILE CA C sing N N 90 ILE CA CB sing N N 91 ILE CA HA sing N N 92 ILE C O doub N N 93 ILE C OXT sing N N 94 ILE CB CG1 sing N N 95 ILE CB CG2 sing N N 96 ILE CB HB sing N N 97 ILE CG1 CD1 sing N N 98 ILE CG1 HG12 sing N N 99 ILE CG1 HG13 sing N N 100 ILE CG2 HG21 sing N N 101 ILE CG2 HG22 sing N N 102 ILE CG2 HG23 sing N N 103 ILE CD1 HD11 sing N N 104 ILE CD1 HD12 sing N N 105 ILE CD1 HD13 sing N N 106 ILE OXT HXT sing N N 107 LEU N CA sing N N 108 LEU N H sing N N 109 LEU N H2 sing N N 110 LEU CA C sing N N 111 LEU CA CB sing N N 112 LEU CA HA sing N N 113 LEU C O doub N N 114 LEU C OXT sing N N 115 LEU CB CG sing N N 116 LEU CB HB2 sing N N 117 LEU CB HB3 sing N N 118 LEU CG CD1 sing N N 119 LEU CG CD2 sing N N 120 LEU CG HG sing N N 121 LEU CD1 HD11 sing N N 122 LEU CD1 HD12 sing N N 123 LEU CD1 HD13 sing N N 124 LEU CD2 HD21 sing N N 125 LEU CD2 HD22 sing N N 126 LEU CD2 HD23 sing N N 127 LEU OXT HXT sing N N 128 LYS N CA sing N N 129 LYS N H sing N N 130 LYS N H2 sing N N 131 LYS CA C sing N N 132 LYS CA CB sing N N 133 LYS CA HA sing N N 134 LYS C O doub N N 135 LYS C OXT sing N N 136 LYS CB CG sing N N 137 LYS CB HB2 sing N N 138 LYS CB HB3 sing N N 139 LYS CG CD sing N N 140 LYS CG HG2 sing N N 141 LYS CG HG3 sing N N 142 LYS CD CE sing N N 143 LYS CD HD2 sing N N 144 LYS CD HD3 sing N N 145 LYS CE NZ sing N N 146 LYS CE HE2 sing N N 147 LYS CE HE3 sing N N 148 LYS NZ HZ1 sing N N 149 LYS NZ HZ2 sing N N 150 LYS NZ HZ3 sing N N 151 LYS OXT HXT sing N N 152 MET N CA sing N N 153 MET N H sing N N 154 MET N H2 sing N N 155 MET CA C sing N N 156 MET CA CB sing N N 157 MET CA HA sing N N 158 MET C O doub N N 159 MET C OXT sing N N 160 MET CB CG sing N N 161 MET CB HB2 sing N N 162 MET CB HB3 sing N N 163 MET CG SD sing N N 164 MET CG HG2 sing N N 165 MET CG HG3 sing N N 166 MET SD CE sing N N 167 MET CE HE1 sing N N 168 MET CE HE2 sing N N 169 MET CE HE3 sing N N 170 MET OXT HXT sing N N 171 NAG C1 C2 sing N N 172 NAG C1 O1 sing N N 173 NAG C1 O5 sing N N 174 NAG C1 H1 sing N N 175 NAG C2 C3 sing N N 176 NAG C2 N2 sing N N 177 NAG C2 H2 sing N N 178 NAG C3 C4 sing N N 179 NAG C3 O3 sing N N 180 NAG C3 H3 sing N N 181 NAG C4 C5 sing N N 182 NAG C4 O4 sing N N 183 NAG C4 H4 sing N N 184 NAG C5 C6 sing N N 185 NAG C5 O5 sing N N 186 NAG C5 H5 sing N N 187 NAG C6 O6 sing N N 188 NAG C6 H61 sing N N 189 NAG C6 H62 sing N N 190 NAG C7 C8 sing N N 191 NAG C7 N2 sing N N 192 NAG C7 O7 doub N N 193 NAG C8 H81 sing N N 194 NAG C8 H82 sing N N 195 NAG C8 H83 sing N N 196 NAG N2 HN2 sing N N 197 NAG O1 HO1 sing N N 198 NAG O3 HO3 sing N N 199 NAG O4 HO4 sing N N 200 NAG O6 HO6 sing N N 201 PHE N CA sing N N 202 PHE N H sing N N 203 PHE N H2 sing N N 204 PHE CA C sing N N 205 PHE CA CB sing N N 206 PHE CA HA sing N N 207 PHE C O doub N N 208 PHE C OXT sing N N 209 PHE CB CG sing N N 210 PHE CB HB2 sing N N 211 PHE CB HB3 sing N N 212 PHE CG CD1 doub Y N 213 PHE CG CD2 sing Y N 214 PHE CD1 CE1 sing Y N 215 PHE CD1 HD1 sing N N 216 PHE CD2 CE2 doub Y N 217 PHE CD2 HD2 sing N N 218 PHE CE1 CZ doub Y N 219 PHE CE1 HE1 sing N N 220 PHE CE2 CZ sing Y N 221 PHE CE2 HE2 sing N N 222 PHE CZ HZ sing N N 223 PHE OXT HXT sing N N 224 PRO N CA sing N N 225 PRO N CD sing N N 226 PRO N H sing N N 227 PRO CA C sing N N 228 PRO CA CB sing N N 229 PRO CA HA sing N N 230 PRO C O doub N N 231 PRO C OXT sing N N 232 PRO CB CG sing N N 233 PRO CB HB2 sing N N 234 PRO CB HB3 sing N N 235 PRO CG CD sing N N 236 PRO CG HG2 sing N N 237 PRO CG HG3 sing N N 238 PRO CD HD2 sing N N 239 PRO CD HD3 sing N N 240 PRO OXT HXT sing N N 241 SER N CA sing N N 242 SER N H sing N N 243 SER N H2 sing N N 244 SER CA C sing N N 245 SER CA CB sing N N 246 SER CA HA sing N N 247 SER C O doub N N 248 SER C OXT sing N N 249 SER CB OG sing N N 250 SER CB HB2 sing N N 251 SER CB HB3 sing N N 252 SER OG HG sing N N 253 SER OXT HXT sing N N 254 THR N CA sing N N 255 THR N H sing N N 256 THR N H2 sing N N 257 THR CA C sing N N 258 THR CA CB sing N N 259 THR CA HA sing N N 260 THR C O doub N N 261 THR C OXT sing N N 262 THR CB OG1 sing N N 263 THR CB CG2 sing N N 264 THR CB HB sing N N 265 THR OG1 HG1 sing N N 266 THR CG2 HG21 sing N N 267 THR CG2 HG22 sing N N 268 THR CG2 HG23 sing N N 269 THR OXT HXT sing N N 270 TRP N CA sing N N 271 TRP N H sing N N 272 TRP N H2 sing N N 273 TRP CA C sing N N 274 TRP CA CB sing N N 275 TRP CA HA sing N N 276 TRP C O doub N N 277 TRP C OXT sing N N 278 TRP CB CG sing N N 279 TRP CB HB2 sing N N 280 TRP CB HB3 sing N N 281 TRP CG CD1 doub Y N 282 TRP CG CD2 sing Y N 283 TRP CD1 NE1 sing Y N 284 TRP CD1 HD1 sing N N 285 TRP CD2 CE2 doub Y N 286 TRP CD2 CE3 sing Y N 287 TRP NE1 CE2 sing Y N 288 TRP NE1 HE1 sing N N 289 TRP CE2 CZ2 sing Y N 290 TRP CE3 CZ3 doub Y N 291 TRP CE3 HE3 sing N N 292 TRP CZ2 CH2 doub Y N 293 TRP CZ2 HZ2 sing N N 294 TRP CZ3 CH2 sing Y N 295 TRP CZ3 HZ3 sing N N 296 TRP CH2 HH2 sing N N 297 TRP OXT HXT sing N N 298 TYR N CA sing N N 299 TYR N H sing N N 300 TYR N H2 sing N N 301 TYR CA C sing N N 302 TYR CA CB sing N N 303 TYR CA HA sing N N 304 TYR C O doub N N 305 TYR C OXT sing N N 306 TYR CB CG sing N N 307 TYR CB HB2 sing N N 308 TYR CB HB3 sing N N 309 TYR CG CD1 doub Y N 310 TYR CG CD2 sing Y N 311 TYR CD1 CE1 sing Y N 312 TYR CD1 HD1 sing N N 313 TYR CD2 CE2 doub Y N 314 TYR CD2 HD2 sing N N 315 TYR CE1 CZ doub Y N 316 TYR CE1 HE1 sing N N 317 TYR CE2 CZ sing Y N 318 TYR CE2 HE2 sing N N 319 TYR CZ OH sing N N 320 TYR OH HH sing N N 321 TYR OXT HXT sing N N 322 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id EW6 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id EW6 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 2-acetamido-2-deoxy-beta-D-glucopyranose _pdbx_entity_nonpoly.comp_id NAG # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ? #