data_8DOA # _entry.id 8DOA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8DOA pdb_00008doa 10.2210/pdb8doa/pdb WWPDB D_1000266952 ? ? BMRB 31033 ? 10.13018/BMR31033 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-10-05 2 'Structure model' 1 1 2022-10-19 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8DOA _pdbx_database_status.recvd_initial_deposition_date 2022-07-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of a model HEEH mini-protein (HEEH_TK_rd5_0958)' _pdbx_database_related.db_id 31033 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email cheryl.arrowsmith@uhnresearch.ca _pdbx_contact_author.name_first Cheryl _pdbx_contact_author.name_last Arrowsmith _pdbx_contact_author.name_mi H. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4971-3250 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Houliston, S.' 1 0000-0002-0113-0339 'Kim, T.-E.' 2 0000-0002-5583-1894 'Rocklin, G.' 3 0000-0003-2253-5631 'Arrowsmith, C.H.' 4 0000-0002-4971-3250 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 119 _citation.language ? _citation.page_first e2122676119 _citation.page_last e2122676119 _citation.title 'Dissecting the stability determinants of a challenging de novo protein fold using massively parallel design and experimentation.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2122676119 _citation.pdbx_database_id_PubMed 36191185 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, T.E.' 1 0000-0002-5583-1894 primary 'Tsuboyama, K.' 2 0000-0002-9034-8179 primary 'Houliston, S.' 3 0000-0002-0113-0339 primary 'Martell, C.M.' 4 ? primary 'Phoumyvong, C.M.' 5 0000-0003-1848-6523 primary 'Lemak, A.' 6 ? primary 'Haddox, H.K.' 7 ? primary 'Arrowsmith, C.H.' 8 ? primary 'Rocklin, G.J.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HEEH mini-protein TK_rd5_0958' _entity.formula_weight 7449.431 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGSSHHHHHHSSGLVPRGSHMDIEEIEKKARKILEKGDSIEIAGFEVRDEEDLKKILEWLRRHG _entity_poly.pdbx_seq_one_letter_code_can MGSSHHHHHHSSGLVPRGSHMDIEEIEKKARKILEKGDSIEIAGFEVRDEEDLKKILEWLRRHG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ASP n 1 23 ILE n 1 24 GLU n 1 25 GLU n 1 26 ILE n 1 27 GLU n 1 28 LYS n 1 29 LYS n 1 30 ALA n 1 31 ARG n 1 32 LYS n 1 33 ILE n 1 34 LEU n 1 35 GLU n 1 36 LYS n 1 37 GLY n 1 38 ASP n 1 39 SER n 1 40 ILE n 1 41 GLU n 1 42 ILE n 1 43 ALA n 1 44 GLY n 1 45 PHE n 1 46 GLU n 1 47 VAL n 1 48 ARG n 1 49 ASP n 1 50 GLU n 1 51 GLU n 1 52 ASP n 1 53 LEU n 1 54 LYS n 1 55 LYS n 1 56 ILE n 1 57 LEU n 1 58 GLU n 1 59 TRP n 1 60 LEU n 1 61 ARG n 1 62 ARG n 1 63 HIS n 1 64 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 64 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 GLY 64 64 64 GLY GLY A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8DOA _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8DOA _struct.title 'Solution structure of a model HEEH mini-protein (HEEH_TK_rd5_0958)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8DOA _struct_keywords.text 'Mini protein, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8DOA _struct_ref.pdbx_db_accession 8DOA _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8DOA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8DOA _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 64 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 64 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR relaxation study' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 22 ? GLY A 37 ? ASP A 22 GLY A 37 1 ? 16 HELX_P HELX_P2 AA2 ASP A 49 ? HIS A 63 ? ASP A 49 HIS A 63 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 40 ? ILE A 42 ? ILE A 40 ILE A 42 AA1 2 PHE A 45 ? VAL A 47 ? PHE A 45 VAL A 47 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 42 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 42 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 45 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 45 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 6 ? ? -59.28 94.61 2 1 HIS A 10 ? ? 60.86 70.99 3 1 SER A 12 ? ? -160.92 -56.36 4 1 VAL A 15 ? ? 56.45 71.13 5 1 MET A 21 ? ? 62.08 94.94 6 2 HIS A 7 ? ? -162.15 103.01 7 2 MET A 21 ? ? 70.72 83.36 8 2 HIS A 63 ? ? -93.04 31.81 9 3 SER A 19 ? ? -64.06 99.75 10 4 VAL A 15 ? ? 63.90 97.71 11 4 SER A 19 ? ? -69.21 83.99 12 4 HIS A 20 ? ? -95.30 -60.68 13 4 ASP A 38 ? ? -104.92 -169.38 14 4 ARG A 48 ? ? -121.75 -63.22 15 5 MET A 21 ? ? 66.67 93.25 16 5 HIS A 63 ? ? -50.28 170.02 17 6 HIS A 8 ? ? -125.46 -68.08 18 6 SER A 12 ? ? -156.55 83.79 19 6 VAL A 15 ? ? 61.97 75.48 20 6 SER A 19 ? ? 60.98 69.88 21 6 MET A 21 ? ? 64.58 86.22 22 7 SER A 11 ? ? -69.40 99.02 23 7 MET A 21 ? ? 67.41 81.04 24 8 SER A 3 ? ? -95.13 57.74 25 9 HIS A 6 ? ? -62.07 -71.34 26 9 MET A 21 ? ? 60.86 79.12 27 10 HIS A 5 ? ? -69.41 91.06 28 10 HIS A 6 ? ? -165.28 115.07 29 10 HIS A 10 ? ? 72.16 145.42 30 10 PRO A 16 ? ? -52.44 105.94 31 10 MET A 21 ? ? -66.88 92.79 32 11 ARG A 17 ? ? 74.57 -64.02 33 13 VAL A 15 ? ? 55.24 76.55 34 14 MET A 21 ? ? 60.91 77.21 35 15 VAL A 15 ? ? -115.62 71.43 36 15 PRO A 16 ? ? -95.78 -158.93 37 16 HIS A 20 ? ? -106.51 68.01 38 17 HIS A 6 ? ? -56.08 108.31 39 17 HIS A 63 ? ? -172.19 119.24 40 18 HIS A 8 ? ? -145.20 29.81 41 18 GLU A 46 ? ? -69.68 98.39 42 18 HIS A 63 ? ? -144.43 43.96 43 19 SER A 3 ? ? -154.95 22.30 44 19 HIS A 5 ? ? -126.57 -144.92 45 19 SER A 12 ? ? -157.75 85.67 46 20 HIS A 6 ? ? -85.83 46.80 47 20 SER A 11 ? ? 58.13 16.06 48 20 GLU A 41 ? ? -69.23 99.45 # _pdbx_nmr_ensemble.entry_id 8DOA _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8DOA _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5 mM protein, 50 mM sodium phosphate, 150 mM sodium chloride, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 'Double label' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '0.5 mM protein' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium phosphate' 50 ? mM 'natural abundance' 1 'sodium chloride' 150 ? mM 'natural abundance' 1 protein 0.5 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'Double label' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCA' 1 isotropic 2 1 1 '3D CBCA(CO)NH' 1 isotropic 3 1 1 '3D HBHA(CO)NH' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '2D 1H-15N HSQC' 1 isotropic 8 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 7 1 1 '3D HCCH-TOCSY' 1 isotropic 6 1 1 '3D 1H-15N NOESY' 1 isotropic 9 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic # _pdbx_nmr_refine.entry_id 8DOA _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger A. T. et.al.' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' ABACUS ? 'Lemak and Arrowsmith' 4 'peak picking' Sparky ? Goddard # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLU N N N N 57 GLU CA C N S 58 GLU C C N N 59 GLU O O N N 60 GLU CB C N N 61 GLU CG C N N 62 GLU CD C N N 63 GLU OE1 O N N 64 GLU OE2 O N N 65 GLU OXT O N N 66 GLU H H N N 67 GLU H2 H N N 68 GLU HA H N N 69 GLU HB2 H N N 70 GLU HB3 H N N 71 GLU HG2 H N N 72 GLU HG3 H N N 73 GLU HE2 H N N 74 GLU HXT H N N 75 GLY N N N N 76 GLY CA C N N 77 GLY C C N N 78 GLY O O N N 79 GLY OXT O N N 80 GLY H H N N 81 GLY H2 H N N 82 GLY HA2 H N N 83 GLY HA3 H N N 84 GLY HXT H N N 85 HIS N N N N 86 HIS CA C N S 87 HIS C C N N 88 HIS O O N N 89 HIS CB C N N 90 HIS CG C Y N 91 HIS ND1 N Y N 92 HIS CD2 C Y N 93 HIS CE1 C Y N 94 HIS NE2 N Y N 95 HIS OXT O N N 96 HIS H H N N 97 HIS H2 H N N 98 HIS HA H N N 99 HIS HB2 H N N 100 HIS HB3 H N N 101 HIS HD1 H N N 102 HIS HD2 H N N 103 HIS HE1 H N N 104 HIS HE2 H N N 105 HIS HXT H N N 106 ILE N N N N 107 ILE CA C N S 108 ILE C C N N 109 ILE O O N N 110 ILE CB C N S 111 ILE CG1 C N N 112 ILE CG2 C N N 113 ILE CD1 C N N 114 ILE OXT O N N 115 ILE H H N N 116 ILE H2 H N N 117 ILE HA H N N 118 ILE HB H N N 119 ILE HG12 H N N 120 ILE HG13 H N N 121 ILE HG21 H N N 122 ILE HG22 H N N 123 ILE HG23 H N N 124 ILE HD11 H N N 125 ILE HD12 H N N 126 ILE HD13 H N N 127 ILE HXT H N N 128 LEU N N N N 129 LEU CA C N S 130 LEU C C N N 131 LEU O O N N 132 LEU CB C N N 133 LEU CG C N N 134 LEU CD1 C N N 135 LEU CD2 C N N 136 LEU OXT O N N 137 LEU H H N N 138 LEU H2 H N N 139 LEU HA H N N 140 LEU HB2 H N N 141 LEU HB3 H N N 142 LEU HG H N N 143 LEU HD11 H N N 144 LEU HD12 H N N 145 LEU HD13 H N N 146 LEU HD21 H N N 147 LEU HD22 H N N 148 LEU HD23 H N N 149 LEU HXT H N N 150 LYS N N N N 151 LYS CA C N S 152 LYS C C N N 153 LYS O O N N 154 LYS CB C N N 155 LYS CG C N N 156 LYS CD C N N 157 LYS CE C N N 158 LYS NZ N N N 159 LYS OXT O N N 160 LYS H H N N 161 LYS H2 H N N 162 LYS HA H N N 163 LYS HB2 H N N 164 LYS HB3 H N N 165 LYS HG2 H N N 166 LYS HG3 H N N 167 LYS HD2 H N N 168 LYS HD3 H N N 169 LYS HE2 H N N 170 LYS HE3 H N N 171 LYS HZ1 H N N 172 LYS HZ2 H N N 173 LYS HZ3 H N N 174 LYS HXT H N N 175 MET N N N N 176 MET CA C N S 177 MET C C N N 178 MET O O N N 179 MET CB C N N 180 MET CG C N N 181 MET SD S N N 182 MET CE C N N 183 MET OXT O N N 184 MET H H N N 185 MET H2 H N N 186 MET HA H N N 187 MET HB2 H N N 188 MET HB3 H N N 189 MET HG2 H N N 190 MET HG3 H N N 191 MET HE1 H N N 192 MET HE2 H N N 193 MET HE3 H N N 194 MET HXT H N N 195 PHE N N N N 196 PHE CA C N S 197 PHE C C N N 198 PHE O O N N 199 PHE CB C N N 200 PHE CG C Y N 201 PHE CD1 C Y N 202 PHE CD2 C Y N 203 PHE CE1 C Y N 204 PHE CE2 C Y N 205 PHE CZ C Y N 206 PHE OXT O N N 207 PHE H H N N 208 PHE H2 H N N 209 PHE HA H N N 210 PHE HB2 H N N 211 PHE HB3 H N N 212 PHE HD1 H N N 213 PHE HD2 H N N 214 PHE HE1 H N N 215 PHE HE2 H N N 216 PHE HZ H N N 217 PHE HXT H N N 218 PRO N N N N 219 PRO CA C N S 220 PRO C C N N 221 PRO O O N N 222 PRO CB C N N 223 PRO CG C N N 224 PRO CD C N N 225 PRO OXT O N N 226 PRO H H N N 227 PRO HA H N N 228 PRO HB2 H N N 229 PRO HB3 H N N 230 PRO HG2 H N N 231 PRO HG3 H N N 232 PRO HD2 H N N 233 PRO HD3 H N N 234 PRO HXT H N N 235 SER N N N N 236 SER CA C N S 237 SER C C N N 238 SER O O N N 239 SER CB C N N 240 SER OG O N N 241 SER OXT O N N 242 SER H H N N 243 SER H2 H N N 244 SER HA H N N 245 SER HB2 H N N 246 SER HB3 H N N 247 SER HG H N N 248 SER HXT H N N 249 TRP N N N N 250 TRP CA C N S 251 TRP C C N N 252 TRP O O N N 253 TRP CB C N N 254 TRP CG C Y N 255 TRP CD1 C Y N 256 TRP CD2 C Y N 257 TRP NE1 N Y N 258 TRP CE2 C Y N 259 TRP CE3 C Y N 260 TRP CZ2 C Y N 261 TRP CZ3 C Y N 262 TRP CH2 C Y N 263 TRP OXT O N N 264 TRP H H N N 265 TRP H2 H N N 266 TRP HA H N N 267 TRP HB2 H N N 268 TRP HB3 H N N 269 TRP HD1 H N N 270 TRP HE1 H N N 271 TRP HE3 H N N 272 TRP HZ2 H N N 273 TRP HZ3 H N N 274 TRP HH2 H N N 275 TRP HXT H N N 276 VAL N N N N 277 VAL CA C N S 278 VAL C C N N 279 VAL O O N N 280 VAL CB C N N 281 VAL CG1 C N N 282 VAL CG2 C N N 283 VAL OXT O N N 284 VAL H H N N 285 VAL H2 H N N 286 VAL HA H N N 287 VAL HB H N N 288 VAL HG11 H N N 289 VAL HG12 H N N 290 VAL HG13 H N N 291 VAL HG21 H N N 292 VAL HG22 H N N 293 VAL HG23 H N N 294 VAL HXT H N N 295 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLU N CA sing N N 54 GLU N H sing N N 55 GLU N H2 sing N N 56 GLU CA C sing N N 57 GLU CA CB sing N N 58 GLU CA HA sing N N 59 GLU C O doub N N 60 GLU C OXT sing N N 61 GLU CB CG sing N N 62 GLU CB HB2 sing N N 63 GLU CB HB3 sing N N 64 GLU CG CD sing N N 65 GLU CG HG2 sing N N 66 GLU CG HG3 sing N N 67 GLU CD OE1 doub N N 68 GLU CD OE2 sing N N 69 GLU OE2 HE2 sing N N 70 GLU OXT HXT sing N N 71 GLY N CA sing N N 72 GLY N H sing N N 73 GLY N H2 sing N N 74 GLY CA C sing N N 75 GLY CA HA2 sing N N 76 GLY CA HA3 sing N N 77 GLY C O doub N N 78 GLY C OXT sing N N 79 GLY OXT HXT sing N N 80 HIS N CA sing N N 81 HIS N H sing N N 82 HIS N H2 sing N N 83 HIS CA C sing N N 84 HIS CA CB sing N N 85 HIS CA HA sing N N 86 HIS C O doub N N 87 HIS C OXT sing N N 88 HIS CB CG sing N N 89 HIS CB HB2 sing N N 90 HIS CB HB3 sing N N 91 HIS CG ND1 sing Y N 92 HIS CG CD2 doub Y N 93 HIS ND1 CE1 doub Y N 94 HIS ND1 HD1 sing N N 95 HIS CD2 NE2 sing Y N 96 HIS CD2 HD2 sing N N 97 HIS CE1 NE2 sing Y N 98 HIS CE1 HE1 sing N N 99 HIS NE2 HE2 sing N N 100 HIS OXT HXT sing N N 101 ILE N CA sing N N 102 ILE N H sing N N 103 ILE N H2 sing N N 104 ILE CA C sing N N 105 ILE CA CB sing N N 106 ILE CA HA sing N N 107 ILE C O doub N N 108 ILE C OXT sing N N 109 ILE CB CG1 sing N N 110 ILE CB CG2 sing N N 111 ILE CB HB sing N N 112 ILE CG1 CD1 sing N N 113 ILE CG1 HG12 sing N N 114 ILE CG1 HG13 sing N N 115 ILE CG2 HG21 sing N N 116 ILE CG2 HG22 sing N N 117 ILE CG2 HG23 sing N N 118 ILE CD1 HD11 sing N N 119 ILE CD1 HD12 sing N N 120 ILE CD1 HD13 sing N N 121 ILE OXT HXT sing N N 122 LEU N CA sing N N 123 LEU N H sing N N 124 LEU N H2 sing N N 125 LEU CA C sing N N 126 LEU CA CB sing N N 127 LEU CA HA sing N N 128 LEU C O doub N N 129 LEU C OXT sing N N 130 LEU CB CG sing N N 131 LEU CB HB2 sing N N 132 LEU CB HB3 sing N N 133 LEU CG CD1 sing N N 134 LEU CG CD2 sing N N 135 LEU CG HG sing N N 136 LEU CD1 HD11 sing N N 137 LEU CD1 HD12 sing N N 138 LEU CD1 HD13 sing N N 139 LEU CD2 HD21 sing N N 140 LEU CD2 HD22 sing N N 141 LEU CD2 HD23 sing N N 142 LEU OXT HXT sing N N 143 LYS N CA sing N N 144 LYS N H sing N N 145 LYS N H2 sing N N 146 LYS CA C sing N N 147 LYS CA CB sing N N 148 LYS CA HA sing N N 149 LYS C O doub N N 150 LYS C OXT sing N N 151 LYS CB CG sing N N 152 LYS CB HB2 sing N N 153 LYS CB HB3 sing N N 154 LYS CG CD sing N N 155 LYS CG HG2 sing N N 156 LYS CG HG3 sing N N 157 LYS CD CE sing N N 158 LYS CD HD2 sing N N 159 LYS CD HD3 sing N N 160 LYS CE NZ sing N N 161 LYS CE HE2 sing N N 162 LYS CE HE3 sing N N 163 LYS NZ HZ1 sing N N 164 LYS NZ HZ2 sing N N 165 LYS NZ HZ3 sing N N 166 LYS OXT HXT sing N N 167 MET N CA sing N N 168 MET N H sing N N 169 MET N H2 sing N N 170 MET CA C sing N N 171 MET CA CB sing N N 172 MET CA HA sing N N 173 MET C O doub N N 174 MET C OXT sing N N 175 MET CB CG sing N N 176 MET CB HB2 sing N N 177 MET CB HB3 sing N N 178 MET CG SD sing N N 179 MET CG HG2 sing N N 180 MET CG HG3 sing N N 181 MET SD CE sing N N 182 MET CE HE1 sing N N 183 MET CE HE2 sing N N 184 MET CE HE3 sing N N 185 MET OXT HXT sing N N 186 PHE N CA sing N N 187 PHE N H sing N N 188 PHE N H2 sing N N 189 PHE CA C sing N N 190 PHE CA CB sing N N 191 PHE CA HA sing N N 192 PHE C O doub N N 193 PHE C OXT sing N N 194 PHE CB CG sing N N 195 PHE CB HB2 sing N N 196 PHE CB HB3 sing N N 197 PHE CG CD1 doub Y N 198 PHE CG CD2 sing Y N 199 PHE CD1 CE1 sing Y N 200 PHE CD1 HD1 sing N N 201 PHE CD2 CE2 doub Y N 202 PHE CD2 HD2 sing N N 203 PHE CE1 CZ doub Y N 204 PHE CE1 HE1 sing N N 205 PHE CE2 CZ sing Y N 206 PHE CE2 HE2 sing N N 207 PHE CZ HZ sing N N 208 PHE OXT HXT sing N N 209 PRO N CA sing N N 210 PRO N CD sing N N 211 PRO N H sing N N 212 PRO CA C sing N N 213 PRO CA CB sing N N 214 PRO CA HA sing N N 215 PRO C O doub N N 216 PRO C OXT sing N N 217 PRO CB CG sing N N 218 PRO CB HB2 sing N N 219 PRO CB HB3 sing N N 220 PRO CG CD sing N N 221 PRO CG HG2 sing N N 222 PRO CG HG3 sing N N 223 PRO CD HD2 sing N N 224 PRO CD HD3 sing N N 225 PRO OXT HXT sing N N 226 SER N CA sing N N 227 SER N H sing N N 228 SER N H2 sing N N 229 SER CA C sing N N 230 SER CA CB sing N N 231 SER CA HA sing N N 232 SER C O doub N N 233 SER C OXT sing N N 234 SER CB OG sing N N 235 SER CB HB2 sing N N 236 SER CB HB3 sing N N 237 SER OG HG sing N N 238 SER OXT HXT sing N N 239 TRP N CA sing N N 240 TRP N H sing N N 241 TRP N H2 sing N N 242 TRP CA C sing N N 243 TRP CA CB sing N N 244 TRP CA HA sing N N 245 TRP C O doub N N 246 TRP C OXT sing N N 247 TRP CB CG sing N N 248 TRP CB HB2 sing N N 249 TRP CB HB3 sing N N 250 TRP CG CD1 doub Y N 251 TRP CG CD2 sing Y N 252 TRP CD1 NE1 sing Y N 253 TRP CD1 HD1 sing N N 254 TRP CD2 CE2 doub Y N 255 TRP CD2 CE3 sing Y N 256 TRP NE1 CE2 sing Y N 257 TRP NE1 HE1 sing N N 258 TRP CE2 CZ2 sing Y N 259 TRP CE3 CZ3 doub Y N 260 TRP CE3 HE3 sing N N 261 TRP CZ2 CH2 doub Y N 262 TRP CZ2 HZ2 sing N N 263 TRP CZ3 CH2 sing Y N 264 TRP CZ3 HZ3 sing N N 265 TRP CH2 HH2 sing N N 266 TRP OXT HXT sing N N 267 VAL N CA sing N N 268 VAL N H sing N N 269 VAL N H2 sing N N 270 VAL CA C sing N N 271 VAL CA CB sing N N 272 VAL CA HA sing N N 273 VAL C O doub N N 274 VAL C OXT sing N N 275 VAL CB CG1 sing N N 276 VAL CB CG2 sing N N 277 VAL CB HB sing N N 278 VAL CG1 HG11 sing N N 279 VAL CG1 HG12 sing N N 280 VAL CG1 HG13 sing N N 281 VAL CG2 HG21 sing N N 282 VAL CG2 HG22 sing N N 283 VAL CG2 HG23 sing N N 284 VAL OXT HXT sing N N 285 # _pdbx_audit_support.funding_organization 'Canadian Institutes of Health Research (CIHR)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 8DOA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_