data_8E6Y # _entry.id 8E6Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8E6Y pdb_00008e6y 10.2210/pdb8e6y/pdb WWPDB D_1000263398 ? ? BMRB 51339 ? 10.13018/BMR51339 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-01-11 2 'Structure model' 1 1 2023-02-01 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_citation_author.identifier_ORCID' 14 2 'Structure model' '_citation_author.name' 15 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8E6Y _pdbx_database_status.recvd_initial_deposition_date 2022-08-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 51339 _pdbx_database_related.content_type unspecified # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 jorban@umd.edu John Orban ? 'principal investigator/group leader' 0000-0002-3895-1800 3 hey@umd.edu Yanan He ? 'principal investigator/group leader' 0000-0002-1428-1507 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Solomon, T.S.' 1 ? 'Orban, J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 120 _citation.language ? _citation.page_first e2215418120 _citation.page_last e2215418120 _citation.title 'Reversible switching between two common protein folds in a designed system using only temperature.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2215418120 _citation.pdbx_database_id_PubMed 36669114 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Solomon, T.L.' 1 ? primary 'He, Y.' 2 ? primary 'Sari, N.' 3 ? primary 'Chen, Y.' 4 ? primary 'Gallagher, D.T.' 5 ? primary 'Bryan, P.N.' 6 0000-0001-7813-7523 primary 'Orban, J.' 7 0000-0002-3895-1800 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Sa1_V90T_30C _entity.formula_weight 10602.306 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SKTFEVNIVLNPNLDQKQLAQAKELAIKALKQYGIGVEKIKLIGNAKTVEAVEKLKQGILLVYQIEAPADRVNDLARELR ILDAVRRVETTYAAD ; _entity_poly.pdbx_seq_one_letter_code_can ;SKTFEVNIVLNPNLDQKQLAQAKELAIKALKQYGIGVEKIKLIGNAKTVEAVEKLKQGILLVYQIEAPADRVNDLARELR ILDAVRRVETTYAAD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LYS n 1 3 THR n 1 4 PHE n 1 5 GLU n 1 6 VAL n 1 7 ASN n 1 8 ILE n 1 9 VAL n 1 10 LEU n 1 11 ASN n 1 12 PRO n 1 13 ASN n 1 14 LEU n 1 15 ASP n 1 16 GLN n 1 17 LYS n 1 18 GLN n 1 19 LEU n 1 20 ALA n 1 21 GLN n 1 22 ALA n 1 23 LYS n 1 24 GLU n 1 25 LEU n 1 26 ALA n 1 27 ILE n 1 28 LYS n 1 29 ALA n 1 30 LEU n 1 31 LYS n 1 32 GLN n 1 33 TYR n 1 34 GLY n 1 35 ILE n 1 36 GLY n 1 37 VAL n 1 38 GLU n 1 39 LYS n 1 40 ILE n 1 41 LYS n 1 42 LEU n 1 43 ILE n 1 44 GLY n 1 45 ASN n 1 46 ALA n 1 47 LYS n 1 48 THR n 1 49 VAL n 1 50 GLU n 1 51 ALA n 1 52 VAL n 1 53 GLU n 1 54 LYS n 1 55 LEU n 1 56 LYS n 1 57 GLN n 1 58 GLY n 1 59 ILE n 1 60 LEU n 1 61 LEU n 1 62 VAL n 1 63 TYR n 1 64 GLN n 1 65 ILE n 1 66 GLU n 1 67 ALA n 1 68 PRO n 1 69 ALA n 1 70 ASP n 1 71 ARG n 1 72 VAL n 1 73 ASN n 1 74 ASP n 1 75 LEU n 1 76 ALA n 1 77 ARG n 1 78 GLU n 1 79 LEU n 1 80 ARG n 1 81 ILE n 1 82 LEU n 1 83 ASP n 1 84 ALA n 1 85 VAL n 1 86 ARG n 1 87 ARG n 1 88 VAL n 1 89 GLU n 1 90 THR n 1 91 THR n 1 92 TYR n 1 93 ALA n 1 94 ALA n 1 95 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 95 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details 'engineered protein' _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pH0721 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ASP 95 95 95 ASP ASP A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8E6Y _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8E6Y _struct.title 'NMR structure of Sa1_V90T at 30 degrees Celsius' _struct.pdbx_model_details 'Solution structure' _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8E6Y _struct_keywords.text 'alpha-beta plait, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8E6Y _struct_ref.pdbx_db_accession 8E6Y _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8E6Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 95 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8E6Y _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 95 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 95 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 15 ? LYS A 31 ? ASP A 15 LYS A 31 1 ? 17 HELX_P HELX_P2 AA2 GLN A 32 ? GLY A 34 ? GLN A 32 GLY A 34 5 ? 3 HELX_P HELX_P3 AA3 PRO A 68 ? ASP A 70 ? PRO A 68 ASP A 70 5 ? 3 HELX_P HELX_P4 AA4 ARG A 71 ? ARG A 80 ? ARG A 71 ARG A 80 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 40 ? ILE A 43 ? ILE A 40 ILE A 43 AA1 2 ILE A 59 ? ALA A 67 ? ILE A 59 ALA A 67 AA1 3 LYS A 2 ? LEU A 10 ? LYS A 2 LEU A 10 AA1 4 VAL A 85 ? TYR A 92 ? VAL A 85 TYR A 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 41 ? N LYS A 41 O VAL A 62 ? O VAL A 62 AA1 2 3 O LEU A 61 ? O LEU A 61 N ILE A 8 ? N ILE A 8 AA1 3 4 N VAL A 9 ? N VAL A 9 O ARG A 87 ? O ARG A 87 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 5 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 15 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLN _pdbx_validate_close_contact.auth_seq_id_2 18 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 57 ? ? -143.84 -84.76 2 3 GLN A 57 ? ? -132.65 -44.48 3 4 ASN A 45 ? ? -148.32 58.62 4 4 THR A 48 ? ? -112.29 -88.54 5 6 ALA A 46 ? ? -141.09 -25.77 6 6 GLU A 50 ? ? 69.92 -56.22 7 7 VAL A 52 ? ? -68.20 0.56 8 8 LYS A 47 ? ? -160.14 -17.02 9 8 LYS A 54 ? ? -125.09 -51.67 10 9 THR A 48 ? ? -138.18 -155.22 11 9 VAL A 49 ? ? -38.72 141.08 12 9 GLU A 50 ? ? -62.60 88.88 # _pdbx_nmr_ensemble.entry_id 8E6Y _pdbx_nmr_ensemble.conformers_calculated_total_number 5000 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria '10 structures for the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8E6Y _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '240 uM [U-13C; U-15N] 15N13C_Sa1_V90T, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 15N13C_Sa1_V90T _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 15N13C_Sa1_V90T _pdbx_nmr_exptl_sample.concentration 240 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM Potassium phosphate' _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 15N13C_Sa1_V90T _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCACB' 2 isotropic 3 1 1 '3D CBCA(CO)NH' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D_HN(CA)CO' 1 isotropic 6 1 1 '3D HNHA' 1 isotropic 7 1 1 '3D 1H-15N NOESY' 2 isotropic 8 1 1 '3D HNCA' 1 isotropic # _pdbx_nmr_refine.entry_id 8E6Y _pdbx_nmr_refine.method CS-Rosetta _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 'structure calculation' CS-ROSETTA ? 'Shen, Vernon, Baker and Bax' 3 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' 4 'peak picking' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 PHE N N N N 192 PHE CA C N S 193 PHE C C N N 194 PHE O O N N 195 PHE CB C N N 196 PHE CG C Y N 197 PHE CD1 C Y N 198 PHE CD2 C Y N 199 PHE CE1 C Y N 200 PHE CE2 C Y N 201 PHE CZ C Y N 202 PHE OXT O N N 203 PHE H H N N 204 PHE H2 H N N 205 PHE HA H N N 206 PHE HB2 H N N 207 PHE HB3 H N N 208 PHE HD1 H N N 209 PHE HD2 H N N 210 PHE HE1 H N N 211 PHE HE2 H N N 212 PHE HZ H N N 213 PHE HXT H N N 214 PRO N N N N 215 PRO CA C N S 216 PRO C C N N 217 PRO O O N N 218 PRO CB C N N 219 PRO CG C N N 220 PRO CD C N N 221 PRO OXT O N N 222 PRO H H N N 223 PRO HA H N N 224 PRO HB2 H N N 225 PRO HB3 H N N 226 PRO HG2 H N N 227 PRO HG3 H N N 228 PRO HD2 H N N 229 PRO HD3 H N N 230 PRO HXT H N N 231 SER N N N N 232 SER CA C N S 233 SER C C N N 234 SER O O N N 235 SER CB C N N 236 SER OG O N N 237 SER OXT O N N 238 SER H H N N 239 SER H2 H N N 240 SER HA H N N 241 SER HB2 H N N 242 SER HB3 H N N 243 SER HG H N N 244 SER HXT H N N 245 THR N N N N 246 THR CA C N S 247 THR C C N N 248 THR O O N N 249 THR CB C N R 250 THR OG1 O N N 251 THR CG2 C N N 252 THR OXT O N N 253 THR H H N N 254 THR H2 H N N 255 THR HA H N N 256 THR HB H N N 257 THR HG1 H N N 258 THR HG21 H N N 259 THR HG22 H N N 260 THR HG23 H N N 261 THR HXT H N N 262 TYR N N N N 263 TYR CA C N S 264 TYR C C N N 265 TYR O O N N 266 TYR CB C N N 267 TYR CG C Y N 268 TYR CD1 C Y N 269 TYR CD2 C Y N 270 TYR CE1 C Y N 271 TYR CE2 C Y N 272 TYR CZ C Y N 273 TYR OH O N N 274 TYR OXT O N N 275 TYR H H N N 276 TYR H2 H N N 277 TYR HA H N N 278 TYR HB2 H N N 279 TYR HB3 H N N 280 TYR HD1 H N N 281 TYR HD2 H N N 282 TYR HE1 H N N 283 TYR HE2 H N N 284 TYR HH H N N 285 TYR HXT H N N 286 VAL N N N N 287 VAL CA C N S 288 VAL C C N N 289 VAL O O N N 290 VAL CB C N N 291 VAL CG1 C N N 292 VAL CG2 C N N 293 VAL OXT O N N 294 VAL H H N N 295 VAL H2 H N N 296 VAL HA H N N 297 VAL HB H N N 298 VAL HG11 H N N 299 VAL HG12 H N N 300 VAL HG13 H N N 301 VAL HG21 H N N 302 VAL HG22 H N N 303 VAL HG23 H N N 304 VAL HXT H N N 305 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 PHE N CA sing N N 182 PHE N H sing N N 183 PHE N H2 sing N N 184 PHE CA C sing N N 185 PHE CA CB sing N N 186 PHE CA HA sing N N 187 PHE C O doub N N 188 PHE C OXT sing N N 189 PHE CB CG sing N N 190 PHE CB HB2 sing N N 191 PHE CB HB3 sing N N 192 PHE CG CD1 doub Y N 193 PHE CG CD2 sing Y N 194 PHE CD1 CE1 sing Y N 195 PHE CD1 HD1 sing N N 196 PHE CD2 CE2 doub Y N 197 PHE CD2 HD2 sing N N 198 PHE CE1 CZ doub Y N 199 PHE CE1 HE1 sing N N 200 PHE CE2 CZ sing Y N 201 PHE CE2 HE2 sing N N 202 PHE CZ HZ sing N N 203 PHE OXT HXT sing N N 204 PRO N CA sing N N 205 PRO N CD sing N N 206 PRO N H sing N N 207 PRO CA C sing N N 208 PRO CA CB sing N N 209 PRO CA HA sing N N 210 PRO C O doub N N 211 PRO C OXT sing N N 212 PRO CB CG sing N N 213 PRO CB HB2 sing N N 214 PRO CB HB3 sing N N 215 PRO CG CD sing N N 216 PRO CG HG2 sing N N 217 PRO CG HG3 sing N N 218 PRO CD HD2 sing N N 219 PRO CD HD3 sing N N 220 PRO OXT HXT sing N N 221 SER N CA sing N N 222 SER N H sing N N 223 SER N H2 sing N N 224 SER CA C sing N N 225 SER CA CB sing N N 226 SER CA HA sing N N 227 SER C O doub N N 228 SER C OXT sing N N 229 SER CB OG sing N N 230 SER CB HB2 sing N N 231 SER CB HB3 sing N N 232 SER OG HG sing N N 233 SER OXT HXT sing N N 234 THR N CA sing N N 235 THR N H sing N N 236 THR N H2 sing N N 237 THR CA C sing N N 238 THR CA CB sing N N 239 THR CA HA sing N N 240 THR C O doub N N 241 THR C OXT sing N N 242 THR CB OG1 sing N N 243 THR CB CG2 sing N N 244 THR CB HB sing N N 245 THR OG1 HG1 sing N N 246 THR CG2 HG21 sing N N 247 THR CG2 HG22 sing N N 248 THR CG2 HG23 sing N N 249 THR OXT HXT sing N N 250 TYR N CA sing N N 251 TYR N H sing N N 252 TYR N H2 sing N N 253 TYR CA C sing N N 254 TYR CA CB sing N N 255 TYR CA HA sing N N 256 TYR C O doub N N 257 TYR C OXT sing N N 258 TYR CB CG sing N N 259 TYR CB HB2 sing N N 260 TYR CB HB3 sing N N 261 TYR CG CD1 doub Y N 262 TYR CG CD2 sing Y N 263 TYR CD1 CE1 sing Y N 264 TYR CD1 HD1 sing N N 265 TYR CD2 CE2 doub Y N 266 TYR CD2 HD2 sing N N 267 TYR CE1 CZ doub Y N 268 TYR CE1 HE1 sing N N 269 TYR CE2 CZ sing Y N 270 TYR CE2 HE2 sing N N 271 TYR CZ OH sing N N 272 TYR OH HH sing N N 273 TYR OXT HXT sing N N 274 VAL N CA sing N N 275 VAL N H sing N N 276 VAL N H2 sing N N 277 VAL CA C sing N N 278 VAL CA CB sing N N 279 VAL CA HA sing N N 280 VAL C O doub N N 281 VAL C OXT sing N N 282 VAL CB CG1 sing N N 283 VAL CB CG2 sing N N 284 VAL CB HB sing N N 285 VAL CG1 HG11 sing N N 286 VAL CG1 HG12 sing N N 287 VAL CG1 HG13 sing N N 288 VAL CG2 HG21 sing N N 289 VAL CG2 HG22 sing N N 290 VAL CG2 HG23 sing N N 291 VAL OXT HXT sing N N 292 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM62154 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 900 ? # _atom_sites.entry_id 8E6Y _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_