data_8DZ8 # _entry.id 8DZ8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8DZ8 pdb_00008dz8 10.2210/pdb8dz8/pdb WWPDB D_1000267595 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8DZ8 _pdbx_database_status.recvd_initial_deposition_date 2022-08-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jude, K.M.' 1 0000-0002-3675-5136 'Spangler, J.B.' 2 0000-0001-8187-3732 'Garcia, K.C.' 3 0000-0001-9273-0278 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Chem.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 19 _citation.language ? _citation.page_first 1127 _citation.page_last 1137 _citation.title 'Design of cell-type-specific hyperstable IL-4 mimetics via modular de novo scaffolds.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41589-023-01313-6 _citation.pdbx_database_id_PubMed 37024727 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, H.' 1 ? primary 'Ulge, U.Y.' 2 ? primary 'Quijano-Rubio, A.' 3 ? primary 'Bernstein, Z.J.' 4 ? primary 'Maestas, D.R.' 5 ? primary 'Chun, J.H.' 6 ? primary 'Wang, W.' 7 ? primary 'Lin, J.X.' 8 ? primary 'Jude, K.M.' 9 ? primary 'Singh, S.' 10 ? primary 'Orcutt-Jahns, B.T.' 11 ? primary 'Li, P.' 12 ? primary 'Mou, J.' 13 ? primary 'Chung, L.' 14 ? primary 'Kuo, Y.H.' 15 ? primary 'Ali, Y.H.' 16 ? primary 'Meyer, A.S.' 17 ? primary 'Grayson, W.L.' 18 ? primary 'Heller, N.M.' 19 ? primary 'Garcia, K.C.' 20 ? primary 'Leonard, W.J.' 21 ? primary 'Silva, D.A.' 22 ? primary 'Elisseeff, J.H.' 23 ? primary 'Baker, D.' 24 ? primary 'Spangler, J.B.' 25 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8DZ8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 122.477 _cell.length_a_esd ? _cell.length_b 122.477 _cell.length_b_esd ? _cell.length_c 310.376 _cell.length_c_esd ? _cell.volume 4032067.961 _cell.volume_esd ? _cell.Z_PDB 144 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8DZ8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ;R 3 2" ; _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description neoleukin-4 _entity.formula_weight 11760.483 _entity.pdbx_number_of_molecules 8 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPKKKIQIMAEEALKDALSILNIVKTNSPPAEEQLERFAKRFERNLWGIARLFESGDQKDEAEKAKRMIEWMKRIKTTAS EDEQEEMANAIITILQSWFFS ; _entity_poly.pdbx_seq_one_letter_code_can ;GPKKKIQIMAEEALKDALSILNIVKTNSPPAEEQLERFAKRFERNLWGIARLFESGDQKDEAEKAKRMIEWMKRIKTTAS EDEQEEMANAIITILQSWFFS ; _entity_poly.pdbx_strand_id A,B,C,D,E,F,G,H _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LYS n 1 4 LYS n 1 5 LYS n 1 6 ILE n 1 7 GLN n 1 8 ILE n 1 9 MET n 1 10 ALA n 1 11 GLU n 1 12 GLU n 1 13 ALA n 1 14 LEU n 1 15 LYS n 1 16 ASP n 1 17 ALA n 1 18 LEU n 1 19 SER n 1 20 ILE n 1 21 LEU n 1 22 ASN n 1 23 ILE n 1 24 VAL n 1 25 LYS n 1 26 THR n 1 27 ASN n 1 28 SER n 1 29 PRO n 1 30 PRO n 1 31 ALA n 1 32 GLU n 1 33 GLU n 1 34 GLN n 1 35 LEU n 1 36 GLU n 1 37 ARG n 1 38 PHE n 1 39 ALA n 1 40 LYS n 1 41 ARG n 1 42 PHE n 1 43 GLU n 1 44 ARG n 1 45 ASN n 1 46 LEU n 1 47 TRP n 1 48 GLY n 1 49 ILE n 1 50 ALA n 1 51 ARG n 1 52 LEU n 1 53 PHE n 1 54 GLU n 1 55 SER n 1 56 GLY n 1 57 ASP n 1 58 GLN n 1 59 LYS n 1 60 ASP n 1 61 GLU n 1 62 ALA n 1 63 GLU n 1 64 LYS n 1 65 ALA n 1 66 LYS n 1 67 ARG n 1 68 MET n 1 69 ILE n 1 70 GLU n 1 71 TRP n 1 72 MET n 1 73 LYS n 1 74 ARG n 1 75 ILE n 1 76 LYS n 1 77 THR n 1 78 THR n 1 79 ALA n 1 80 SER n 1 81 GLU n 1 82 ASP n 1 83 GLU n 1 84 GLN n 1 85 GLU n 1 86 GLU n 1 87 MET n 1 88 ALA n 1 89 ASN n 1 90 ALA n 1 91 ILE n 1 92 ILE n 1 93 THR n 1 94 ILE n 1 95 LEU n 1 96 GLN n 1 97 SER n 1 98 TRP n 1 99 PHE n 1 100 PHE n 1 101 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 101 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8DZ8 _struct_ref.pdbx_db_accession 8DZ8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8DZ8 A 1 ? 101 ? 8DZ8 1 ? 101 ? 1 101 2 1 8DZ8 B 1 ? 101 ? 8DZ8 1 ? 101 ? 1 101 3 1 8DZ8 C 1 ? 101 ? 8DZ8 1 ? 101 ? 1 101 4 1 8DZ8 D 1 ? 101 ? 8DZ8 1 ? 101 ? 1 101 5 1 8DZ8 E 1 ? 101 ? 8DZ8 1 ? 101 ? 1 101 6 1 8DZ8 F 1 ? 101 ? 8DZ8 1 ? 101 ? 1 101 7 1 8DZ8 G 1 ? 101 ? 8DZ8 1 ? 101 ? 1 101 8 1 8DZ8 H 1 ? 101 ? 8DZ8 1 ? 101 ? 1 101 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8DZ8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.38 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.1 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.5 M sodium chloride, 0.1 M sodium acetate, pH 5.1, 5% DMSO' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-03-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.033149 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.033149 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-B _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 112.95 _reflns.entry_id 8DZ8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.972 _reflns.d_resolution_low 40.91 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18828 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.76 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10 _reflns.pdbx_Rmerge_I_obs 0.1516 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.79 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1602 _reflns.pdbx_Rpim_I_all 0.05144 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.972 _reflns_shell.d_res_low 3.078 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.70 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1823 _reflns_shell.percent_possible_all 98.91 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 3.134 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 10.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 3.3 _reflns_shell.pdbx_Rpim_I_all 1.027 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.258 _reflns_shell.pdbx_CC_star 0.641 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 126.58 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8DZ8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.972 _refine.ls_d_res_low 40.91 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18817 _refine.ls_number_reflns_R_free 935 _refine.ls_number_reflns_R_work 17882 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.82 _refine.ls_percent_reflns_R_free 4.97 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2232 _refine.ls_R_factor_R_free 0.2605 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2213 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 6DG6' _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.2351 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4859 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.972 _refine_hist.d_res_low 40.91 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 5991 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 5991 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0040 ? 6072 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.6327 ? 8159 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0369 ? 923 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0041 ? 1035 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 19.8969 ? 2245 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' d_2 ? ? 0.736921548681 ? ? 1 'Torsion NCS' ? A ? ? ? ens_1 'X-RAY DIFFRACTION' d_3 ? ? 1.56269290188 ? ? 2 'Torsion NCS' ? A ? ? ? ens_1 'X-RAY DIFFRACTION' d_4 ? ? 1.19545509805 ? ? 3 'Torsion NCS' ? A ? ? ? ens_1 'X-RAY DIFFRACTION' d_5 ? ? 1.36676013384 ? ? 4 'Torsion NCS' ? A ? ? ? ens_1 'X-RAY DIFFRACTION' d_6 ? ? 1.55977854386 ? ? 5 'Torsion NCS' ? A ? ? ? ens_1 'X-RAY DIFFRACTION' d_7 ? ? 1.38818009292 ? ? 6 'Torsion NCS' ? A ? ? ? ens_1 'X-RAY DIFFRACTION' d_8 ? ? 1.45475430667 ? ? 7 'Torsion NCS' ? A ? ? ? ens_1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.972 3.13 . . 131 2502 99.25 . . . 0.3783 . 0.3406 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.13 3.32 . . 133 2515 100.00 . . . 0.3606 . 0.3043 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.33 3.58 . . 131 2529 100.00 . . . 0.3548 . 0.2858 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.58 3.94 . . 132 2532 99.92 . . . 0.2896 . 0.2389 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.94 4.51 . . 133 2557 99.93 . . . 0.2442 . 0.2103 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.51 5.68 . . 140 2570 99.89 . . . 0.2353 . 0.2316 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.68 40.91 . . 135 2677 99.75 . . . 0.2352 . 0.1866 . . . . . . . . . . . # loop_ _struct_ncs_oper.id _struct_ncs_oper.code _struct_ncs_oper.matrix[1][1] _struct_ncs_oper.matrix[1][2] _struct_ncs_oper.matrix[1][3] _struct_ncs_oper.matrix[2][1] _struct_ncs_oper.matrix[2][2] _struct_ncs_oper.matrix[2][3] _struct_ncs_oper.matrix[3][1] _struct_ncs_oper.matrix[3][2] _struct_ncs_oper.matrix[3][3] _struct_ncs_oper.vector[1] _struct_ncs_oper.vector[2] _struct_ncs_oper.vector[3] _struct_ncs_oper.details 1 given 0.00770032697521 0.630083459794 -0.776489239242 0.618511780695 -0.61315422505 -0.491411307811 -0.785737794755 -0.476483714305 -0.394435530723 118.338446304 72.9332683179 211.193627109 ? 2 given 0.560364375438 -0.153486785607 -0.813900223236 0.827872839517 0.074294638837 0.555973801747 -0.024866208577 -0.985353801071 0.168699609919 118.644038576 -80.762971674 128.210050393 ? 3 given -0.429208676536 -0.0888060158186 -0.898828906712 -0.405607520093 -0.870212842215 0.279664350408 -0.807008334301 0.484606129552 0.337482514466 191.060079473 66.661734713 100.627477663 ? 4 given 0.770629282154 -0.636226735579 -0.0366885598181 0.629157047358 0.768704981849 -0.115126281271 0.101449096821 0.0656368175256 0.992673102758 -11.4252483531 22.3141749767 7.36974859626 ? 5 given -0.340025492988 -0.364576750747 0.866871649631 -0.902325125112 -0.133211536784 -0.409956162363 0.264937790265 -0.92159561592 -0.283671443764 -69.7659237798 169.46381207 184.601283721 ? 6 given -0.0491801355545 0.649474678635 0.758791114918 0.250353771664 0.74347338166 -0.620137339447 -0.966904495429 0.159467779109 -0.199162557088 -110.188808801 101.456135402 196.136250487 ? 7 given 0.684304134794 -0.0788925133923 0.724916424448 0.434785605773 -0.753940498044 -0.492478631437 0.585396727114 0.652188390529 -0.481623270974 -116.160219958 133.265330201 131.888513949 ? # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details ens_1 d_1 ;(chain "A" and (resid 4 through 6 or (resid 7 and (name N or name CA or name C or name O or name CB )) or resid 8 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 25 or (resid 32 through 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 39 or (resid 40 through 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 43 or (resid 44 and (name N or name CA or name C or name O or name CB )) or resid 45 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 63 or (resid 64 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 98 or (resid 99 and (name N or name CA or name C or name O or name CB )))) ; ens_1 d_2 ;(chain "B" and ((resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 or (resid 7 and (name N or name CA or name C or name O or name CB )) or resid 8 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 25 or resid 32 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 39 or (resid 40 through 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 43 or (resid 44 and (name N or name CA or name C or name O or name CB )) or resid 45 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 63 or (resid 64 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 98 or (resid 99 and (name N or name CA or name C or name O or name CB )))) ; ens_1 d_3 ;(chain "C" and ((resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 or (resid 7 and (name N or name CA or name C or name O or name CB )) or resid 8 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 25 or (resid 32 through 34 and (name N or name CA or name C or name O or name CB )) or resid 35 or (resid 36 through 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 39 or (resid 40 through 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 43 or (resid 44 and (name N or name CA or name C or name O or name CB )) or resid 45 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 63 or (resid 64 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 98 or (resid 99 and (name N or name CA or name C or name O or name CB )))) ; ens_1 d_4 ;(chain "D" and ((resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 or (resid 7 and (name N or name CA or name C or name O or name CB )) or resid 8 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 25 or (resid 32 through 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 43 or (resid 44 and (name N or name CA or name C or name O or name CB )) or resid 45 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 63 or (resid 64 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 98 or (resid 99 and (name N or name CA or name C or name O or name CB )))) ; ens_1 d_5 ;(chain "E" and (resid 4 through 6 or (resid 7 and (name N or name CA or name C or name O or name CB )) or resid 8 through 25 or resid 32 through 35 or (resid 36 through 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 43 or (resid 44 and (name N or name CA or name C or name O or name CB )) or resid 45 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 or (resid 59 through 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 63 or (resid 64 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 98 or (resid 99 and (name N or name CA or name C or name O or name CB )))) ; ens_1 d_6 ;(chain "F" and ((resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 25 or (resid 32 through 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 43 or (resid 44 and (name N or name CA or name C or name O or name CB )) or resid 45 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 98 or (resid 99 and (name N or name CA or name C or name O or name CB )))) ; ens_1 d_7 ;(chain "G" and (resid 4 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 25 or (resid 32 through 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 63 or (resid 64 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 98 or (resid 99 and (name N or name CA or name C or name O or name CB )))) ; ens_1 d_8 ;(chain "H" and ((resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 25 or (resid 32 through 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 99)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.end_auth_comp_id ens_1 d_1 1 . A LYS 2 . A LYS 23 ? ? ? ? ? ? ? ? ens_1 d_1 2 . A GLU 30 . A PHE 97 ? ? ? ? ? ? ? ? ens_1 d_2 1 . B LYS 3 . B LYS 24 ? ? ? ? ? ? ? ? ens_1 d_2 2 . B GLU 27 . B PHE 94 ? ? ? ? ? ? ? ? ens_1 d_3 1 . C LYS 2 . C LYS 23 ? ? ? ? ? ? ? ? ens_1 d_3 2 . C GLU 28 . C PHE 95 ? ? ? ? ? ? ? ? ens_1 d_4 1 . D LYS 1 . D LYS 22 ? ? ? ? ? ? ? ? ens_1 d_4 2 . D GLU 29 . D PHE 96 ? ? ? ? ? ? ? ? ens_1 d_5 1 . E LYS 2 . E LYS 23 ? ? ? ? ? ? ? ? ens_1 d_5 2 . E GLU 30 . E PHE 97 ? ? ? ? ? ? ? ? ens_1 d_6 1 . F LYS 3 . F LYS 24 ? ? ? ? ? ? ? ? ens_1 d_6 2 . F GLU 27 . F PHE 94 ? ? ? ? ? ? ? ? ens_1 d_7 1 . G LYS 2 . G LYS 23 ? ? ? ? ? ? ? ? ens_1 d_7 2 . G GLU 26 . G PHE 93 ? ? ? ? ? ? ? ? ens_1 d_8 1 . H LYS 2 . H LYS 23 ? ? ? ? ? ? ? ? ens_1 d_8 2 . H GLU 27 . H PHE 94 ? ? ? ? ? ? ? ? # _struct_ncs_ens.id ens_1 _struct_ncs_ens.details ? # loop_ _struct_ncs_ens_gen.ens_id _struct_ncs_ens_gen.dom_id_1 _struct_ncs_ens_gen.dom_id_2 _struct_ncs_ens_gen.oper_id ens_1 d_2 d_1 1 ens_1 d_3 d_1 2 ens_1 d_4 d_1 3 ens_1 d_5 d_1 4 ens_1 d_6 d_1 5 ens_1 d_7 d_1 6 ens_1 d_8 d_1 7 # _struct.entry_id 8DZ8 _struct.title 'Neoleukin 4, a de novo designed IL-4 mimetic' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8DZ8 _struct_keywords.text 'designed protein, cytokine, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? G N N 1 ? H N N 1 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 6 ? ASN A 27 ? ILE A 6 ASN A 27 1 ? 22 HELX_P HELX_P2 AA2 ALA A 31 ? GLY A 56 ? ALA A 31 GLY A 56 1 ? 26 HELX_P HELX_P3 AA3 GLN A 58 ? THR A 78 ? GLN A 58 THR A 78 1 ? 21 HELX_P HELX_P4 AA4 SER A 80 ? TRP A 98 ? SER A 80 TRP A 98 1 ? 19 HELX_P HELX_P5 AA5 LYS B 3 ? ASN B 27 ? LYS B 3 ASN B 27 1 ? 25 HELX_P HELX_P6 AA6 GLU B 33 ? GLY B 56 ? GLU B 33 GLY B 56 1 ? 24 HELX_P HELX_P7 AA7 GLN B 58 ? THR B 78 ? GLN B 58 THR B 78 1 ? 21 HELX_P HELX_P8 AA8 SER B 80 ? TRP B 98 ? SER B 80 TRP B 98 1 ? 19 HELX_P HELX_P9 AA9 LYS C 4 ? ASN C 27 ? LYS C 4 ASN C 27 1 ? 24 HELX_P HELX_P10 AB1 GLU C 32 ? GLY C 56 ? GLU C 32 GLY C 56 1 ? 25 HELX_P HELX_P11 AB2 GLN C 58 ? THR C 78 ? GLN C 58 THR C 78 1 ? 21 HELX_P HELX_P12 AB3 SER C 80 ? PHE C 99 ? SER C 80 PHE C 99 1 ? 20 HELX_P HELX_P13 AB4 LYS D 5 ? ASN D 27 ? LYS D 5 ASN D 27 1 ? 23 HELX_P HELX_P14 AB5 ALA D 31 ? GLY D 56 ? ALA D 31 GLY D 56 1 ? 26 HELX_P HELX_P15 AB6 GLN D 58 ? THR D 78 ? GLN D 58 THR D 78 1 ? 21 HELX_P HELX_P16 AB7 SER D 80 ? SER D 97 ? SER D 80 SER D 97 1 ? 18 HELX_P HELX_P17 AB8 ILE E 6 ? LYS E 25 ? ILE E 6 LYS E 25 1 ? 20 HELX_P HELX_P18 AB9 ALA E 31 ? GLY E 56 ? ALA E 31 GLY E 56 1 ? 26 HELX_P HELX_P19 AC1 GLN E 58 ? THR E 78 ? GLN E 58 THR E 78 1 ? 21 HELX_P HELX_P20 AC2 SER E 80 ? TRP E 98 ? SER E 80 TRP E 98 1 ? 19 HELX_P HELX_P21 AC3 LYS F 3 ? LYS F 25 ? LYS F 3 LYS F 25 1 ? 23 HELX_P HELX_P22 AC4 GLU F 32 ? GLY F 56 ? GLU F 32 GLY F 56 1 ? 25 HELX_P HELX_P23 AC5 GLN F 58 ? THR F 78 ? GLN F 58 THR F 78 1 ? 21 HELX_P HELX_P24 AC6 SER F 80 ? PHE F 100 ? SER F 80 PHE F 100 1 ? 21 HELX_P HELX_P25 AC7 LYS G 4 ? LYS G 25 ? LYS G 4 LYS G 25 1 ? 22 HELX_P HELX_P26 AC8 GLN G 34 ? GLY G 56 ? GLN G 34 GLY G 56 1 ? 23 HELX_P HELX_P27 AC9 GLN G 58 ? THR G 78 ? GLN G 58 THR G 78 1 ? 21 HELX_P HELX_P28 AD1 SER G 80 ? TRP G 98 ? SER G 80 TRP G 98 1 ? 19 HELX_P HELX_P29 AD2 LYS H 4 ? LYS H 25 ? LYS H 4 LYS H 25 1 ? 22 HELX_P HELX_P30 AD3 ALA H 31 ? GLY H 56 ? ALA H 31 GLY H 56 1 ? 26 HELX_P HELX_P31 AD4 LYS H 59 ? THR H 78 ? LYS H 59 THR H 78 1 ? 20 HELX_P HELX_P32 AD5 SER H 80 ? PHE H 99 ? SER H 80 PHE H 99 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 8DZ8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008165 _atom_sites.fract_transf_matrix[1][2] 0.004714 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009428 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003222 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 TRP 71 71 71 TRP TRP A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 TRP 98 98 98 TRP TRP A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 PHE 100 100 ? ? ? A . n A 1 101 SER 101 101 ? ? ? A . n B 1 1 GLY 1 1 ? ? ? B . n B 1 2 PRO 2 2 2 PRO PRO B . n B 1 3 LYS 3 3 3 LYS LYS B . n B 1 4 LYS 4 4 4 LYS LYS B . n B 1 5 LYS 5 5 5 LYS LYS B . n B 1 6 ILE 6 6 6 ILE ILE B . n B 1 7 GLN 7 7 7 GLN GLN B . n B 1 8 ILE 8 8 8 ILE ILE B . n B 1 9 MET 9 9 9 MET MET B . n B 1 10 ALA 10 10 10 ALA ALA B . n B 1 11 GLU 11 11 11 GLU GLU B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 ALA 13 13 13 ALA ALA B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 LYS 15 15 15 LYS LYS B . n B 1 16 ASP 16 16 16 ASP ASP B . n B 1 17 ALA 17 17 17 ALA ALA B . n B 1 18 LEU 18 18 18 LEU LEU B . n B 1 19 SER 19 19 19 SER SER B . n B 1 20 ILE 20 20 20 ILE ILE B . n B 1 21 LEU 21 21 21 LEU LEU B . n B 1 22 ASN 22 22 22 ASN ASN B . n B 1 23 ILE 23 23 23 ILE ILE B . n B 1 24 VAL 24 24 24 VAL VAL B . n B 1 25 LYS 25 25 25 LYS LYS B . n B 1 26 THR 26 26 26 THR THR B . n B 1 27 ASN 27 27 27 ASN ASN B . n B 1 28 SER 28 28 ? ? ? B . n B 1 29 PRO 29 29 ? ? ? B . n B 1 30 PRO 30 30 ? ? ? B . n B 1 31 ALA 31 31 ? ? ? B . n B 1 32 GLU 32 32 32 GLU GLU B . n B 1 33 GLU 33 33 33 GLU GLU B . n B 1 34 GLN 34 34 34 GLN GLN B . n B 1 35 LEU 35 35 35 LEU LEU B . n B 1 36 GLU 36 36 36 GLU GLU B . n B 1 37 ARG 37 37 37 ARG ARG B . n B 1 38 PHE 38 38 38 PHE PHE B . n B 1 39 ALA 39 39 39 ALA ALA B . n B 1 40 LYS 40 40 40 LYS LYS B . n B 1 41 ARG 41 41 41 ARG ARG B . n B 1 42 PHE 42 42 42 PHE PHE B . n B 1 43 GLU 43 43 43 GLU GLU B . n B 1 44 ARG 44 44 44 ARG ARG B . n B 1 45 ASN 45 45 45 ASN ASN B . n B 1 46 LEU 46 46 46 LEU LEU B . n B 1 47 TRP 47 47 47 TRP TRP B . n B 1 48 GLY 48 48 48 GLY GLY B . n B 1 49 ILE 49 49 49 ILE ILE B . n B 1 50 ALA 50 50 50 ALA ALA B . n B 1 51 ARG 51 51 51 ARG ARG B . n B 1 52 LEU 52 52 52 LEU LEU B . n B 1 53 PHE 53 53 53 PHE PHE B . n B 1 54 GLU 54 54 54 GLU GLU B . n B 1 55 SER 55 55 55 SER SER B . n B 1 56 GLY 56 56 56 GLY GLY B . n B 1 57 ASP 57 57 57 ASP ASP B . n B 1 58 GLN 58 58 58 GLN GLN B . n B 1 59 LYS 59 59 59 LYS LYS B . n B 1 60 ASP 60 60 60 ASP ASP B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 ALA 62 62 62 ALA ALA B . n B 1 63 GLU 63 63 63 GLU GLU B . n B 1 64 LYS 64 64 64 LYS LYS B . n B 1 65 ALA 65 65 65 ALA ALA B . n B 1 66 LYS 66 66 66 LYS LYS B . n B 1 67 ARG 67 67 67 ARG ARG B . n B 1 68 MET 68 68 68 MET MET B . n B 1 69 ILE 69 69 69 ILE ILE B . n B 1 70 GLU 70 70 70 GLU GLU B . n B 1 71 TRP 71 71 71 TRP TRP B . n B 1 72 MET 72 72 72 MET MET B . n B 1 73 LYS 73 73 73 LYS LYS B . n B 1 74 ARG 74 74 74 ARG ARG B . n B 1 75 ILE 75 75 75 ILE ILE B . n B 1 76 LYS 76 76 76 LYS LYS B . n B 1 77 THR 77 77 77 THR THR B . n B 1 78 THR 78 78 78 THR THR B . n B 1 79 ALA 79 79 79 ALA ALA B . n B 1 80 SER 80 80 80 SER SER B . n B 1 81 GLU 81 81 81 GLU GLU B . n B 1 82 ASP 82 82 82 ASP ASP B . n B 1 83 GLU 83 83 83 GLU GLU B . n B 1 84 GLN 84 84 84 GLN GLN B . n B 1 85 GLU 85 85 85 GLU GLU B . n B 1 86 GLU 86 86 86 GLU GLU B . n B 1 87 MET 87 87 87 MET MET B . n B 1 88 ALA 88 88 88 ALA ALA B . n B 1 89 ASN 89 89 89 ASN ASN B . n B 1 90 ALA 90 90 90 ALA ALA B . n B 1 91 ILE 91 91 91 ILE ILE B . n B 1 92 ILE 92 92 92 ILE ILE B . n B 1 93 THR 93 93 93 THR THR B . n B 1 94 ILE 94 94 94 ILE ILE B . n B 1 95 LEU 95 95 95 LEU LEU B . n B 1 96 GLN 96 96 96 GLN GLN B . n B 1 97 SER 97 97 97 SER SER B . n B 1 98 TRP 98 98 98 TRP TRP B . n B 1 99 PHE 99 99 99 PHE PHE B . n B 1 100 PHE 100 100 ? ? ? B . n B 1 101 SER 101 101 ? ? ? B . n C 1 1 GLY 1 1 ? ? ? C . n C 1 2 PRO 2 2 ? ? ? C . n C 1 3 LYS 3 3 3 LYS LYS C . n C 1 4 LYS 4 4 4 LYS LYS C . n C 1 5 LYS 5 5 5 LYS LYS C . n C 1 6 ILE 6 6 6 ILE ILE C . n C 1 7 GLN 7 7 7 GLN GLN C . n C 1 8 ILE 8 8 8 ILE ILE C . n C 1 9 MET 9 9 9 MET MET C . n C 1 10 ALA 10 10 10 ALA ALA C . n C 1 11 GLU 11 11 11 GLU GLU C . n C 1 12 GLU 12 12 12 GLU GLU C . n C 1 13 ALA 13 13 13 ALA ALA C . n C 1 14 LEU 14 14 14 LEU LEU C . n C 1 15 LYS 15 15 15 LYS LYS C . n C 1 16 ASP 16 16 16 ASP ASP C . n C 1 17 ALA 17 17 17 ALA ALA C . n C 1 18 LEU 18 18 18 LEU LEU C . n C 1 19 SER 19 19 19 SER SER C . n C 1 20 ILE 20 20 20 ILE ILE C . n C 1 21 LEU 21 21 21 LEU LEU C . n C 1 22 ASN 22 22 22 ASN ASN C . n C 1 23 ILE 23 23 23 ILE ILE C . n C 1 24 VAL 24 24 24 VAL VAL C . n C 1 25 LYS 25 25 25 LYS LYS C . n C 1 26 THR 26 26 26 THR THR C . n C 1 27 ASN 27 27 27 ASN ASN C . n C 1 28 SER 28 28 28 SER SER C . n C 1 29 PRO 29 29 ? ? ? C . n C 1 30 PRO 30 30 ? ? ? C . n C 1 31 ALA 31 31 31 ALA ALA C . n C 1 32 GLU 32 32 32 GLU GLU C . n C 1 33 GLU 33 33 33 GLU GLU C . n C 1 34 GLN 34 34 34 GLN GLN C . n C 1 35 LEU 35 35 35 LEU LEU C . n C 1 36 GLU 36 36 36 GLU GLU C . n C 1 37 ARG 37 37 37 ARG ARG C . n C 1 38 PHE 38 38 38 PHE PHE C . n C 1 39 ALA 39 39 39 ALA ALA C . n C 1 40 LYS 40 40 40 LYS LYS C . n C 1 41 ARG 41 41 41 ARG ARG C . n C 1 42 PHE 42 42 42 PHE PHE C . n C 1 43 GLU 43 43 43 GLU GLU C . n C 1 44 ARG 44 44 44 ARG ARG C . n C 1 45 ASN 45 45 45 ASN ASN C . n C 1 46 LEU 46 46 46 LEU LEU C . n C 1 47 TRP 47 47 47 TRP TRP C . n C 1 48 GLY 48 48 48 GLY GLY C . n C 1 49 ILE 49 49 49 ILE ILE C . n C 1 50 ALA 50 50 50 ALA ALA C . n C 1 51 ARG 51 51 51 ARG ARG C . n C 1 52 LEU 52 52 52 LEU LEU C . n C 1 53 PHE 53 53 53 PHE PHE C . n C 1 54 GLU 54 54 54 GLU GLU C . n C 1 55 SER 55 55 55 SER SER C . n C 1 56 GLY 56 56 56 GLY GLY C . n C 1 57 ASP 57 57 57 ASP ASP C . n C 1 58 GLN 58 58 58 GLN GLN C . n C 1 59 LYS 59 59 59 LYS LYS C . n C 1 60 ASP 60 60 60 ASP ASP C . n C 1 61 GLU 61 61 61 GLU GLU C . n C 1 62 ALA 62 62 62 ALA ALA C . n C 1 63 GLU 63 63 63 GLU GLU C . n C 1 64 LYS 64 64 64 LYS LYS C . n C 1 65 ALA 65 65 65 ALA ALA C . n C 1 66 LYS 66 66 66 LYS LYS C . n C 1 67 ARG 67 67 67 ARG ARG C . n C 1 68 MET 68 68 68 MET MET C . n C 1 69 ILE 69 69 69 ILE ILE C . n C 1 70 GLU 70 70 70 GLU GLU C . n C 1 71 TRP 71 71 71 TRP TRP C . n C 1 72 MET 72 72 72 MET MET C . n C 1 73 LYS 73 73 73 LYS LYS C . n C 1 74 ARG 74 74 74 ARG ARG C . n C 1 75 ILE 75 75 75 ILE ILE C . n C 1 76 LYS 76 76 76 LYS LYS C . n C 1 77 THR 77 77 77 THR THR C . n C 1 78 THR 78 78 78 THR THR C . n C 1 79 ALA 79 79 79 ALA ALA C . n C 1 80 SER 80 80 80 SER SER C . n C 1 81 GLU 81 81 81 GLU GLU C . n C 1 82 ASP 82 82 82 ASP ASP C . n C 1 83 GLU 83 83 83 GLU GLU C . n C 1 84 GLN 84 84 84 GLN GLN C . n C 1 85 GLU 85 85 85 GLU GLU C . n C 1 86 GLU 86 86 86 GLU GLU C . n C 1 87 MET 87 87 87 MET MET C . n C 1 88 ALA 88 88 88 ALA ALA C . n C 1 89 ASN 89 89 89 ASN ASN C . n C 1 90 ALA 90 90 90 ALA ALA C . n C 1 91 ILE 91 91 91 ILE ILE C . n C 1 92 ILE 92 92 92 ILE ILE C . n C 1 93 THR 93 93 93 THR THR C . n C 1 94 ILE 94 94 94 ILE ILE C . n C 1 95 LEU 95 95 95 LEU LEU C . n C 1 96 GLN 96 96 96 GLN GLN C . n C 1 97 SER 97 97 97 SER SER C . n C 1 98 TRP 98 98 98 TRP TRP C . n C 1 99 PHE 99 99 99 PHE PHE C . n C 1 100 PHE 100 100 100 PHE PHE C . n C 1 101 SER 101 101 ? ? ? C . n D 1 1 GLY 1 1 ? ? ? D . n D 1 2 PRO 2 2 ? ? ? D . n D 1 3 LYS 3 3 ? ? ? D . n D 1 4 LYS 4 4 4 LYS LYS D . n D 1 5 LYS 5 5 5 LYS LYS D . n D 1 6 ILE 6 6 6 ILE ILE D . n D 1 7 GLN 7 7 7 GLN GLN D . n D 1 8 ILE 8 8 8 ILE ILE D . n D 1 9 MET 9 9 9 MET MET D . n D 1 10 ALA 10 10 10 ALA ALA D . n D 1 11 GLU 11 11 11 GLU GLU D . n D 1 12 GLU 12 12 12 GLU GLU D . n D 1 13 ALA 13 13 13 ALA ALA D . n D 1 14 LEU 14 14 14 LEU LEU D . n D 1 15 LYS 15 15 15 LYS LYS D . n D 1 16 ASP 16 16 16 ASP ASP D . n D 1 17 ALA 17 17 17 ALA ALA D . n D 1 18 LEU 18 18 18 LEU LEU D . n D 1 19 SER 19 19 19 SER SER D . n D 1 20 ILE 20 20 20 ILE ILE D . n D 1 21 LEU 21 21 21 LEU LEU D . n D 1 22 ASN 22 22 22 ASN ASN D . n D 1 23 ILE 23 23 23 ILE ILE D . n D 1 24 VAL 24 24 24 VAL VAL D . n D 1 25 LYS 25 25 25 LYS LYS D . n D 1 26 THR 26 26 26 THR THR D . n D 1 27 ASN 27 27 27 ASN ASN D . n D 1 28 SER 28 28 28 SER SER D . n D 1 29 PRO 29 29 29 PRO PRO D . n D 1 30 PRO 30 30 30 PRO PRO D . n D 1 31 ALA 31 31 31 ALA ALA D . n D 1 32 GLU 32 32 32 GLU GLU D . n D 1 33 GLU 33 33 33 GLU GLU D . n D 1 34 GLN 34 34 34 GLN GLN D . n D 1 35 LEU 35 35 35 LEU LEU D . n D 1 36 GLU 36 36 36 GLU GLU D . n D 1 37 ARG 37 37 37 ARG ARG D . n D 1 38 PHE 38 38 38 PHE PHE D . n D 1 39 ALA 39 39 39 ALA ALA D . n D 1 40 LYS 40 40 40 LYS LYS D . n D 1 41 ARG 41 41 41 ARG ARG D . n D 1 42 PHE 42 42 42 PHE PHE D . n D 1 43 GLU 43 43 43 GLU GLU D . n D 1 44 ARG 44 44 44 ARG ARG D . n D 1 45 ASN 45 45 45 ASN ASN D . n D 1 46 LEU 46 46 46 LEU LEU D . n D 1 47 TRP 47 47 47 TRP TRP D . n D 1 48 GLY 48 48 48 GLY GLY D . n D 1 49 ILE 49 49 49 ILE ILE D . n D 1 50 ALA 50 50 50 ALA ALA D . n D 1 51 ARG 51 51 51 ARG ARG D . n D 1 52 LEU 52 52 52 LEU LEU D . n D 1 53 PHE 53 53 53 PHE PHE D . n D 1 54 GLU 54 54 54 GLU GLU D . n D 1 55 SER 55 55 55 SER SER D . n D 1 56 GLY 56 56 56 GLY GLY D . n D 1 57 ASP 57 57 57 ASP ASP D . n D 1 58 GLN 58 58 58 GLN GLN D . n D 1 59 LYS 59 59 59 LYS LYS D . n D 1 60 ASP 60 60 60 ASP ASP D . n D 1 61 GLU 61 61 61 GLU GLU D . n D 1 62 ALA 62 62 62 ALA ALA D . n D 1 63 GLU 63 63 63 GLU GLU D . n D 1 64 LYS 64 64 64 LYS LYS D . n D 1 65 ALA 65 65 65 ALA ALA D . n D 1 66 LYS 66 66 66 LYS LYS D . n D 1 67 ARG 67 67 67 ARG ARG D . n D 1 68 MET 68 68 68 MET MET D . n D 1 69 ILE 69 69 69 ILE ILE D . n D 1 70 GLU 70 70 70 GLU GLU D . n D 1 71 TRP 71 71 71 TRP TRP D . n D 1 72 MET 72 72 72 MET MET D . n D 1 73 LYS 73 73 73 LYS LYS D . n D 1 74 ARG 74 74 74 ARG ARG D . n D 1 75 ILE 75 75 75 ILE ILE D . n D 1 76 LYS 76 76 76 LYS LYS D . n D 1 77 THR 77 77 77 THR THR D . n D 1 78 THR 78 78 78 THR THR D . n D 1 79 ALA 79 79 79 ALA ALA D . n D 1 80 SER 80 80 80 SER SER D . n D 1 81 GLU 81 81 81 GLU GLU D . n D 1 82 ASP 82 82 82 ASP ASP D . n D 1 83 GLU 83 83 83 GLU GLU D . n D 1 84 GLN 84 84 84 GLN GLN D . n D 1 85 GLU 85 85 85 GLU GLU D . n D 1 86 GLU 86 86 86 GLU GLU D . n D 1 87 MET 87 87 87 MET MET D . n D 1 88 ALA 88 88 88 ALA ALA D . n D 1 89 ASN 89 89 89 ASN ASN D . n D 1 90 ALA 90 90 90 ALA ALA D . n D 1 91 ILE 91 91 91 ILE ILE D . n D 1 92 ILE 92 92 92 ILE ILE D . n D 1 93 THR 93 93 93 THR THR D . n D 1 94 ILE 94 94 94 ILE ILE D . n D 1 95 LEU 95 95 95 LEU LEU D . n D 1 96 GLN 96 96 96 GLN GLN D . n D 1 97 SER 97 97 97 SER SER D . n D 1 98 TRP 98 98 98 TRP TRP D . n D 1 99 PHE 99 99 99 PHE PHE D . n D 1 100 PHE 100 100 100 PHE PHE D . n D 1 101 SER 101 101 ? ? ? D . n E 1 1 GLY 1 1 ? ? ? E . n E 1 2 PRO 2 2 ? ? ? E . n E 1 3 LYS 3 3 3 LYS LYS E . n E 1 4 LYS 4 4 4 LYS LYS E . n E 1 5 LYS 5 5 5 LYS LYS E . n E 1 6 ILE 6 6 6 ILE ILE E . n E 1 7 GLN 7 7 7 GLN GLN E . n E 1 8 ILE 8 8 8 ILE ILE E . n E 1 9 MET 9 9 9 MET MET E . n E 1 10 ALA 10 10 10 ALA ALA E . n E 1 11 GLU 11 11 11 GLU GLU E . n E 1 12 GLU 12 12 12 GLU GLU E . n E 1 13 ALA 13 13 13 ALA ALA E . n E 1 14 LEU 14 14 14 LEU LEU E . n E 1 15 LYS 15 15 15 LYS LYS E . n E 1 16 ASP 16 16 16 ASP ASP E . n E 1 17 ALA 17 17 17 ALA ALA E . n E 1 18 LEU 18 18 18 LEU LEU E . n E 1 19 SER 19 19 19 SER SER E . n E 1 20 ILE 20 20 20 ILE ILE E . n E 1 21 LEU 21 21 21 LEU LEU E . n E 1 22 ASN 22 22 22 ASN ASN E . n E 1 23 ILE 23 23 23 ILE ILE E . n E 1 24 VAL 24 24 24 VAL VAL E . n E 1 25 LYS 25 25 25 LYS LYS E . n E 1 26 THR 26 26 26 THR THR E . n E 1 27 ASN 27 27 27 ASN ASN E . n E 1 28 SER 28 28 28 SER SER E . n E 1 29 PRO 29 29 29 PRO PRO E . n E 1 30 PRO 30 30 30 PRO PRO E . n E 1 31 ALA 31 31 31 ALA ALA E . n E 1 32 GLU 32 32 32 GLU GLU E . n E 1 33 GLU 33 33 33 GLU GLU E . n E 1 34 GLN 34 34 34 GLN GLN E . n E 1 35 LEU 35 35 35 LEU LEU E . n E 1 36 GLU 36 36 36 GLU GLU E . n E 1 37 ARG 37 37 37 ARG ARG E . n E 1 38 PHE 38 38 38 PHE PHE E . n E 1 39 ALA 39 39 39 ALA ALA E . n E 1 40 LYS 40 40 40 LYS LYS E . n E 1 41 ARG 41 41 41 ARG ARG E . n E 1 42 PHE 42 42 42 PHE PHE E . n E 1 43 GLU 43 43 43 GLU GLU E . n E 1 44 ARG 44 44 44 ARG ARG E . n E 1 45 ASN 45 45 45 ASN ASN E . n E 1 46 LEU 46 46 46 LEU LEU E . n E 1 47 TRP 47 47 47 TRP TRP E . n E 1 48 GLY 48 48 48 GLY GLY E . n E 1 49 ILE 49 49 49 ILE ILE E . n E 1 50 ALA 50 50 50 ALA ALA E . n E 1 51 ARG 51 51 51 ARG ARG E . n E 1 52 LEU 52 52 52 LEU LEU E . n E 1 53 PHE 53 53 53 PHE PHE E . n E 1 54 GLU 54 54 54 GLU GLU E . n E 1 55 SER 55 55 55 SER SER E . n E 1 56 GLY 56 56 56 GLY GLY E . n E 1 57 ASP 57 57 57 ASP ASP E . n E 1 58 GLN 58 58 58 GLN GLN E . n E 1 59 LYS 59 59 59 LYS LYS E . n E 1 60 ASP 60 60 60 ASP ASP E . n E 1 61 GLU 61 61 61 GLU GLU E . n E 1 62 ALA 62 62 62 ALA ALA E . n E 1 63 GLU 63 63 63 GLU GLU E . n E 1 64 LYS 64 64 64 LYS LYS E . n E 1 65 ALA 65 65 65 ALA ALA E . n E 1 66 LYS 66 66 66 LYS LYS E . n E 1 67 ARG 67 67 67 ARG ARG E . n E 1 68 MET 68 68 68 MET MET E . n E 1 69 ILE 69 69 69 ILE ILE E . n E 1 70 GLU 70 70 70 GLU GLU E . n E 1 71 TRP 71 71 71 TRP TRP E . n E 1 72 MET 72 72 72 MET MET E . n E 1 73 LYS 73 73 73 LYS LYS E . n E 1 74 ARG 74 74 74 ARG ARG E . n E 1 75 ILE 75 75 75 ILE ILE E . n E 1 76 LYS 76 76 76 LYS LYS E . n E 1 77 THR 77 77 77 THR THR E . n E 1 78 THR 78 78 78 THR THR E . n E 1 79 ALA 79 79 79 ALA ALA E . n E 1 80 SER 80 80 80 SER SER E . n E 1 81 GLU 81 81 81 GLU GLU E . n E 1 82 ASP 82 82 82 ASP ASP E . n E 1 83 GLU 83 83 83 GLU GLU E . n E 1 84 GLN 84 84 84 GLN GLN E . n E 1 85 GLU 85 85 85 GLU GLU E . n E 1 86 GLU 86 86 86 GLU GLU E . n E 1 87 MET 87 87 87 MET MET E . n E 1 88 ALA 88 88 88 ALA ALA E . n E 1 89 ASN 89 89 89 ASN ASN E . n E 1 90 ALA 90 90 90 ALA ALA E . n E 1 91 ILE 91 91 91 ILE ILE E . n E 1 92 ILE 92 92 92 ILE ILE E . n E 1 93 THR 93 93 93 THR THR E . n E 1 94 ILE 94 94 94 ILE ILE E . n E 1 95 LEU 95 95 95 LEU LEU E . n E 1 96 GLN 96 96 96 GLN GLN E . n E 1 97 SER 97 97 97 SER SER E . n E 1 98 TRP 98 98 98 TRP TRP E . n E 1 99 PHE 99 99 99 PHE PHE E . n E 1 100 PHE 100 100 100 PHE PHE E . n E 1 101 SER 101 101 ? ? ? E . n F 1 1 GLY 1 1 ? ? ? F . n F 1 2 PRO 2 2 2 PRO PRO F . n F 1 3 LYS 3 3 3 LYS LYS F . n F 1 4 LYS 4 4 4 LYS LYS F . n F 1 5 LYS 5 5 5 LYS LYS F . n F 1 6 ILE 6 6 6 ILE ILE F . n F 1 7 GLN 7 7 7 GLN GLN F . n F 1 8 ILE 8 8 8 ILE ILE F . n F 1 9 MET 9 9 9 MET MET F . n F 1 10 ALA 10 10 10 ALA ALA F . n F 1 11 GLU 11 11 11 GLU GLU F . n F 1 12 GLU 12 12 12 GLU GLU F . n F 1 13 ALA 13 13 13 ALA ALA F . n F 1 14 LEU 14 14 14 LEU LEU F . n F 1 15 LYS 15 15 15 LYS LYS F . n F 1 16 ASP 16 16 16 ASP ASP F . n F 1 17 ALA 17 17 17 ALA ALA F . n F 1 18 LEU 18 18 18 LEU LEU F . n F 1 19 SER 19 19 19 SER SER F . n F 1 20 ILE 20 20 20 ILE ILE F . n F 1 21 LEU 21 21 21 LEU LEU F . n F 1 22 ASN 22 22 22 ASN ASN F . n F 1 23 ILE 23 23 23 ILE ILE F . n F 1 24 VAL 24 24 24 VAL VAL F . n F 1 25 LYS 25 25 25 LYS LYS F . n F 1 26 THR 26 26 ? ? ? F . n F 1 27 ASN 27 27 ? ? ? F . n F 1 28 SER 28 28 ? ? ? F . n F 1 29 PRO 29 29 ? ? ? F . n F 1 30 PRO 30 30 30 PRO PRO F . n F 1 31 ALA 31 31 31 ALA ALA F . n F 1 32 GLU 32 32 32 GLU GLU F . n F 1 33 GLU 33 33 33 GLU GLU F . n F 1 34 GLN 34 34 34 GLN GLN F . n F 1 35 LEU 35 35 35 LEU LEU F . n F 1 36 GLU 36 36 36 GLU GLU F . n F 1 37 ARG 37 37 37 ARG ARG F . n F 1 38 PHE 38 38 38 PHE PHE F . n F 1 39 ALA 39 39 39 ALA ALA F . n F 1 40 LYS 40 40 40 LYS LYS F . n F 1 41 ARG 41 41 41 ARG ARG F . n F 1 42 PHE 42 42 42 PHE PHE F . n F 1 43 GLU 43 43 43 GLU GLU F . n F 1 44 ARG 44 44 44 ARG ARG F . n F 1 45 ASN 45 45 45 ASN ASN F . n F 1 46 LEU 46 46 46 LEU LEU F . n F 1 47 TRP 47 47 47 TRP TRP F . n F 1 48 GLY 48 48 48 GLY GLY F . n F 1 49 ILE 49 49 49 ILE ILE F . n F 1 50 ALA 50 50 50 ALA ALA F . n F 1 51 ARG 51 51 51 ARG ARG F . n F 1 52 LEU 52 52 52 LEU LEU F . n F 1 53 PHE 53 53 53 PHE PHE F . n F 1 54 GLU 54 54 54 GLU GLU F . n F 1 55 SER 55 55 55 SER SER F . n F 1 56 GLY 56 56 56 GLY GLY F . n F 1 57 ASP 57 57 57 ASP ASP F . n F 1 58 GLN 58 58 58 GLN GLN F . n F 1 59 LYS 59 59 59 LYS LYS F . n F 1 60 ASP 60 60 60 ASP ASP F . n F 1 61 GLU 61 61 61 GLU GLU F . n F 1 62 ALA 62 62 62 ALA ALA F . n F 1 63 GLU 63 63 63 GLU GLU F . n F 1 64 LYS 64 64 64 LYS LYS F . n F 1 65 ALA 65 65 65 ALA ALA F . n F 1 66 LYS 66 66 66 LYS LYS F . n F 1 67 ARG 67 67 67 ARG ARG F . n F 1 68 MET 68 68 68 MET MET F . n F 1 69 ILE 69 69 69 ILE ILE F . n F 1 70 GLU 70 70 70 GLU GLU F . n F 1 71 TRP 71 71 71 TRP TRP F . n F 1 72 MET 72 72 72 MET MET F . n F 1 73 LYS 73 73 73 LYS LYS F . n F 1 74 ARG 74 74 74 ARG ARG F . n F 1 75 ILE 75 75 75 ILE ILE F . n F 1 76 LYS 76 76 76 LYS LYS F . n F 1 77 THR 77 77 77 THR THR F . n F 1 78 THR 78 78 78 THR THR F . n F 1 79 ALA 79 79 79 ALA ALA F . n F 1 80 SER 80 80 80 SER SER F . n F 1 81 GLU 81 81 81 GLU GLU F . n F 1 82 ASP 82 82 82 ASP ASP F . n F 1 83 GLU 83 83 83 GLU GLU F . n F 1 84 GLN 84 84 84 GLN GLN F . n F 1 85 GLU 85 85 85 GLU GLU F . n F 1 86 GLU 86 86 86 GLU GLU F . n F 1 87 MET 87 87 87 MET MET F . n F 1 88 ALA 88 88 88 ALA ALA F . n F 1 89 ASN 89 89 89 ASN ASN F . n F 1 90 ALA 90 90 90 ALA ALA F . n F 1 91 ILE 91 91 91 ILE ILE F . n F 1 92 ILE 92 92 92 ILE ILE F . n F 1 93 THR 93 93 93 THR THR F . n F 1 94 ILE 94 94 94 ILE ILE F . n F 1 95 LEU 95 95 95 LEU LEU F . n F 1 96 GLN 96 96 96 GLN GLN F . n F 1 97 SER 97 97 97 SER SER F . n F 1 98 TRP 98 98 98 TRP TRP F . n F 1 99 PHE 99 99 99 PHE PHE F . n F 1 100 PHE 100 100 100 PHE PHE F . n F 1 101 SER 101 101 ? ? ? F . n G 1 1 GLY 1 1 ? ? ? G . n G 1 2 PRO 2 2 ? ? ? G . n G 1 3 LYS 3 3 3 LYS LYS G . n G 1 4 LYS 4 4 4 LYS LYS G . n G 1 5 LYS 5 5 5 LYS LYS G . n G 1 6 ILE 6 6 6 ILE ILE G . n G 1 7 GLN 7 7 7 GLN GLN G . n G 1 8 ILE 8 8 8 ILE ILE G . n G 1 9 MET 9 9 9 MET MET G . n G 1 10 ALA 10 10 10 ALA ALA G . n G 1 11 GLU 11 11 11 GLU GLU G . n G 1 12 GLU 12 12 12 GLU GLU G . n G 1 13 ALA 13 13 13 ALA ALA G . n G 1 14 LEU 14 14 14 LEU LEU G . n G 1 15 LYS 15 15 15 LYS LYS G . n G 1 16 ASP 16 16 16 ASP ASP G . n G 1 17 ALA 17 17 17 ALA ALA G . n G 1 18 LEU 18 18 18 LEU LEU G . n G 1 19 SER 19 19 19 SER SER G . n G 1 20 ILE 20 20 20 ILE ILE G . n G 1 21 LEU 21 21 21 LEU LEU G . n G 1 22 ASN 22 22 22 ASN ASN G . n G 1 23 ILE 23 23 23 ILE ILE G . n G 1 24 VAL 24 24 24 VAL VAL G . n G 1 25 LYS 25 25 25 LYS LYS G . n G 1 26 THR 26 26 ? ? ? G . n G 1 27 ASN 27 27 ? ? ? G . n G 1 28 SER 28 28 ? ? ? G . n G 1 29 PRO 29 29 ? ? ? G . n G 1 30 PRO 30 30 30 PRO PRO G . n G 1 31 ALA 31 31 31 ALA ALA G . n G 1 32 GLU 32 32 32 GLU GLU G . n G 1 33 GLU 33 33 33 GLU GLU G . n G 1 34 GLN 34 34 34 GLN GLN G . n G 1 35 LEU 35 35 35 LEU LEU G . n G 1 36 GLU 36 36 36 GLU GLU G . n G 1 37 ARG 37 37 37 ARG ARG G . n G 1 38 PHE 38 38 38 PHE PHE G . n G 1 39 ALA 39 39 39 ALA ALA G . n G 1 40 LYS 40 40 40 LYS LYS G . n G 1 41 ARG 41 41 41 ARG ARG G . n G 1 42 PHE 42 42 42 PHE PHE G . n G 1 43 GLU 43 43 43 GLU GLU G . n G 1 44 ARG 44 44 44 ARG ARG G . n G 1 45 ASN 45 45 45 ASN ASN G . n G 1 46 LEU 46 46 46 LEU LEU G . n G 1 47 TRP 47 47 47 TRP TRP G . n G 1 48 GLY 48 48 48 GLY GLY G . n G 1 49 ILE 49 49 49 ILE ILE G . n G 1 50 ALA 50 50 50 ALA ALA G . n G 1 51 ARG 51 51 51 ARG ARG G . n G 1 52 LEU 52 52 52 LEU LEU G . n G 1 53 PHE 53 53 53 PHE PHE G . n G 1 54 GLU 54 54 54 GLU GLU G . n G 1 55 SER 55 55 55 SER SER G . n G 1 56 GLY 56 56 56 GLY GLY G . n G 1 57 ASP 57 57 57 ASP ASP G . n G 1 58 GLN 58 58 58 GLN GLN G . n G 1 59 LYS 59 59 59 LYS LYS G . n G 1 60 ASP 60 60 60 ASP ASP G . n G 1 61 GLU 61 61 61 GLU GLU G . n G 1 62 ALA 62 62 62 ALA ALA G . n G 1 63 GLU 63 63 63 GLU GLU G . n G 1 64 LYS 64 64 64 LYS LYS G . n G 1 65 ALA 65 65 65 ALA ALA G . n G 1 66 LYS 66 66 66 LYS LYS G . n G 1 67 ARG 67 67 67 ARG ARG G . n G 1 68 MET 68 68 68 MET MET G . n G 1 69 ILE 69 69 69 ILE ILE G . n G 1 70 GLU 70 70 70 GLU GLU G . n G 1 71 TRP 71 71 71 TRP TRP G . n G 1 72 MET 72 72 72 MET MET G . n G 1 73 LYS 73 73 73 LYS LYS G . n G 1 74 ARG 74 74 74 ARG ARG G . n G 1 75 ILE 75 75 75 ILE ILE G . n G 1 76 LYS 76 76 76 LYS LYS G . n G 1 77 THR 77 77 77 THR THR G . n G 1 78 THR 78 78 78 THR THR G . n G 1 79 ALA 79 79 79 ALA ALA G . n G 1 80 SER 80 80 80 SER SER G . n G 1 81 GLU 81 81 81 GLU GLU G . n G 1 82 ASP 82 82 82 ASP ASP G . n G 1 83 GLU 83 83 83 GLU GLU G . n G 1 84 GLN 84 84 84 GLN GLN G . n G 1 85 GLU 85 85 85 GLU GLU G . n G 1 86 GLU 86 86 86 GLU GLU G . n G 1 87 MET 87 87 87 MET MET G . n G 1 88 ALA 88 88 88 ALA ALA G . n G 1 89 ASN 89 89 89 ASN ASN G . n G 1 90 ALA 90 90 90 ALA ALA G . n G 1 91 ILE 91 91 91 ILE ILE G . n G 1 92 ILE 92 92 92 ILE ILE G . n G 1 93 THR 93 93 93 THR THR G . n G 1 94 ILE 94 94 94 ILE ILE G . n G 1 95 LEU 95 95 95 LEU LEU G . n G 1 96 GLN 96 96 96 GLN GLN G . n G 1 97 SER 97 97 97 SER SER G . n G 1 98 TRP 98 98 98 TRP TRP G . n G 1 99 PHE 99 99 99 PHE PHE G . n G 1 100 PHE 100 100 100 PHE PHE G . n G 1 101 SER 101 101 ? ? ? G . n H 1 1 GLY 1 1 ? ? ? H . n H 1 2 PRO 2 2 ? ? ? H . n H 1 3 LYS 3 3 3 LYS LYS H . n H 1 4 LYS 4 4 4 LYS LYS H . n H 1 5 LYS 5 5 5 LYS LYS H . n H 1 6 ILE 6 6 6 ILE ILE H . n H 1 7 GLN 7 7 7 GLN GLN H . n H 1 8 ILE 8 8 8 ILE ILE H . n H 1 9 MET 9 9 9 MET MET H . n H 1 10 ALA 10 10 10 ALA ALA H . n H 1 11 GLU 11 11 11 GLU GLU H . n H 1 12 GLU 12 12 12 GLU GLU H . n H 1 13 ALA 13 13 13 ALA ALA H . n H 1 14 LEU 14 14 14 LEU LEU H . n H 1 15 LYS 15 15 15 LYS LYS H . n H 1 16 ASP 16 16 16 ASP ASP H . n H 1 17 ALA 17 17 17 ALA ALA H . n H 1 18 LEU 18 18 18 LEU LEU H . n H 1 19 SER 19 19 19 SER SER H . n H 1 20 ILE 20 20 20 ILE ILE H . n H 1 21 LEU 21 21 21 LEU LEU H . n H 1 22 ASN 22 22 22 ASN ASN H . n H 1 23 ILE 23 23 23 ILE ILE H . n H 1 24 VAL 24 24 24 VAL VAL H . n H 1 25 LYS 25 25 25 LYS LYS H . n H 1 26 THR 26 26 26 THR THR H . n H 1 27 ASN 27 27 ? ? ? H . n H 1 28 SER 28 28 ? ? ? H . n H 1 29 PRO 29 29 ? ? ? H . n H 1 30 PRO 30 30 30 PRO PRO H . n H 1 31 ALA 31 31 31 ALA ALA H . n H 1 32 GLU 32 32 32 GLU GLU H . n H 1 33 GLU 33 33 33 GLU GLU H . n H 1 34 GLN 34 34 34 GLN GLN H . n H 1 35 LEU 35 35 35 LEU LEU H . n H 1 36 GLU 36 36 36 GLU GLU H . n H 1 37 ARG 37 37 37 ARG ARG H . n H 1 38 PHE 38 38 38 PHE PHE H . n H 1 39 ALA 39 39 39 ALA ALA H . n H 1 40 LYS 40 40 40 LYS LYS H . n H 1 41 ARG 41 41 41 ARG ARG H . n H 1 42 PHE 42 42 42 PHE PHE H . n H 1 43 GLU 43 43 43 GLU GLU H . n H 1 44 ARG 44 44 44 ARG ARG H . n H 1 45 ASN 45 45 45 ASN ASN H . n H 1 46 LEU 46 46 46 LEU LEU H . n H 1 47 TRP 47 47 47 TRP TRP H . n H 1 48 GLY 48 48 48 GLY GLY H . n H 1 49 ILE 49 49 49 ILE ILE H . n H 1 50 ALA 50 50 50 ALA ALA H . n H 1 51 ARG 51 51 51 ARG ARG H . n H 1 52 LEU 52 52 52 LEU LEU H . n H 1 53 PHE 53 53 53 PHE PHE H . n H 1 54 GLU 54 54 54 GLU GLU H . n H 1 55 SER 55 55 55 SER SER H . n H 1 56 GLY 56 56 56 GLY GLY H . n H 1 57 ASP 57 57 57 ASP ASP H . n H 1 58 GLN 58 58 58 GLN GLN H . n H 1 59 LYS 59 59 59 LYS LYS H . n H 1 60 ASP 60 60 60 ASP ASP H . n H 1 61 GLU 61 61 61 GLU GLU H . n H 1 62 ALA 62 62 62 ALA ALA H . n H 1 63 GLU 63 63 63 GLU GLU H . n H 1 64 LYS 64 64 64 LYS LYS H . n H 1 65 ALA 65 65 65 ALA ALA H . n H 1 66 LYS 66 66 66 LYS LYS H . n H 1 67 ARG 67 67 67 ARG ARG H . n H 1 68 MET 68 68 68 MET MET H . n H 1 69 ILE 69 69 69 ILE ILE H . n H 1 70 GLU 70 70 70 GLU GLU H . n H 1 71 TRP 71 71 71 TRP TRP H . n H 1 72 MET 72 72 72 MET MET H . n H 1 73 LYS 73 73 73 LYS LYS H . n H 1 74 ARG 74 74 74 ARG ARG H . n H 1 75 ILE 75 75 75 ILE ILE H . n H 1 76 LYS 76 76 76 LYS LYS H . n H 1 77 THR 77 77 77 THR THR H . n H 1 78 THR 78 78 78 THR THR H . n H 1 79 ALA 79 79 79 ALA ALA H . n H 1 80 SER 80 80 80 SER SER H . n H 1 81 GLU 81 81 81 GLU GLU H . n H 1 82 ASP 82 82 82 ASP ASP H . n H 1 83 GLU 83 83 83 GLU GLU H . n H 1 84 GLN 84 84 84 GLN GLN H . n H 1 85 GLU 85 85 85 GLU GLU H . n H 1 86 GLU 86 86 86 GLU GLU H . n H 1 87 MET 87 87 87 MET MET H . n H 1 88 ALA 88 88 88 ALA ALA H . n H 1 89 ASN 89 89 89 ASN ASN H . n H 1 90 ALA 90 90 90 ALA ALA H . n H 1 91 ILE 91 91 91 ILE ILE H . n H 1 92 ILE 92 92 92 ILE ILE H . n H 1 93 THR 93 93 93 THR THR H . n H 1 94 ILE 94 94 94 ILE ILE H . n H 1 95 LEU 95 95 95 LEU LEU H . n H 1 96 GLN 96 96 96 GLN GLN H . n H 1 97 SER 97 97 97 SER SER H . n H 1 98 TRP 98 98 98 TRP TRP H . n H 1 99 PHE 99 99 99 PHE PHE H . n H 1 100 PHE 100 100 ? ? ? H . n H 1 101 SER 101 101 ? ? ? H . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email kcgarcia@stanford.edu _pdbx_contact_author.name_first K _pdbx_contact_author.name_last Garcia _pdbx_contact_author.name_mi C _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9273-0278 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 author_defined_assembly ? monomeric 1 4 author_defined_assembly ? monomeric 1 5 author_defined_assembly ? monomeric 1 6 author_defined_assembly ? monomeric 1 7 author_defined_assembly ? monomeric 1 8 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A 2 1 B 3 1 C 4 1 D 5 1 E 6 1 F 7 1 G 8 1 H # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-03-29 2 'Structure model' 1 1 2023-04-26 3 'Structure model' 1 2 2023-09-06 4 'Structure model' 1 3 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' citation 6 3 'Structure model' citation_author 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 3 'Structure model' '_citation_author.identifier_ORCID' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z 3 -x+y,-x,z 4 x-y,-y,-z 5 -x,-x+y,-z 6 y,x,-z 7 x+1/3,y+2/3,z+2/3 8 -y+1/3,x-y+2/3,z+2/3 9 -x+y+1/3,-x+2/3,z+2/3 10 x-y+1/3,-y+2/3,-z+2/3 11 -x+1/3,-x+y+2/3,-z+2/3 12 y+1/3,x+2/3,-z+2/3 13 x+2/3,y+1/3,z+1/3 14 -y+2/3,x-y+1/3,z+1/3 15 -x+y+2/3,-x+1/3,z+1/3 16 x-y+2/3,-y+1/3,-z+1/3 17 -x+2/3,-x+y+1/3,-z+1/3 18 y+2/3,x+1/3,-z+1/3 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 41.1776230317 28.217951688 139.153938935 0.884475687052 ? 0.00896203252828 ? -0.0595904543677 ? 0.893875344774 ? -0.128348853111 ? 0.843851826192 ? 5.26623334199 ? 1.05629073842 ? 0.749733810078 ? 9.28288491872 ? -0.280997570498 ? 7.57814608094 ? 0.234601516074 ? -0.0116055272517 ? 0.219888068409 ? 0.455649968824 ? -0.409074812713 ? 0.0324622679202 ? -0.392007979084 ? 0.155181586368 ? 0.132079594178 ? 2 'X-RAY DIFFRACTION' ? refined 28.1710391981 12.0260488075 111.184573644 0.908751426099 ? 0.010403256953 ? -0.206670830465 ? 0.899863196386 ? -0.0701575868739 ? 0.971948367715 ? 8.71458149777 ? 0.94965832862 ? -1.01981900008 ? 8.71356030518 ? 3.01352518924 ? 7.08352747855 ? -0.236950890422 ? 0.0318547669205 ? -0.347300584117 ? -0.354950842629 ? -0.375879111509 ? -0.142653202627 ? -0.163044750576 ? 0.22517586537 ? 0.0822577613136 ? 3 'X-RAY DIFFRACTION' ? refined 23.88409031 32.503349243 122.891654593 0.904522404608 ? 0.163857544375 ? 0.00347202309293 ? 1.06135382789 ? -0.125786377937 ? 0.949210874114 ? 1.47213301613 ? -1.94450466736 ? 1.64078980922 ? 6.02691873092 ? 2.10034048733 ? 8.23701720598 ? 0.0641224184141 ? 0.637912132036 ? -0.187213926348 ? 0.282266289576 ? -0.133552545768 ? 0.469434303866 ? -0.292759284587 ? -0.338419670351 ? 0.0588502087726 ? 4 'X-RAY DIFFRACTION' ? refined 45.7045170377 64.5029697123 128.040115333 0.855771477141 ? -0.0435356157834 ? 0.00811049122428 ? 0.986528438149 ? 0.0275330294279 ? 0.978172652019 ? 7.45387818553 ? -3.05138435384 ? 1.0863735829 ? 4.66350042888 ? -3.68131250996 ? 5.75250978319 ? -0.0399123062347 ? 0.203509838518 ? 0.00254020515178 ? 0.209171557603 ? -0.0851600699971 ? 0.357332252865 ? 0.0877984313447 ? -0.0957470382391 ? 0.07073655001 ? 5 'X-RAY DIFFRACTION' ? refined -2.65921961735 53.6822663963 151.792179607 1.15901814869 ? 0.0769805721728 ? -0.0378118744962 ? 0.851705449269 ? -0.0146139911457 ? 0.771038196202 ? 7.50356120948 ? 0.350186046614 ? 2.1829835178 ? 8.80059469007 ? -1.11561479039 ? 7.77708024336 ? 0.148053088355 ? -0.0704281612006 ? 0.164471692996 ? -0.716213298304 ? -0.184053013206 ? 0.338997670706 ? 0.0799524094189 ? -0.205785579098 ? -0.02336538337 ? 6 'X-RAY DIFFRACTION' ? refined 27.0116429062 72.1876870333 129.785674723 0.882490000057 ? 0.118124432382 ? 0.0718523110538 ? 0.842006017049 ? -0.0976625731708 ? 1.10878780453 ? 10.0242548628 ? 3.11160466435 ? -2.30872197773 ? 5.61212028925 ? 2.16678100317 ? 6.71953755811 ? 0.0172241566279 ? 0.0960184366386 ? 0.774405752948 ? 0.399593791549 ? 0.213437787653 ? -0.395561825976 ? -0.0425781055798 ? -0.0179946700506 ? 0.0432953103684 ? 7 'X-RAY DIFFRACTION' ? refined 11.9863651512 46.0253881067 133.570967799 1.18227316268 ? 0.172259971844 ? 0.119762581828 ? 0.856056443127 ? -0.0568898580696 ? 1.22205667028 ? 4.3366002725 ? -0.195302173801 ? 0.254176432308 ? 3.23343820327 ? -0.69168555608 ? 6.2083832715 ? -0.193065192373 ? -0.415666528102 ? -0.568011164498 ? 0.538987450853 ? 0.101816764599 ? 0.460818572579 ? 0.528748897349 ? -0.244150158664 ? -0.000716867114176 ? 8 'X-RAY DIFFRACTION' ? refined 10.8027607196 61.3821490595 107.352249025 0.95167996895 ? 0.131787621511 ? 0.146919764894 ? 1.40040576876 ? -0.0436019517154 ? 1.05655789062 ? 7.24890452011 ? 1.86929838923 ? 3.64076822293 ? 5.31919231137 ? 0.956017648305 ? 4.4258126254 ? 0.154239475601 ? 0.443639678926 ? -0.142881508585 ? -0.0734073101519 ? -0.114924740334 ? 0.320658289665 ? 0.0131516394509 ? -0.246648039094 ? -0.0659234167823 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 3 ? A 97 A 99 ? ? '(chain A )' 2 'X-RAY DIFFRACTION' 2 B 1 B 2 ? B 94 B 99 ? ? '(chain B )' 3 'X-RAY DIFFRACTION' 3 C 1 C 3 ? C 96 C 100 ? ? '(chain C )' 4 'X-RAY DIFFRACTION' 4 D 1 D 4 ? D 97 D 100 ? ? '(chain D )' 5 'X-RAY DIFFRACTION' 5 E 1 E 3 ? E 98 E 100 ? ? '(chain E )' 6 'X-RAY DIFFRACTION' 6 F 1 F 2 ? F 95 F 100 ? ? '(chain F )' 7 'X-RAY DIFFRACTION' 7 G 1 G 3 ? G 94 G 100 ? ? '(chain G )' 8 'X-RAY DIFFRACTION' 8 H 1 H 3 ? H 94 H 99 ? ? '(chain H )' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.3 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'Jan 26, 2018' 5 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NE2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLN _pdbx_validate_symm_contact.auth_seq_id_1 96 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OG _pdbx_validate_symm_contact.auth_asym_id_2 D _pdbx_validate_symm_contact.auth_comp_id_2 SER _pdbx_validate_symm_contact.auth_seq_id_2 55 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_655 _pdbx_validate_symm_contact.dist 2.10 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 31 ? ? -66.73 89.08 2 1 GLN A 58 ? ? -107.81 77.06 3 1 GLN B 58 ? ? -107.46 74.85 4 1 GLN C 58 ? ? -106.62 75.90 5 1 GLN D 58 ? ? -105.85 75.44 6 1 ALA E 31 ? ? -140.23 59.50 7 1 GLN E 58 ? ? -106.51 70.84 8 1 PHE E 99 ? ? -140.80 58.08 9 1 GLU F 32 ? ? -140.29 -31.39 10 1 GLN F 58 ? ? -111.28 72.29 11 1 GLN G 58 ? ? -106.15 74.11 12 1 ASP H 60 ? ? -63.41 -72.59 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 3 ? CG ? A LYS 3 CG 2 1 Y 1 A LYS 3 ? CD ? A LYS 3 CD 3 1 Y 1 A LYS 3 ? CE ? A LYS 3 CE 4 1 Y 1 A LYS 3 ? NZ ? A LYS 3 NZ 5 1 Y 1 A LYS 4 ? CG ? A LYS 4 CG 6 1 Y 1 A LYS 4 ? CD ? A LYS 4 CD 7 1 Y 1 A LYS 4 ? CE ? A LYS 4 CE 8 1 Y 1 A LYS 4 ? NZ ? A LYS 4 NZ 9 1 Y 1 A LYS 5 ? CG ? A LYS 5 CG 10 1 Y 1 A LYS 5 ? CD ? A LYS 5 CD 11 1 Y 1 A LYS 5 ? CE ? A LYS 5 CE 12 1 Y 1 A LYS 5 ? NZ ? A LYS 5 NZ 13 1 Y 1 A GLU 32 ? CG ? A GLU 32 CG 14 1 Y 1 A GLU 32 ? CD ? A GLU 32 CD 15 1 Y 1 A GLU 32 ? OE1 ? A GLU 32 OE1 16 1 Y 1 A GLU 32 ? OE2 ? A GLU 32 OE2 17 1 Y 1 A GLU 33 ? CG ? A GLU 33 CG 18 1 Y 1 A GLU 33 ? CD ? A GLU 33 CD 19 1 Y 1 A GLU 33 ? OE1 ? A GLU 33 OE1 20 1 Y 1 A GLU 33 ? OE2 ? A GLU 33 OE2 21 1 Y 1 A GLU 36 ? CG ? A GLU 36 CG 22 1 Y 1 A GLU 36 ? CD ? A GLU 36 CD 23 1 Y 1 A GLU 36 ? OE1 ? A GLU 36 OE1 24 1 Y 1 A GLU 36 ? OE2 ? A GLU 36 OE2 25 1 Y 1 A LYS 59 ? CG ? A LYS 59 CG 26 1 Y 1 A LYS 59 ? CD ? A LYS 59 CD 27 1 Y 1 A LYS 59 ? CE ? A LYS 59 CE 28 1 Y 1 A LYS 59 ? NZ ? A LYS 59 NZ 29 1 Y 1 A GLU 81 ? CG ? A GLU 81 CG 30 1 Y 1 A GLU 81 ? CD ? A GLU 81 CD 31 1 Y 1 A GLU 81 ? OE1 ? A GLU 81 OE1 32 1 Y 1 A GLU 81 ? OE2 ? A GLU 81 OE2 33 1 Y 1 B GLU 32 ? CG ? B GLU 32 CG 34 1 Y 1 B GLU 32 ? CD ? B GLU 32 CD 35 1 Y 1 B GLU 32 ? OE1 ? B GLU 32 OE1 36 1 Y 1 B GLU 32 ? OE2 ? B GLU 32 OE2 37 1 Y 1 B GLU 33 ? CG ? B GLU 33 CG 38 1 Y 1 B GLU 33 ? CD ? B GLU 33 CD 39 1 Y 1 B GLU 33 ? OE1 ? B GLU 33 OE1 40 1 Y 1 B GLU 33 ? OE2 ? B GLU 33 OE2 41 1 Y 1 B GLN 34 ? CG ? B GLN 34 CG 42 1 Y 1 B GLN 34 ? CD ? B GLN 34 CD 43 1 Y 1 B GLN 34 ? OE1 ? B GLN 34 OE1 44 1 Y 1 B GLN 34 ? NE2 ? B GLN 34 NE2 45 1 Y 1 B GLU 36 ? CG ? B GLU 36 CG 46 1 Y 1 B GLU 36 ? CD ? B GLU 36 CD 47 1 Y 1 B GLU 36 ? OE1 ? B GLU 36 OE1 48 1 Y 1 B GLU 36 ? OE2 ? B GLU 36 OE2 49 1 Y 1 B LYS 59 ? CG ? B LYS 59 CG 50 1 Y 1 B LYS 59 ? CD ? B LYS 59 CD 51 1 Y 1 B LYS 59 ? CE ? B LYS 59 CE 52 1 Y 1 B LYS 59 ? NZ ? B LYS 59 NZ 53 1 Y 1 C LYS 3 ? CG ? C LYS 3 CG 54 1 Y 1 C LYS 3 ? CD ? C LYS 3 CD 55 1 Y 1 C LYS 3 ? CE ? C LYS 3 CE 56 1 Y 1 C LYS 3 ? NZ ? C LYS 3 NZ 57 1 Y 1 C GLU 32 ? CG ? C GLU 32 CG 58 1 Y 1 C GLU 32 ? CD ? C GLU 32 CD 59 1 Y 1 C GLU 32 ? OE1 ? C GLU 32 OE1 60 1 Y 1 C GLU 32 ? OE2 ? C GLU 32 OE2 61 1 Y 1 C GLU 33 ? CG ? C GLU 33 CG 62 1 Y 1 C GLU 33 ? CD ? C GLU 33 CD 63 1 Y 1 C GLU 33 ? OE1 ? C GLU 33 OE1 64 1 Y 1 C GLU 33 ? OE2 ? C GLU 33 OE2 65 1 Y 1 C ARG 37 ? CG ? C ARG 37 CG 66 1 Y 1 C ARG 37 ? CD ? C ARG 37 CD 67 1 Y 1 C ARG 37 ? NE ? C ARG 37 NE 68 1 Y 1 C ARG 37 ? CZ ? C ARG 37 CZ 69 1 Y 1 C ARG 37 ? NH1 ? C ARG 37 NH1 70 1 Y 1 C ARG 37 ? NH2 ? C ARG 37 NH2 71 1 Y 1 C GLU 54 ? CG ? C GLU 54 CG 72 1 Y 1 C GLU 54 ? CD ? C GLU 54 CD 73 1 Y 1 C GLU 54 ? OE1 ? C GLU 54 OE1 74 1 Y 1 C GLU 54 ? OE2 ? C GLU 54 OE2 75 1 Y 1 C LYS 59 ? CG ? C LYS 59 CG 76 1 Y 1 C LYS 59 ? CD ? C LYS 59 CD 77 1 Y 1 C LYS 59 ? CE ? C LYS 59 CE 78 1 Y 1 C LYS 59 ? NZ ? C LYS 59 NZ 79 1 Y 1 C PHE 100 ? CG ? C PHE 100 CG 80 1 Y 1 C PHE 100 ? CD1 ? C PHE 100 CD1 81 1 Y 1 C PHE 100 ? CD2 ? C PHE 100 CD2 82 1 Y 1 C PHE 100 ? CE1 ? C PHE 100 CE1 83 1 Y 1 C PHE 100 ? CE2 ? C PHE 100 CE2 84 1 Y 1 C PHE 100 ? CZ ? C PHE 100 CZ 85 1 Y 1 D GLU 33 ? CG ? D GLU 33 CG 86 1 Y 1 D GLU 33 ? CD ? D GLU 33 CD 87 1 Y 1 D GLU 33 ? OE1 ? D GLU 33 OE1 88 1 Y 1 D GLU 33 ? OE2 ? D GLU 33 OE2 89 1 Y 1 D GLU 36 ? CG ? D GLU 36 CG 90 1 Y 1 D GLU 36 ? CD ? D GLU 36 CD 91 1 Y 1 D GLU 36 ? OE1 ? D GLU 36 OE1 92 1 Y 1 D GLU 36 ? OE2 ? D GLU 36 OE2 93 1 Y 1 D ARG 37 ? CG ? D ARG 37 CG 94 1 Y 1 D ARG 37 ? CD ? D ARG 37 CD 95 1 Y 1 D ARG 37 ? NE ? D ARG 37 NE 96 1 Y 1 D ARG 37 ? CZ ? D ARG 37 CZ 97 1 Y 1 D ARG 37 ? NH1 ? D ARG 37 NH1 98 1 Y 1 D ARG 37 ? NH2 ? D ARG 37 NH2 99 1 Y 1 D LYS 40 ? CG ? D LYS 40 CG 100 1 Y 1 D LYS 40 ? CD ? D LYS 40 CD 101 1 Y 1 D LYS 40 ? CE ? D LYS 40 CE 102 1 Y 1 D LYS 40 ? NZ ? D LYS 40 NZ 103 1 Y 1 D LYS 59 ? CG ? D LYS 59 CG 104 1 Y 1 D LYS 59 ? CD ? D LYS 59 CD 105 1 Y 1 D LYS 59 ? CE ? D LYS 59 CE 106 1 Y 1 D LYS 59 ? NZ ? D LYS 59 NZ 107 1 Y 1 E LYS 3 ? CG ? E LYS 3 CG 108 1 Y 1 E LYS 3 ? CD ? E LYS 3 CD 109 1 Y 1 E LYS 3 ? CE ? E LYS 3 CE 110 1 Y 1 E LYS 3 ? NZ ? E LYS 3 NZ 111 1 Y 1 E LYS 4 ? CG ? E LYS 4 CG 112 1 Y 1 E LYS 4 ? CD ? E LYS 4 CD 113 1 Y 1 E LYS 4 ? CE ? E LYS 4 CE 114 1 Y 1 E LYS 4 ? NZ ? E LYS 4 NZ 115 1 Y 1 E LYS 5 ? CG ? E LYS 5 CG 116 1 Y 1 E LYS 5 ? CD ? E LYS 5 CD 117 1 Y 1 E LYS 5 ? CE ? E LYS 5 CE 118 1 Y 1 E LYS 5 ? NZ ? E LYS 5 NZ 119 1 Y 1 E LYS 15 ? CG ? E LYS 15 CG 120 1 Y 1 E LYS 15 ? CD ? E LYS 15 CD 121 1 Y 1 E LYS 15 ? CE ? E LYS 15 CE 122 1 Y 1 E LYS 15 ? NZ ? E LYS 15 NZ 123 1 Y 1 E ASN 27 ? CG ? E ASN 27 CG 124 1 Y 1 E ASN 27 ? OD1 ? E ASN 27 OD1 125 1 Y 1 E ASN 27 ? ND2 ? E ASN 27 ND2 126 1 Y 1 E GLU 32 ? CG ? E GLU 32 CG 127 1 Y 1 E GLU 32 ? CD ? E GLU 32 CD 128 1 Y 1 E GLU 32 ? OE1 ? E GLU 32 OE1 129 1 Y 1 E GLU 32 ? OE2 ? E GLU 32 OE2 130 1 Y 1 E GLU 33 ? CG ? E GLU 33 CG 131 1 Y 1 E GLU 33 ? CD ? E GLU 33 CD 132 1 Y 1 E GLU 33 ? OE1 ? E GLU 33 OE1 133 1 Y 1 E GLU 33 ? OE2 ? E GLU 33 OE2 134 1 Y 1 E GLN 34 ? CG ? E GLN 34 CG 135 1 Y 1 E GLN 34 ? CD ? E GLN 34 CD 136 1 Y 1 E GLN 34 ? OE1 ? E GLN 34 OE1 137 1 Y 1 E GLN 34 ? NE2 ? E GLN 34 NE2 138 1 Y 1 E LYS 40 ? CG ? E LYS 40 CG 139 1 Y 1 E LYS 40 ? CD ? E LYS 40 CD 140 1 Y 1 E LYS 40 ? CE ? E LYS 40 CE 141 1 Y 1 E LYS 40 ? NZ ? E LYS 40 NZ 142 1 Y 1 E ARG 41 ? CG ? E ARG 41 CG 143 1 Y 1 E ARG 41 ? CD ? E ARG 41 CD 144 1 Y 1 E ARG 41 ? NE ? E ARG 41 NE 145 1 Y 1 E ARG 41 ? CZ ? E ARG 41 CZ 146 1 Y 1 E ARG 41 ? NH1 ? E ARG 41 NH1 147 1 Y 1 E ARG 41 ? NH2 ? E ARG 41 NH2 148 1 Y 1 E GLU 54 ? CG ? E GLU 54 CG 149 1 Y 1 E GLU 54 ? CD ? E GLU 54 CD 150 1 Y 1 E GLU 54 ? OE1 ? E GLU 54 OE1 151 1 Y 1 E GLU 54 ? OE2 ? E GLU 54 OE2 152 1 Y 1 E LYS 66 ? CG ? E LYS 66 CG 153 1 Y 1 E LYS 66 ? CD ? E LYS 66 CD 154 1 Y 1 E LYS 66 ? CE ? E LYS 66 CE 155 1 Y 1 E LYS 66 ? NZ ? E LYS 66 NZ 156 1 Y 1 F LYS 3 ? CG ? F LYS 3 CG 157 1 Y 1 F LYS 3 ? CD ? F LYS 3 CD 158 1 Y 1 F LYS 3 ? CE ? F LYS 3 CE 159 1 Y 1 F LYS 3 ? NZ ? F LYS 3 NZ 160 1 Y 1 F LYS 4 ? CG ? F LYS 4 CG 161 1 Y 1 F LYS 4 ? CD ? F LYS 4 CD 162 1 Y 1 F LYS 4 ? CE ? F LYS 4 CE 163 1 Y 1 F LYS 4 ? NZ ? F LYS 4 NZ 164 1 Y 1 F GLN 7 ? CG ? F GLN 7 CG 165 1 Y 1 F GLN 7 ? CD ? F GLN 7 CD 166 1 Y 1 F GLN 7 ? OE1 ? F GLN 7 OE1 167 1 Y 1 F GLN 7 ? NE2 ? F GLN 7 NE2 168 1 Y 1 F GLU 32 ? CG ? F GLU 32 CG 169 1 Y 1 F GLU 32 ? CD ? F GLU 32 CD 170 1 Y 1 F GLU 32 ? OE1 ? F GLU 32 OE1 171 1 Y 1 F GLU 32 ? OE2 ? F GLU 32 OE2 172 1 Y 1 F GLU 33 ? CG ? F GLU 33 CG 173 1 Y 1 F GLU 33 ? CD ? F GLU 33 CD 174 1 Y 1 F GLU 33 ? OE1 ? F GLU 33 OE1 175 1 Y 1 F GLU 33 ? OE2 ? F GLU 33 OE2 176 1 Y 1 F GLU 36 ? CG ? F GLU 36 CG 177 1 Y 1 F GLU 36 ? CD ? F GLU 36 CD 178 1 Y 1 F GLU 36 ? OE1 ? F GLU 36 OE1 179 1 Y 1 F GLU 36 ? OE2 ? F GLU 36 OE2 180 1 Y 1 F ARG 37 ? CG ? F ARG 37 CG 181 1 Y 1 F ARG 37 ? CD ? F ARG 37 CD 182 1 Y 1 F ARG 37 ? NE ? F ARG 37 NE 183 1 Y 1 F ARG 37 ? CZ ? F ARG 37 CZ 184 1 Y 1 F ARG 37 ? NH1 ? F ARG 37 NH1 185 1 Y 1 F ARG 37 ? NH2 ? F ARG 37 NH2 186 1 Y 1 F LYS 40 ? CG ? F LYS 40 CG 187 1 Y 1 F LYS 40 ? CD ? F LYS 40 CD 188 1 Y 1 F LYS 40 ? CE ? F LYS 40 CE 189 1 Y 1 F LYS 40 ? NZ ? F LYS 40 NZ 190 1 Y 1 F GLU 54 ? CG ? F GLU 54 CG 191 1 Y 1 F GLU 54 ? CD ? F GLU 54 CD 192 1 Y 1 F GLU 54 ? OE1 ? F GLU 54 OE1 193 1 Y 1 F GLU 54 ? OE2 ? F GLU 54 OE2 194 1 Y 1 F LYS 59 ? CG ? F LYS 59 CG 195 1 Y 1 F LYS 59 ? CD ? F LYS 59 CD 196 1 Y 1 F LYS 59 ? CE ? F LYS 59 CE 197 1 Y 1 F LYS 59 ? NZ ? F LYS 59 NZ 198 1 Y 1 F LYS 64 ? CG ? F LYS 64 CG 199 1 Y 1 F LYS 64 ? CD ? F LYS 64 CD 200 1 Y 1 F LYS 64 ? CE ? F LYS 64 CE 201 1 Y 1 F LYS 64 ? NZ ? F LYS 64 NZ 202 1 Y 1 G LYS 3 ? CG ? G LYS 3 CG 203 1 Y 1 G LYS 3 ? CD ? G LYS 3 CD 204 1 Y 1 G LYS 3 ? CE ? G LYS 3 CE 205 1 Y 1 G LYS 3 ? NZ ? G LYS 3 NZ 206 1 Y 1 G LYS 4 ? CG ? G LYS 4 CG 207 1 Y 1 G LYS 4 ? CD ? G LYS 4 CD 208 1 Y 1 G LYS 4 ? CE ? G LYS 4 CE 209 1 Y 1 G LYS 4 ? NZ ? G LYS 4 NZ 210 1 Y 1 G LYS 5 ? CG ? G LYS 5 CG 211 1 Y 1 G LYS 5 ? CD ? G LYS 5 CD 212 1 Y 1 G LYS 5 ? CE ? G LYS 5 CE 213 1 Y 1 G LYS 5 ? NZ ? G LYS 5 NZ 214 1 Y 1 G GLN 7 ? CG ? G GLN 7 CG 215 1 Y 1 G GLN 7 ? CD ? G GLN 7 CD 216 1 Y 1 G GLN 7 ? OE1 ? G GLN 7 OE1 217 1 Y 1 G GLN 7 ? NE2 ? G GLN 7 NE2 218 1 Y 1 G GLU 32 ? CG ? G GLU 32 CG 219 1 Y 1 G GLU 32 ? CD ? G GLU 32 CD 220 1 Y 1 G GLU 32 ? OE1 ? G GLU 32 OE1 221 1 Y 1 G GLU 32 ? OE2 ? G GLU 32 OE2 222 1 Y 1 G GLU 33 ? CG ? G GLU 33 CG 223 1 Y 1 G GLU 33 ? CD ? G GLU 33 CD 224 1 Y 1 G GLU 33 ? OE1 ? G GLU 33 OE1 225 1 Y 1 G GLU 33 ? OE2 ? G GLU 33 OE2 226 1 Y 1 G GLU 36 ? CG ? G GLU 36 CG 227 1 Y 1 G GLU 36 ? CD ? G GLU 36 CD 228 1 Y 1 G GLU 36 ? OE1 ? G GLU 36 OE1 229 1 Y 1 G GLU 36 ? OE2 ? G GLU 36 OE2 230 1 Y 1 G ARG 37 ? CG ? G ARG 37 CG 231 1 Y 1 G ARG 37 ? CD ? G ARG 37 CD 232 1 Y 1 G ARG 37 ? NE ? G ARG 37 NE 233 1 Y 1 G ARG 37 ? CZ ? G ARG 37 CZ 234 1 Y 1 G ARG 37 ? NH1 ? G ARG 37 NH1 235 1 Y 1 G ARG 37 ? NH2 ? G ARG 37 NH2 236 1 Y 1 G LYS 40 ? CG ? G LYS 40 CG 237 1 Y 1 G LYS 40 ? CD ? G LYS 40 CD 238 1 Y 1 G LYS 40 ? CE ? G LYS 40 CE 239 1 Y 1 G LYS 40 ? NZ ? G LYS 40 NZ 240 1 Y 1 G ARG 44 ? CG ? G ARG 44 CG 241 1 Y 1 G ARG 44 ? CD ? G ARG 44 CD 242 1 Y 1 G ARG 44 ? NE ? G ARG 44 NE 243 1 Y 1 G ARG 44 ? CZ ? G ARG 44 CZ 244 1 Y 1 G ARG 44 ? NH1 ? G ARG 44 NH1 245 1 Y 1 G ARG 44 ? NH2 ? G ARG 44 NH2 246 1 Y 1 G GLU 54 ? CG ? G GLU 54 CG 247 1 Y 1 G GLU 54 ? CD ? G GLU 54 CD 248 1 Y 1 G GLU 54 ? OE1 ? G GLU 54 OE1 249 1 Y 1 G GLU 54 ? OE2 ? G GLU 54 OE2 250 1 Y 1 G LYS 59 ? CG ? G LYS 59 CG 251 1 Y 1 G LYS 59 ? CD ? G LYS 59 CD 252 1 Y 1 G LYS 59 ? CE ? G LYS 59 CE 253 1 Y 1 G LYS 59 ? NZ ? G LYS 59 NZ 254 1 Y 1 H LYS 3 ? CG ? H LYS 3 CG 255 1 Y 1 H LYS 3 ? CD ? H LYS 3 CD 256 1 Y 1 H LYS 3 ? CE ? H LYS 3 CE 257 1 Y 1 H LYS 3 ? NZ ? H LYS 3 NZ 258 1 Y 1 H LYS 4 ? CG ? H LYS 4 CG 259 1 Y 1 H LYS 4 ? CD ? H LYS 4 CD 260 1 Y 1 H LYS 4 ? CE ? H LYS 4 CE 261 1 Y 1 H LYS 4 ? NZ ? H LYS 4 NZ 262 1 Y 1 H GLN 7 ? CG ? H GLN 7 CG 263 1 Y 1 H GLN 7 ? CD ? H GLN 7 CD 264 1 Y 1 H GLN 7 ? OE1 ? H GLN 7 OE1 265 1 Y 1 H GLN 7 ? NE2 ? H GLN 7 NE2 266 1 Y 1 H LYS 15 ? CG ? H LYS 15 CG 267 1 Y 1 H LYS 15 ? CD ? H LYS 15 CD 268 1 Y 1 H LYS 15 ? CE ? H LYS 15 CE 269 1 Y 1 H LYS 15 ? NZ ? H LYS 15 NZ 270 1 Y 1 H GLU 32 ? CG ? H GLU 32 CG 271 1 Y 1 H GLU 32 ? CD ? H GLU 32 CD 272 1 Y 1 H GLU 32 ? OE1 ? H GLU 32 OE1 273 1 Y 1 H GLU 32 ? OE2 ? H GLU 32 OE2 274 1 Y 1 H GLU 33 ? CG ? H GLU 33 CG 275 1 Y 1 H GLU 33 ? CD ? H GLU 33 CD 276 1 Y 1 H GLU 33 ? OE1 ? H GLU 33 OE1 277 1 Y 1 H GLU 33 ? OE2 ? H GLU 33 OE2 278 1 Y 1 H GLU 36 ? CG ? H GLU 36 CG 279 1 Y 1 H GLU 36 ? CD ? H GLU 36 CD 280 1 Y 1 H GLU 36 ? OE1 ? H GLU 36 OE1 281 1 Y 1 H GLU 36 ? OE2 ? H GLU 36 OE2 282 1 Y 1 H LYS 40 ? CG ? H LYS 40 CG 283 1 Y 1 H LYS 40 ? CD ? H LYS 40 CD 284 1 Y 1 H LYS 40 ? CE ? H LYS 40 CE 285 1 Y 1 H LYS 40 ? NZ ? H LYS 40 NZ 286 1 Y 1 H ARG 44 ? CG ? H ARG 44 CG 287 1 Y 1 H ARG 44 ? CD ? H ARG 44 CD 288 1 Y 1 H ARG 44 ? NE ? H ARG 44 NE 289 1 Y 1 H ARG 44 ? CZ ? H ARG 44 CZ 290 1 Y 1 H ARG 44 ? NH1 ? H ARG 44 NH1 291 1 Y 1 H ARG 44 ? NH2 ? H ARG 44 NH2 292 1 Y 1 H ARG 51 ? CG ? H ARG 51 CG 293 1 Y 1 H ARG 51 ? CD ? H ARG 51 CD 294 1 Y 1 H ARG 51 ? NE ? H ARG 51 NE 295 1 Y 1 H ARG 51 ? CZ ? H ARG 51 CZ 296 1 Y 1 H ARG 51 ? NH1 ? H ARG 51 NH1 297 1 Y 1 H ARG 51 ? NH2 ? H ARG 51 NH2 298 1 Y 1 H GLU 54 ? CG ? H GLU 54 CG 299 1 Y 1 H GLU 54 ? CD ? H GLU 54 CD 300 1 Y 1 H GLU 54 ? OE1 ? H GLU 54 OE1 301 1 Y 1 H GLU 54 ? OE2 ? H GLU 54 OE2 302 1 Y 1 H ASP 57 ? CG ? H ASP 57 CG 303 1 Y 1 H ASP 57 ? OD1 ? H ASP 57 OD1 304 1 Y 1 H ASP 57 ? OD2 ? H ASP 57 OD2 305 1 Y 1 H LYS 59 ? CG ? H LYS 59 CG 306 1 Y 1 H LYS 59 ? CD ? H LYS 59 CD 307 1 Y 1 H LYS 59 ? CE ? H LYS 59 CE 308 1 Y 1 H LYS 59 ? NZ ? H LYS 59 NZ 309 1 Y 1 H ASP 60 ? CG ? H ASP 60 CG 310 1 Y 1 H ASP 60 ? OD1 ? H ASP 60 OD1 311 1 Y 1 H ASP 60 ? OD2 ? H ASP 60 OD2 312 1 Y 1 H LYS 64 ? CG ? H LYS 64 CG 313 1 Y 1 H LYS 64 ? CD ? H LYS 64 CD 314 1 Y 1 H LYS 64 ? CE ? H LYS 64 CE 315 1 Y 1 H LYS 64 ? NZ ? H LYS 64 NZ 316 1 Y 1 H PHE 99 ? CG ? H PHE 99 CG 317 1 Y 1 H PHE 99 ? CD1 ? H PHE 99 CD1 318 1 Y 1 H PHE 99 ? CD2 ? H PHE 99 CD2 319 1 Y 1 H PHE 99 ? CE1 ? H PHE 99 CE1 320 1 Y 1 H PHE 99 ? CE2 ? H PHE 99 CE2 321 1 Y 1 H PHE 99 ? CZ ? H PHE 99 CZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A PHE 100 ? A PHE 100 4 1 Y 1 A SER 101 ? A SER 101 5 1 Y 1 B GLY 1 ? B GLY 1 6 1 Y 1 B SER 28 ? B SER 28 7 1 Y 1 B PRO 29 ? B PRO 29 8 1 Y 1 B PRO 30 ? B PRO 30 9 1 Y 1 B ALA 31 ? B ALA 31 10 1 Y 1 B PHE 100 ? B PHE 100 11 1 Y 1 B SER 101 ? B SER 101 12 1 Y 1 C GLY 1 ? C GLY 1 13 1 Y 1 C PRO 2 ? C PRO 2 14 1 Y 1 C PRO 29 ? C PRO 29 15 1 Y 1 C PRO 30 ? C PRO 30 16 1 Y 1 C SER 101 ? C SER 101 17 1 Y 1 D GLY 1 ? D GLY 1 18 1 Y 1 D PRO 2 ? D PRO 2 19 1 Y 1 D LYS 3 ? D LYS 3 20 1 Y 1 D SER 101 ? D SER 101 21 1 Y 1 E GLY 1 ? E GLY 1 22 1 Y 1 E PRO 2 ? E PRO 2 23 1 Y 1 E SER 101 ? E SER 101 24 1 Y 1 F GLY 1 ? F GLY 1 25 1 Y 1 F THR 26 ? F THR 26 26 1 Y 1 F ASN 27 ? F ASN 27 27 1 Y 1 F SER 28 ? F SER 28 28 1 Y 1 F PRO 29 ? F PRO 29 29 1 Y 1 F SER 101 ? F SER 101 30 1 Y 1 G GLY 1 ? G GLY 1 31 1 Y 1 G PRO 2 ? G PRO 2 32 1 Y 1 G THR 26 ? G THR 26 33 1 Y 1 G ASN 27 ? G ASN 27 34 1 Y 1 G SER 28 ? G SER 28 35 1 Y 1 G PRO 29 ? G PRO 29 36 1 Y 1 G SER 101 ? G SER 101 37 1 Y 1 H GLY 1 ? H GLY 1 38 1 Y 1 H PRO 2 ? H PRO 2 39 1 Y 1 H ASN 27 ? H ASN 27 40 1 Y 1 H SER 28 ? H SER 28 41 1 Y 1 H PRO 29 ? H PRO 29 42 1 Y 1 H PHE 100 ? H PHE 100 43 1 Y 1 H SER 101 ? H SER 101 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 PRO N N N N 235 PRO CA C N S 236 PRO C C N N 237 PRO O O N N 238 PRO CB C N N 239 PRO CG C N N 240 PRO CD C N N 241 PRO OXT O N N 242 PRO H H N N 243 PRO HA H N N 244 PRO HB2 H N N 245 PRO HB3 H N N 246 PRO HG2 H N N 247 PRO HG3 H N N 248 PRO HD2 H N N 249 PRO HD3 H N N 250 PRO HXT H N N 251 SER N N N N 252 SER CA C N S 253 SER C C N N 254 SER O O N N 255 SER CB C N N 256 SER OG O N N 257 SER OXT O N N 258 SER H H N N 259 SER H2 H N N 260 SER HA H N N 261 SER HB2 H N N 262 SER HB3 H N N 263 SER HG H N N 264 SER HXT H N N 265 THR N N N N 266 THR CA C N S 267 THR C C N N 268 THR O O N N 269 THR CB C N R 270 THR OG1 O N N 271 THR CG2 C N N 272 THR OXT O N N 273 THR H H N N 274 THR H2 H N N 275 THR HA H N N 276 THR HB H N N 277 THR HG1 H N N 278 THR HG21 H N N 279 THR HG22 H N N 280 THR HG23 H N N 281 THR HXT H N N 282 TRP N N N N 283 TRP CA C N S 284 TRP C C N N 285 TRP O O N N 286 TRP CB C N N 287 TRP CG C Y N 288 TRP CD1 C Y N 289 TRP CD2 C Y N 290 TRP NE1 N Y N 291 TRP CE2 C Y N 292 TRP CE3 C Y N 293 TRP CZ2 C Y N 294 TRP CZ3 C Y N 295 TRP CH2 C Y N 296 TRP OXT O N N 297 TRP H H N N 298 TRP H2 H N N 299 TRP HA H N N 300 TRP HB2 H N N 301 TRP HB3 H N N 302 TRP HD1 H N N 303 TRP HE1 H N N 304 TRP HE3 H N N 305 TRP HZ2 H N N 306 TRP HZ3 H N N 307 TRP HH2 H N N 308 TRP HXT H N N 309 VAL N N N N 310 VAL CA C N S 311 VAL C C N N 312 VAL O O N N 313 VAL CB C N N 314 VAL CG1 C N N 315 VAL CG2 C N N 316 VAL OXT O N N 317 VAL H H N N 318 VAL H2 H N N 319 VAL HA H N N 320 VAL HB H N N 321 VAL HG11 H N N 322 VAL HG12 H N N 323 VAL HG13 H N N 324 VAL HG21 H N N 325 VAL HG22 H N N 326 VAL HG23 H N N 327 VAL HXT H N N 328 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TRP N CA sing N N 270 TRP N H sing N N 271 TRP N H2 sing N N 272 TRP CA C sing N N 273 TRP CA CB sing N N 274 TRP CA HA sing N N 275 TRP C O doub N N 276 TRP C OXT sing N N 277 TRP CB CG sing N N 278 TRP CB HB2 sing N N 279 TRP CB HB3 sing N N 280 TRP CG CD1 doub Y N 281 TRP CG CD2 sing Y N 282 TRP CD1 NE1 sing Y N 283 TRP CD1 HD1 sing N N 284 TRP CD2 CE2 doub Y N 285 TRP CD2 CE3 sing Y N 286 TRP NE1 CE2 sing Y N 287 TRP NE1 HE1 sing N N 288 TRP CE2 CZ2 sing Y N 289 TRP CE3 CZ3 doub Y N 290 TRP CE3 HE3 sing N N 291 TRP CZ2 CH2 doub Y N 292 TRP CZ2 HZ2 sing N N 293 TRP CZ3 CH2 sing Y N 294 TRP CZ3 HZ3 sing N N 295 TRP CH2 HH2 sing N N 296 TRP OXT HXT sing N N 297 VAL N CA sing N N 298 VAL N H sing N N 299 VAL N H2 sing N N 300 VAL CA C sing N N 301 VAL CA CB sing N N 302 VAL CA HA sing N N 303 VAL C O doub N N 304 VAL C OXT sing N N 305 VAL CB CG1 sing N N 306 VAL CB CG2 sing N N 307 VAL CB HB sing N N 308 VAL CG1 HG11 sing N N 309 VAL CG1 HG12 sing N N 310 VAL CG1 HG13 sing N N 311 VAL CG2 HG21 sing N N 312 VAL CG2 HG22 sing N N 313 VAL CG2 HG23 sing N N 314 VAL OXT HXT sing N N 315 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number AI051321 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6DG6 _pdbx_initial_refinement_model.details 'PDB entry 6DG6' # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'gel filtration' ? 2 2 'gel filtration' ? 3 3 'gel filtration' ? 4 4 'gel filtration' ? 5 5 'gel filtration' ? 6 6 'gel filtration' ? 7 7 'gel filtration' ? 8 8 'gel filtration' ? # _space_group.name_H-M_alt 'R 3 2 :H' _space_group.name_Hall ;R 3 2" ; _space_group.IT_number 155 _space_group.crystal_system trigonal _space_group.id 1 #