data_8E5G # _entry.id 8E5G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.374 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8E5G pdb_00008e5g 10.2210/pdb8e5g/pdb WWPDB D_1000267882 ? ? EMDB EMD-27912 ? ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'Cryo-EM of A. veneficus cytochrome filament' _pdbx_database_related.db_id EMD-27912 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8E5G _pdbx_database_status.recvd_initial_deposition_date 2022-08-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, F.' 1 0000-0003-1008-663X 'Baquero, D.P.' 2 ? 'Krupovic, M.' 3 ? 'Egelman, E.H.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Cell _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1097-4172 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 186 _citation.language ? _citation.page_first 2853 _citation.page_last 2864.e8 _citation.title 'Extracellular cytochrome nanowires appear to be ubiquitous in prokaryotes.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.cell.2023.05.012 _citation.pdbx_database_id_PubMed 37290436 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Baquero, D.P.' 1 ? primary 'Cvirkaite-Krupovic, V.' 2 ? primary 'Hu, S.S.' 3 ? primary 'Fields, J.L.' 4 ? primary 'Liu, X.' 5 ? primary 'Rensing, C.' 6 ? primary 'Egelman, E.H.' 7 ? primary 'Krupovic, M.' 8 ? primary 'Wang, F.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'c-type cytochrome' 27958.664 1 ? ? ? ? 2 non-polymer syn 'HEME C' 618.503 4 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNGGKLALLMVTLAAMGTLVLPSTTSLFLGQHMWYNISGTGNNLPCEKCHADVFAEFKNNPGAHKTIGGGTDTVEHIRAA CGECHRTSVVGTFASGDGTSATPGQEAHAAATIACMACHEFGPNGNAPYSGAPVAGGFDNVTTDTASSPYNYDNGDTTYG TKEAHQTFIERAVEDKTLIDSNEACIACHTYVPVKINWTHKVSLEFNCTYEYNTGTSGVTTHYNVTNWTVNGTRYTTVFG NTTGNGSVNDASNWPGWYPYSW ; _entity_poly.pdbx_seq_one_letter_code_can ;MNGGKLALLMVTLAAMGTLVLPSTTSLFLGQHMWYNISGTGNNLPCEKCHADVFAEFKNNPGAHKTIGGGTDTVEHIRAA CGECHRTSVVGTFASGDGTSATPGQEAHAAATIACMACHEFGPNGNAPYSGAPVAGGFDNVTTDTASSPYNYDNGDTTYG TKEAHQTFIERAVEDKTLIDSNEACIACHTYVPVKINWTHKVSLEFNCTYEYNTGTSGVTTHYNVTNWTVNGTRYTTVFG NTTGNGSVNDASNWPGWYPYSW ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 GLY n 1 4 GLY n 1 5 LYS n 1 6 LEU n 1 7 ALA n 1 8 LEU n 1 9 LEU n 1 10 MET n 1 11 VAL n 1 12 THR n 1 13 LEU n 1 14 ALA n 1 15 ALA n 1 16 MET n 1 17 GLY n 1 18 THR n 1 19 LEU n 1 20 VAL n 1 21 LEU n 1 22 PRO n 1 23 SER n 1 24 THR n 1 25 THR n 1 26 SER n 1 27 LEU n 1 28 PHE n 1 29 LEU n 1 30 GLY n 1 31 GLN n 1 32 HIS n 1 33 MET n 1 34 TRP n 1 35 TYR n 1 36 ASN n 1 37 ILE n 1 38 SER n 1 39 GLY n 1 40 THR n 1 41 GLY n 1 42 ASN n 1 43 ASN n 1 44 LEU n 1 45 PRO n 1 46 CYS n 1 47 GLU n 1 48 LYS n 1 49 CYS n 1 50 HIS n 1 51 ALA n 1 52 ASP n 1 53 VAL n 1 54 PHE n 1 55 ALA n 1 56 GLU n 1 57 PHE n 1 58 LYS n 1 59 ASN n 1 60 ASN n 1 61 PRO n 1 62 GLY n 1 63 ALA n 1 64 HIS n 1 65 LYS n 1 66 THR n 1 67 ILE n 1 68 GLY n 1 69 GLY n 1 70 GLY n 1 71 THR n 1 72 ASP n 1 73 THR n 1 74 VAL n 1 75 GLU n 1 76 HIS n 1 77 ILE n 1 78 ARG n 1 79 ALA n 1 80 ALA n 1 81 CYS n 1 82 GLY n 1 83 GLU n 1 84 CYS n 1 85 HIS n 1 86 ARG n 1 87 THR n 1 88 SER n 1 89 VAL n 1 90 VAL n 1 91 GLY n 1 92 THR n 1 93 PHE n 1 94 ALA n 1 95 SER n 1 96 GLY n 1 97 ASP n 1 98 GLY n 1 99 THR n 1 100 SER n 1 101 ALA n 1 102 THR n 1 103 PRO n 1 104 GLY n 1 105 GLN n 1 106 GLU n 1 107 ALA n 1 108 HIS n 1 109 ALA n 1 110 ALA n 1 111 ALA n 1 112 THR n 1 113 ILE n 1 114 ALA n 1 115 CYS n 1 116 MET n 1 117 ALA n 1 118 CYS n 1 119 HIS n 1 120 GLU n 1 121 PHE n 1 122 GLY n 1 123 PRO n 1 124 ASN n 1 125 GLY n 1 126 ASN n 1 127 ALA n 1 128 PRO n 1 129 TYR n 1 130 SER n 1 131 GLY n 1 132 ALA n 1 133 PRO n 1 134 VAL n 1 135 ALA n 1 136 GLY n 1 137 GLY n 1 138 PHE n 1 139 ASP n 1 140 ASN n 1 141 VAL n 1 142 THR n 1 143 THR n 1 144 ASP n 1 145 THR n 1 146 ALA n 1 147 SER n 1 148 SER n 1 149 PRO n 1 150 TYR n 1 151 ASN n 1 152 TYR n 1 153 ASP n 1 154 ASN n 1 155 GLY n 1 156 ASP n 1 157 THR n 1 158 THR n 1 159 TYR n 1 160 GLY n 1 161 THR n 1 162 LYS n 1 163 GLU n 1 164 ALA n 1 165 HIS n 1 166 GLN n 1 167 THR n 1 168 PHE n 1 169 ILE n 1 170 GLU n 1 171 ARG n 1 172 ALA n 1 173 VAL n 1 174 GLU n 1 175 ASP n 1 176 LYS n 1 177 THR n 1 178 LEU n 1 179 ILE n 1 180 ASP n 1 181 SER n 1 182 ASN n 1 183 GLU n 1 184 ALA n 1 185 CYS n 1 186 ILE n 1 187 ALA n 1 188 CYS n 1 189 HIS n 1 190 THR n 1 191 TYR n 1 192 VAL n 1 193 PRO n 1 194 VAL n 1 195 LYS n 1 196 ILE n 1 197 ASN n 1 198 TRP n 1 199 THR n 1 200 HIS n 1 201 LYS n 1 202 VAL n 1 203 SER n 1 204 LEU n 1 205 GLU n 1 206 PHE n 1 207 ASN n 1 208 CYS n 1 209 THR n 1 210 TYR n 1 211 GLU n 1 212 TYR n 1 213 ASN n 1 214 THR n 1 215 GLY n 1 216 THR n 1 217 SER n 1 218 GLY n 1 219 VAL n 1 220 THR n 1 221 THR n 1 222 HIS n 1 223 TYR n 1 224 ASN n 1 225 VAL n 1 226 THR n 1 227 ASN n 1 228 TRP n 1 229 THR n 1 230 VAL n 1 231 ASN n 1 232 GLY n 1 233 THR n 1 234 ARG n 1 235 TYR n 1 236 THR n 1 237 THR n 1 238 VAL n 1 239 PHE n 1 240 GLY n 1 241 ASN n 1 242 THR n 1 243 THR n 1 244 GLY n 1 245 ASN n 1 246 GLY n 1 247 SER n 1 248 VAL n 1 249 ASN n 1 250 ASP n 1 251 ALA n 1 252 SER n 1 253 ASN n 1 254 TRP n 1 255 PRO n 1 256 GLY n 1 257 TRP n 1 258 TYR n 1 259 PRO n 1 260 TYR n 1 261 SER n 1 262 TRP n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 262 _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Archaeoglobus veneficus' _entity_src_nat.pdbx_ncbi_taxonomy_id 58290 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code F2KMU8_ARCVS _struct_ref.pdbx_db_accession F2KMU8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNGGKLALLMVTLAAMGTLVLPSTTSLFLGQHMWYNISGTGNNLPCEKCHADVFAEFKNNPGAHKTIGGGTDTVEHIRAA CGECHRTSVVGTFASGDGTSATPGQEAHAAATIACMACHEFGPNGNAPYSGAPVAGGFDNVTTDTASSPYNYDNGDTTYG TKEAHQTFIERAVEDKTLIDSNEACIACHTYVPVKINWTHKVSLEFNCTYEYNTGTSGVTTHYNVTNWTVNGTRYTTVFG NTTGNGSVNDASNWPGWYPYSW ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8E5G _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 262 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession F2KMU8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 262 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 262 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8E5G _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 8E5G _struct.title 'Cryo-EM of A. veneficus cytochrome filament' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8E5G _struct_keywords.text 'helical symmetry, cytochrome filmanet, conductive nanowires, microbial nanowires, ELECTRON TRANSPORT' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 45 ? CYS A 49 ? PRO A 45 CYS A 49 5 ? 5 HELX_P HELX_P2 AA2 HIS A 50 ? ASN A 59 ? HIS A 50 ASN A 59 1 ? 10 HELX_P HELX_P3 AA3 THR A 73 ? ARG A 86 ? THR A 73 ARG A 86 1 ? 14 HELX_P HELX_P4 AA4 GLN A 166 ? ASP A 175 ? GLN A 166 ASP A 175 1 ? 10 HELX_P HELX_P5 AA5 SER A 181 ? ILE A 186 ? SER A 181 ILE A 186 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 46 SG ? ? ? 1_555 B HEC . CAB ? ? A CYS 46 A HEC 301 1_555 ? ? ? ? ? ? ? 1.793 ? ? covale2 covale none ? A CYS 49 SG ? ? ? 1_555 B HEC . CAC ? ? A CYS 49 A HEC 301 1_555 ? ? ? ? ? ? ? 1.909 ? ? covale3 covale none ? A CYS 81 SG ? ? ? 1_555 C HEC . CAB ? ? A CYS 81 A HEC 302 1_555 ? ? ? ? ? ? ? 1.800 ? ? covale4 covale none ? A CYS 115 SG ? ? ? 1_555 D HEC . CAB ? ? A CYS 115 A HEC 303 1_555 ? ? ? ? ? ? ? 1.730 ? ? covale5 covale none ? A CYS 118 SG ? ? ? 1_555 D HEC . CAC ? ? A CYS 118 A HEC 303 1_555 ? ? ? ? ? ? ? 1.989 ? ? covale6 covale none ? A CYS 185 SG ? ? ? 1_555 E HEC . CAB ? ? A CYS 185 A HEC 304 1_555 ? ? ? ? ? ? ? 1.837 ? ? metalc1 metalc ? ? A HIS 50 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 50 A HEC 301 1_555 ? ? ? ? ? ? ? 2.039 ? ? metalc2 metalc ? ? A HIS 64 NE2 ? ? ? 1_555 D HEC . FE ? ? A HIS 64 A HEC 303 1_555 ? ? ? ? ? ? ? 2.091 ? ? metalc3 metalc ? ? A HIS 85 NE2 ? ? ? 1_555 C HEC . FE ? ? A HIS 85 A HEC 302 1_555 ? ? ? ? ? ? ? 2.045 ? ? metalc4 metalc ? ? A HIS 119 NE2 ? ? ? 1_555 D HEC . FE ? ? A HIS 119 A HEC 303 1_555 ? ? ? ? ? ? ? 2.011 ? ? metalc5 metalc ? ? A HIS 189 NE2 ? ? ? 1_555 E HEC . FE ? ? A HIS 189 A HEC 304 1_555 ? ? ? ? ? ? ? 2.044 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 95 ? GLY A 96 ? SER A 95 GLY A 96 AA1 2 ALA A 101 ? THR A 102 ? ALA A 101 THR A 102 AA2 1 VAL A 194 ? TYR A 210 ? VAL A 194 TYR A 210 AA2 2 TYR A 223 ? GLY A 240 ? TYR A 223 GLY A 240 AA2 3 GLY A 246 ? VAL A 248 ? GLY A 246 VAL A 248 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 95 ? N SER A 95 O THR A 102 ? O THR A 102 AA2 1 2 N THR A 209 ? N THR A 209 O ASN A 224 ? O ASN A 224 AA2 2 3 N PHE A 239 ? N PHE A 239 O SER A 247 ? O SER A 247 # _atom_sites.entry_id 8E5G _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 GLY 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 ALA 7 7 ? ? ? A . n A 1 8 LEU 8 8 ? ? ? A . n A 1 9 LEU 9 9 ? ? ? A . n A 1 10 MET 10 10 ? ? ? A . n A 1 11 VAL 11 11 ? ? ? A . n A 1 12 THR 12 12 ? ? ? A . n A 1 13 LEU 13 13 ? ? ? A . n A 1 14 ALA 14 14 ? ? ? A . n A 1 15 ALA 15 15 ? ? ? A . n A 1 16 MET 16 16 ? ? ? A . n A 1 17 GLY 17 17 ? ? ? A . n A 1 18 THR 18 18 ? ? ? A . n A 1 19 LEU 19 19 ? ? ? A . n A 1 20 VAL 20 20 ? ? ? A . n A 1 21 LEU 21 21 ? ? ? A . n A 1 22 PRO 22 22 ? ? ? A . n A 1 23 SER 23 23 ? ? ? A . n A 1 24 THR 24 24 ? ? ? A . n A 1 25 THR 25 25 ? ? ? A . n A 1 26 SER 26 26 ? ? ? A . n A 1 27 LEU 27 27 ? ? ? A . n A 1 28 PHE 28 28 ? ? ? A . n A 1 29 LEU 29 29 ? ? ? A . n A 1 30 GLY 30 30 ? ? ? A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 CYS 115 115 115 CYS CYS A . n A 1 116 MET 116 116 116 MET MET A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 CYS 118 118 118 CYS CYS A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 HIS 165 165 165 HIS HIS A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 PHE 168 168 168 PHE PHE A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 ARG 171 171 171 ARG ARG A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 ASN 182 182 182 ASN ASN A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 CYS 185 185 185 CYS CYS A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 CYS 188 188 188 CYS CYS A . n A 1 189 HIS 189 189 189 HIS HIS A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 TYR 191 191 191 TYR TYR A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 PRO 193 193 193 PRO PRO A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 ASN 197 197 197 ASN ASN A . n A 1 198 TRP 198 198 198 TRP TRP A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 HIS 200 200 200 HIS HIS A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 PHE 206 206 206 PHE PHE A . n A 1 207 ASN 207 207 207 ASN ASN A . n A 1 208 CYS 208 208 208 CYS CYS A . n A 1 209 THR 209 209 209 THR THR A . n A 1 210 TYR 210 210 210 TYR TYR A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 TYR 212 212 212 TYR TYR A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 THR 214 214 214 THR THR A . n A 1 215 GLY 215 215 215 GLY GLY A . n A 1 216 THR 216 216 216 THR THR A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 THR 220 220 220 THR THR A . n A 1 221 THR 221 221 221 THR THR A . n A 1 222 HIS 222 222 222 HIS HIS A . n A 1 223 TYR 223 223 223 TYR TYR A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 THR 226 226 226 THR THR A . n A 1 227 ASN 227 227 227 ASN ASN A . n A 1 228 TRP 228 228 228 TRP TRP A . n A 1 229 THR 229 229 229 THR THR A . n A 1 230 VAL 230 230 230 VAL VAL A . n A 1 231 ASN 231 231 231 ASN ASN A . n A 1 232 GLY 232 232 232 GLY GLY A . n A 1 233 THR 233 233 233 THR THR A . n A 1 234 ARG 234 234 234 ARG ARG A . n A 1 235 TYR 235 235 235 TYR TYR A . n A 1 236 THR 236 236 236 THR THR A . n A 1 237 THR 237 237 237 THR THR A . n A 1 238 VAL 238 238 238 VAL VAL A . n A 1 239 PHE 239 239 239 PHE PHE A . n A 1 240 GLY 240 240 240 GLY GLY A . n A 1 241 ASN 241 241 241 ASN ASN A . n A 1 242 THR 242 242 242 THR THR A . n A 1 243 THR 243 243 243 THR THR A . n A 1 244 GLY 244 244 244 GLY GLY A . n A 1 245 ASN 245 245 245 ASN ASN A . n A 1 246 GLY 246 246 246 GLY GLY A . n A 1 247 SER 247 247 247 SER SER A . n A 1 248 VAL 248 248 248 VAL VAL A . n A 1 249 ASN 249 249 249 ASN ASN A . n A 1 250 ASP 250 250 250 ASP ASP A . n A 1 251 ALA 251 251 ? ? ? A . n A 1 252 SER 252 252 ? ? ? A . n A 1 253 ASN 253 253 ? ? ? A . n A 1 254 TRP 254 254 ? ? ? A . n A 1 255 PRO 255 255 ? ? ? A . n A 1 256 GLY 256 256 ? ? ? A . n A 1 257 TRP 257 257 ? ? ? A . n A 1 258 TYR 258 258 ? ? ? A . n A 1 259 PRO 259 259 ? ? ? A . n A 1 260 TYR 260 260 ? ? ? A . n A 1 261 SER 261 261 ? ? ? A . n A 1 262 TRP 262 262 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email fw2@uab.edu _pdbx_contact_author.name_first Fengbin _pdbx_contact_author.name_last Wang _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1008-663X # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEC 1 301 301 HEC HEC A . C 2 HEC 1 302 302 HEC HEC A . D 2 HEC 1 303 303 HEC HEC A . E 2 HEC 1 304 304 HEC HEC A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details 'UCSF CHIMERA 1.14_b42059.' _pdbx_struct_assembly.oligomeric_details pentameric _pdbx_struct_assembly.oligomeric_count 5 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.000000 0.000000 0.000000 0.00000 0.000000 1.000000 0.000000 0.00000 0.000000 0.000000 1.000000 0.00000 2 'helical symmetry operation' ? ? 0.390121 0.920764 0.000000 0.00000 -0.920764 0.390121 0.000000 0.00000 0.000000 -0.000000 1.000000 -65.47400 3 'helical symmetry operation' ? ? 0.833703 0.552213 0.000000 0.00000 -0.552213 0.833703 0.000000 0.00000 0.000000 -0.000000 1.000000 -32.73700 4 'helical symmetry operation' ? ? 0.833703 -0.552213 0.000000 0.00000 0.552213 0.833703 0.000000 0.00000 -0.000000 0.000000 1.000000 32.73700 5 'helical symmetry operation' ? ? 0.390121 -0.920764 0.000000 0.00000 0.920764 0.390121 0.000000 0.00000 -0.000000 0.000000 1.000000 65.47400 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NA ? B HEC . ? A HEC 301 ? 1_555 92.4 ? 2 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NB ? B HEC . ? A HEC 301 ? 1_555 92.2 ? 3 NA ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NB ? B HEC . ? A HEC 301 ? 1_555 89.8 ? 4 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NC ? B HEC . ? A HEC 301 ? 1_555 88.3 ? 5 NA ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NC ? B HEC . ? A HEC 301 ? 1_555 178.4 ? 6 NB ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NC ? B HEC . ? A HEC 301 ? 1_555 88.6 ? 7 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 ND ? B HEC . ? A HEC 301 ? 1_555 87.3 ? 8 NA ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 ND ? B HEC . ? A HEC 301 ? 1_555 90.5 ? 9 NB ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 ND ? B HEC . ? A HEC 301 ? 1_555 179.4 ? 10 NC ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 ND ? B HEC . ? A HEC 301 ? 1_555 91.0 ? 11 NE2 ? A HIS 64 ? A HIS 64 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NA ? D HEC . ? A HEC 303 ? 1_555 95.1 ? 12 NE2 ? A HIS 64 ? A HIS 64 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NB ? D HEC . ? A HEC 303 ? 1_555 108.8 ? 13 NA ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NB ? D HEC . ? A HEC 303 ? 1_555 87.9 ? 14 NE2 ? A HIS 64 ? A HIS 64 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NC ? D HEC . ? A HEC 303 ? 1_555 91.6 ? 15 NA ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NC ? D HEC . ? A HEC 303 ? 1_555 173.2 ? 16 NB ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NC ? D HEC . ? A HEC 303 ? 1_555 90.9 ? 17 NE2 ? A HIS 64 ? A HIS 64 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 ND ? D HEC . ? A HEC 303 ? 1_555 78.6 ? 18 NA ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 ND ? D HEC . ? A HEC 303 ? 1_555 91.8 ? 19 NB ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 ND ? D HEC . ? A HEC 303 ? 1_555 172.6 ? 20 NC ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 ND ? D HEC . ? A HEC 303 ? 1_555 88.5 ? 21 NE2 ? A HIS 64 ? A HIS 64 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NE2 ? A HIS 119 ? A HIS 119 ? 1_555 156.3 ? 22 NA ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NE2 ? A HIS 119 ? A HIS 119 ? 1_555 90.4 ? 23 NB ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NE2 ? A HIS 119 ? A HIS 119 ? 1_555 94.4 ? 24 NC ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NE2 ? A HIS 119 ? A HIS 119 ? 1_555 83.0 ? 25 ND ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NE2 ? A HIS 119 ? A HIS 119 ? 1_555 78.2 ? 26 NE2 ? A HIS 85 ? A HIS 85 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NA ? C HEC . ? A HEC 302 ? 1_555 86.0 ? 27 NE2 ? A HIS 85 ? A HIS 85 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NB ? C HEC . ? A HEC 302 ? 1_555 95.2 ? 28 NA ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NB ? C HEC . ? A HEC 302 ? 1_555 88.3 ? 29 NE2 ? A HIS 85 ? A HIS 85 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NC ? C HEC . ? A HEC 302 ? 1_555 92.8 ? 30 NA ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NC ? C HEC . ? A HEC 302 ? 1_555 178.3 ? 31 NB ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NC ? C HEC . ? A HEC 302 ? 1_555 90.6 ? 32 NE2 ? A HIS 85 ? A HIS 85 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 ND ? C HEC . ? A HEC 302 ? 1_555 83.8 ? 33 NA ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 ND ? C HEC . ? A HEC 302 ? 1_555 91.4 ? 34 NB ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 ND ? C HEC . ? A HEC 302 ? 1_555 179.0 ? 35 NC ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 ND ? C HEC . ? A HEC 302 ? 1_555 89.7 ? 36 NE2 ? A HIS 189 ? A HIS 189 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NA ? E HEC . ? A HEC 304 ? 1_555 99.7 ? 37 NE2 ? A HIS 189 ? A HIS 189 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NB ? E HEC . ? A HEC 304 ? 1_555 100.6 ? 38 NA ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NB ? E HEC . ? A HEC 304 ? 1_555 91.1 ? 39 NE2 ? A HIS 189 ? A HIS 189 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NC ? E HEC . ? A HEC 304 ? 1_555 81.4 ? 40 NA ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NC ? E HEC . ? A HEC 304 ? 1_555 178.9 ? 41 NB ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NC ? E HEC . ? A HEC 304 ? 1_555 88.4 ? 42 NE2 ? A HIS 189 ? A HIS 189 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 ND ? E HEC . ? A HEC 304 ? 1_555 79.7 ? 43 NA ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 ND ? E HEC . ? A HEC 304 ? 1_555 88.3 ? 44 NB ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 ND ? E HEC . ? A HEC 304 ? 1_555 179.4 ? 45 NC ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 ND ? E HEC . ? A HEC 304 ? 1_555 92.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-05-10 2 'Structure model' 1 1 2023-07-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' # _pdbx_entry_details.entry_id 8E5G _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _em_3d_fitting.entry_id 8E5G _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol ? _em_3d_fitting.ref_space ? _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 8E5G _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 92602 _em_3d_reconstruction.resolution 3.9 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type HELICAL _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 6 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name 'extracellular cytochrome filament' _em_entity_assembly.source NATURAL _em_entity_assembly.type COMPLEX _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_imaging.id 1 _em_imaging.entry_id 8E5G _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen ? _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_max 3000 _em_imaging.nominal_defocus_min 1000 _em_imaging.nominal_magnification ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model ? _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature ? _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity ? _em_vitrification.instrument ? _em_vitrification.entry_id 8E5G _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 8E5G _em_experiment.id 1 _em_experiment.aggregation_state FILAMENT _em_experiment.reconstruction_method HELICAL _em_experiment.entity_assembly_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 84 ? ? CAC A HEC 302 ? ? 2.03 2 1 SG A CYS 188 ? ? CAC A HEC 304 ? ? 2.09 3 1 OG A SER 203 ? ? O A ASN 231 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 64 ? ? -102.27 42.24 2 1 ASP A 97 ? ? -140.28 31.51 3 1 THR A 161 ? ? -140.36 -13.87 4 1 LYS A 162 ? ? -95.52 32.20 5 1 GLN A 166 ? ? 18.49 -73.52 6 1 ASP A 180 ? ? 56.27 -109.34 7 1 ASN A 207 ? ? -114.80 -149.52 8 1 TYR A 212 ? ? 68.20 -4.39 9 1 ASN A 227 ? ? 70.23 149.08 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 31 ? CG ? A GLN 31 CG 2 1 Y 1 A GLN 31 ? CD ? A GLN 31 CD 3 1 Y 1 A GLN 31 ? OE1 ? A GLN 31 OE1 4 1 Y 1 A GLN 31 ? NE2 ? A GLN 31 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A GLY 4 ? A GLY 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A ALA 7 ? A ALA 7 8 1 Y 1 A LEU 8 ? A LEU 8 9 1 Y 1 A LEU 9 ? A LEU 9 10 1 Y 1 A MET 10 ? A MET 10 11 1 Y 1 A VAL 11 ? A VAL 11 12 1 Y 1 A THR 12 ? A THR 12 13 1 Y 1 A LEU 13 ? A LEU 13 14 1 Y 1 A ALA 14 ? A ALA 14 15 1 Y 1 A ALA 15 ? A ALA 15 16 1 Y 1 A MET 16 ? A MET 16 17 1 Y 1 A GLY 17 ? A GLY 17 18 1 Y 1 A THR 18 ? A THR 18 19 1 Y 1 A LEU 19 ? A LEU 19 20 1 Y 1 A VAL 20 ? A VAL 20 21 1 Y 1 A LEU 21 ? A LEU 21 22 1 Y 1 A PRO 22 ? A PRO 22 23 1 Y 1 A SER 23 ? A SER 23 24 1 Y 1 A THR 24 ? A THR 24 25 1 Y 1 A THR 25 ? A THR 25 26 1 Y 1 A SER 26 ? A SER 26 27 1 Y 1 A LEU 27 ? A LEU 27 28 1 Y 1 A PHE 28 ? A PHE 28 29 1 Y 1 A LEU 29 ? A LEU 29 30 1 Y 1 A GLY 30 ? A GLY 30 31 1 Y 1 A ALA 251 ? A ALA 251 32 1 Y 1 A SER 252 ? A SER 252 33 1 Y 1 A ASN 253 ? A ASN 253 34 1 Y 1 A TRP 254 ? A TRP 254 35 1 Y 1 A PRO 255 ? A PRO 255 36 1 Y 1 A GLY 256 ? A GLY 256 37 1 Y 1 A TRP 257 ? A TRP 257 38 1 Y 1 A TYR 258 ? A TYR 258 39 1 Y 1 A PRO 259 ? A PRO 259 40 1 Y 1 A TYR 260 ? A TYR 260 41 1 Y 1 A SER 261 ? A SER 261 42 1 Y 1 A TRP 262 ? A TRP 262 # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' _em_ctf_correction.details ? # _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 58290 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Archaeoglobus veneficus' _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_helical_entity.id 1 _em_helical_entity.image_processing_id 1 _em_helical_entity.angular_rotation_per_subunit 33.52 _em_helical_entity.axial_rise_per_subunit 32.74 _em_helical_entity.axial_symmetry C1 _em_helical_entity.details ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 45 _em_image_recording.average_exposure_time ? _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K3 (6k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? _em_image_recording.avg_electron_dose_per_subtomogram ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'CRYSTALLOGRAPHY MERGING' ? ? ? 1 1 1 2 'IMAGE ACQUISITION' ? ? ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? ? ? 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? ? ? ? ? ? 8 'MODEL REFINEMENT' ? ? ? ? ? ? 9 OTHER ? ? ? ? ? ? 10 'INITIAL EULER ASSIGNMENT' ? ? ? 1 ? ? 11 'FINAL EULER ASSIGNMENT' ? ? ? 1 ? ? 12 CLASSIFICATION ? ? ? 1 ? ? 13 RECONSTRUCTION ? ? ? 1 ? ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 5K99GM138756-02 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R35GM122510 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HEC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HEC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'HEME C' _pdbx_entity_nonpoly.comp_id HEC # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support microscopy _pdbx_struct_assembly_auth_evidence.details ? #