data_8ENP # _entry.id 8ENP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8ENP pdb_00008enp 10.2210/pdb8enp/pdb WWPDB D_1000268542 ? ? BMRB 31043 ? 10.13018/BMR31043 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-10-18 2 'Structure model' 1 1 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category database_2 # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8ENP _pdbx_database_status.recvd_initial_deposition_date 2022-09-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'UBE3A isoform 3 AZUL' _pdbx_database_related.db_id 31043 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email bezsonova@uchc.edu _pdbx_contact_author.name_first Irina _pdbx_contact_author.name_last Bezsonova _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8629-0349 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bregnard, T.A.' 1 0000-0003-4778-890X 'Bezsonova, I.' 2 0000-0002-8629-0349 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Differences in structure, dynamics and Zn-coordination between isoforms of human ubiquitin ligase UBE3A' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bregnard, T.A.' 1 0000-0003-4778-890X primary 'Fairchild, D.' 2 0000-0001-9191-1149 primary 'Chen, X.' 3 0000-0002-0036-0212 primary 'Erlandsen, H.' 4 0000-0002-0716-5460 primary 'Walters, K.J.' 5 0000-0001-7590-2891 primary 'Korzhnev, D.M.' 6 0000-0002-3556-2447 primary 'Bezsonova, I.' 7 0000-0002-8629-0349 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Isoform III of Ubiquitin-protein ligase E3A' 9630.942 1 2.3.2.26 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;E6AP ubiquitin-protein ligase,HECT-type ubiquitin transferase E3A,Human papillomavirus E6-associated protein,Oncogenic protein-associated protein E6-AP,Renal carcinoma antigen NY-REN-54 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMATACKRSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINA KLCDPHP ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMATACKRSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINA KLCDPHP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 THR n 1 7 ALA n 1 8 CYS n 1 9 LYS n 1 10 ARG n 1 11 SER n 1 12 GLY n 1 13 GLU n 1 14 PRO n 1 15 GLN n 1 16 SER n 1 17 ASP n 1 18 ASP n 1 19 ILE n 1 20 GLU n 1 21 ALA n 1 22 SER n 1 23 ARG n 1 24 MET n 1 25 LYS n 1 26 ARG n 1 27 ALA n 1 28 ALA n 1 29 ALA n 1 30 LYS n 1 31 HIS n 1 32 LEU n 1 33 ILE n 1 34 GLU n 1 35 ARG n 1 36 TYR n 1 37 TYR n 1 38 HIS n 1 39 GLN n 1 40 LEU n 1 41 THR n 1 42 GLU n 1 43 GLY n 1 44 CYS n 1 45 GLY n 1 46 ASN n 1 47 GLU n 1 48 ALA n 1 49 CYS n 1 50 THR n 1 51 ASN n 1 52 GLU n 1 53 PHE n 1 54 CYS n 1 55 ALA n 1 56 SER n 1 57 CYS n 1 58 PRO n 1 59 THR n 1 60 PHE n 1 61 LEU n 1 62 ARG n 1 63 MET n 1 64 ASP n 1 65 ASN n 1 66 ASN n 1 67 ALA n 1 68 ALA n 1 69 ALA n 1 70 ILE n 1 71 LYS n 1 72 ALA n 1 73 LEU n 1 74 GLU n 1 75 LEU n 1 76 TYR n 1 77 LYS n 1 78 ILE n 1 79 ASN n 1 80 ALA n 1 81 LYS n 1 82 LEU n 1 83 CYS n 1 84 ASP n 1 85 PRO n 1 86 HIS n 1 87 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 87 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'UBE3A, E6AP, EPVE6AP, HPVE6A' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28b+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 PRO 87 87 87 PRO PRO A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 88 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8ENP _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8ENP _struct.title 'UBE3A isoform 3 AZUL' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8ENP _struct_keywords.text 'ubiquitin ligase, proteasome interaction, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UBE3A_HUMAN _struct_ref.pdbx_db_accession Q05086 _struct_ref.pdbx_db_isoform Q05086-3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MATACKRSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLC DPHP ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8ENP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q05086 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 84 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8ENP GLY A 1 ? UNP Q05086 ? ? 'expression tag' 1 1 1 8ENP SER A 2 ? UNP Q05086 ? ? 'expression tag' 2 2 1 8ENP HIS A 3 ? UNP Q05086 ? ? 'expression tag' 3 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details 'structural zinc is required for proper folding' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 15 ? GLU A 42 ? GLN A 15 GLU A 42 1 ? 28 HELX_P HELX_P2 AA2 ASP A 64 ? ASN A 79 ? ASP A 64 ASN A 79 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 44 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 44 A ZN 101 1_555 ? ? ? ? ? ? ? 2.345 ? ? metalc2 metalc ? ? A CYS 49 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 49 A ZN 101 1_555 ? ? ? ? ? ? ? 2.326 ? ? metalc3 metalc ? ? A CYS 54 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 54 A ZN 101 1_555 ? ? ? ? ? ? ? 2.326 ? ? metalc4 metalc ? ? A CYS 83 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 83 A ZN 101 1_555 ? ? ? ? ? ? ? 2.320 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 107.3 ? 2 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 111.8 ? 3 SG ? A CYS 49 ? A CYS 49 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 107.9 ? 4 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 83 ? A CYS 83 ? 1_555 109.7 ? 5 SG ? A CYS 49 ? A CYS 49 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 83 ? A CYS 83 ? 1_555 110.1 ? 6 SG ? A CYS 54 ? A CYS 54 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 83 ? A CYS 83 ? 1_555 110.0 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 5 ? ? -69.61 85.99 2 1 ALA A 7 ? ? -169.89 52.14 3 1 CYS A 44 ? ? -141.18 -50.08 4 1 ALA A 48 ? ? -92.22 45.27 5 1 THR A 50 ? ? -55.18 89.77 6 1 PHE A 53 ? ? -118.92 79.06 7 1 PHE A 60 ? ? 57.41 71.92 8 1 ASN A 79 ? ? 58.72 74.20 9 1 PRO A 85 ? ? -85.59 -158.83 10 2 SER A 11 ? ? -58.97 96.73 11 2 CYS A 44 ? ? -157.16 -13.69 12 2 ALA A 48 ? ? -109.47 71.75 13 2 THR A 50 ? ? -63.48 95.95 14 2 PHE A 53 ? ? -105.28 74.96 15 2 PHE A 60 ? ? 64.31 75.19 16 2 ASN A 79 ? ? 57.95 74.07 17 2 ASP A 84 ? ? -69.78 97.31 18 2 HIS A 86 ? ? -158.58 78.81 19 3 THR A 6 ? ? -68.85 86.73 20 3 CYS A 8 ? ? -67.60 85.83 21 3 SER A 11 ? ? 48.75 -80.19 22 3 CYS A 44 ? ? -145.12 -38.32 23 3 THR A 50 ? ? -60.89 86.39 24 3 PRO A 58 ? ? -69.06 2.61 25 3 PHE A 60 ? ? 63.49 67.53 26 3 HIS A 86 ? ? -151.32 80.64 27 4 LYS A 9 ? ? 69.26 153.52 28 4 SER A 11 ? ? -151.87 -153.11 29 4 THR A 41 ? ? -124.21 -58.00 30 4 CYS A 44 ? ? -133.04 -56.57 31 4 ALA A 48 ? ? -101.35 53.26 32 4 THR A 50 ? ? -52.22 90.38 33 4 HIS A 86 ? ? -173.05 92.43 34 5 ALA A 5 ? ? -88.15 49.74 35 5 ARG A 10 ? ? -154.41 61.42 36 5 CYS A 44 ? ? -149.21 -35.30 37 5 ALA A 48 ? ? -116.11 69.01 38 5 THR A 50 ? ? -61.24 88.98 39 5 PHE A 60 ? ? 59.98 90.08 40 6 CYS A 8 ? ? -63.71 99.13 41 6 ARG A 10 ? ? -92.58 -154.48 42 6 CYS A 44 ? ? -175.03 65.77 43 6 ALA A 48 ? ? -110.74 72.75 44 6 THR A 50 ? ? -54.39 95.25 45 6 PHE A 60 ? ? 63.82 78.59 46 6 ASN A 79 ? ? 54.69 73.29 47 7 ALA A 7 ? ? -67.53 90.04 48 7 ARG A 10 ? ? -63.21 92.77 49 7 SER A 11 ? ? -159.42 26.12 50 7 GLU A 13 ? ? 72.11 143.20 51 7 CYS A 44 ? ? -132.17 -31.90 52 7 THR A 50 ? ? -57.09 86.63 53 7 ASN A 79 ? ? 58.96 74.27 54 7 ASP A 84 ? ? -142.82 55.56 55 7 HIS A 86 ? ? -156.90 70.60 56 8 SER A 2 ? ? -154.59 37.92 57 8 HIS A 3 ? ? -69.64 90.11 58 8 ARG A 10 ? ? -56.34 106.06 59 8 GLU A 13 ? ? 65.51 168.40 60 8 SER A 16 ? ? -159.13 -33.53 61 8 CYS A 44 ? ? 162.82 -27.45 62 8 ALA A 48 ? ? -95.87 46.31 63 8 THR A 50 ? ? -45.22 90.48 64 8 ASN A 79 ? ? 65.74 75.47 65 8 HIS A 86 ? ? 65.83 107.48 66 9 HIS A 3 ? ? -110.96 -165.64 67 9 CYS A 8 ? ? 67.13 172.69 68 9 ARG A 10 ? ? 61.12 83.87 69 9 SER A 11 ? ? -138.12 -154.97 70 9 GLU A 13 ? ? 59.27 106.80 71 9 CYS A 44 ? ? -141.41 -32.07 72 9 ALA A 48 ? ? -90.71 34.83 73 9 THR A 50 ? ? -51.46 92.60 74 9 ASN A 79 ? ? 52.18 70.89 75 9 ASP A 84 ? ? -56.74 104.44 76 9 HIS A 86 ? ? -153.08 61.06 77 10 ALA A 5 ? ? -69.69 91.34 78 10 ARG A 10 ? ? 75.83 130.85 79 10 THR A 41 ? ? -131.06 -40.37 80 10 CYS A 44 ? ? -142.96 -38.02 81 10 ALA A 48 ? ? -108.23 52.39 82 10 THR A 50 ? ? -52.34 91.19 83 10 PHE A 60 ? ? 62.98 61.91 84 11 GLU A 13 ? ? 67.73 154.99 85 11 CYS A 44 ? ? -131.60 -46.83 86 11 ALA A 48 ? ? -90.81 41.64 87 11 THR A 50 ? ? -52.11 88.39 88 11 ASN A 79 ? ? 58.77 74.87 89 11 PRO A 85 ? ? -94.68 -147.36 90 12 ALA A 7 ? ? -150.35 83.45 91 12 CYS A 44 ? ? -159.76 -30.23 92 12 ALA A 48 ? ? -99.51 37.46 93 12 THR A 50 ? ? -55.49 92.35 94 12 SER A 56 ? ? -68.28 0.75 95 12 ASN A 79 ? ? 64.95 75.69 96 12 ASP A 84 ? ? -163.60 78.79 97 13 ALA A 5 ? ? -162.73 99.78 98 13 LYS A 9 ? ? -122.68 -162.76 99 13 SER A 11 ? ? -82.35 38.57 100 13 GLU A 13 ? ? 65.57 163.88 101 13 CYS A 44 ? ? -169.69 -44.27 102 13 ALA A 48 ? ? -92.70 39.75 103 13 THR A 50 ? ? -47.32 92.82 104 13 ASN A 79 ? ? 55.68 74.57 105 13 HIS A 86 ? ? 54.17 74.51 106 14 SER A 11 ? ? -80.58 -71.12 107 14 PRO A 14 ? ? -70.89 -166.73 108 14 THR A 41 ? ? -131.64 -40.12 109 14 CYS A 44 ? ? 179.05 54.67 110 14 ALA A 48 ? ? -108.10 70.86 111 14 ASN A 79 ? ? 58.56 74.93 112 14 CYS A 83 ? ? -84.76 36.59 113 15 CYS A 44 ? ? -161.74 -29.25 114 15 ALA A 48 ? ? -105.89 53.35 115 15 THR A 50 ? ? -51.73 90.64 116 15 ASN A 79 ? ? 57.30 74.41 117 15 LYS A 81 ? ? -67.93 98.59 118 16 SER A 2 ? ? -84.31 -70.27 119 16 ALA A 5 ? ? -63.13 89.22 120 16 GLU A 13 ? ? 63.47 94.48 121 16 CYS A 44 ? ? -154.24 -34.87 122 16 ALA A 48 ? ? -107.30 45.82 123 16 THR A 50 ? ? -55.44 90.29 124 16 ASN A 79 ? ? 58.68 73.83 125 16 HIS A 86 ? ? 60.50 77.71 126 17 SER A 2 ? ? 72.01 -5.57 127 17 SER A 11 ? ? -133.23 -51.56 128 17 GLU A 13 ? ? 63.97 153.71 129 17 CYS A 44 ? ? -173.07 -37.82 130 17 ALA A 48 ? ? -94.47 39.86 131 17 THR A 50 ? ? -46.47 92.21 132 17 PHE A 60 ? ? 60.10 69.08 133 17 ARG A 62 ? ? -164.25 -169.75 134 17 ASN A 79 ? ? 62.61 69.08 135 17 HIS A 86 ? ? 59.22 71.54 136 18 GLU A 13 ? ? 70.43 148.88 137 18 CYS A 44 ? ? -163.02 -51.40 138 18 ALA A 48 ? ? -103.65 48.49 139 18 THR A 50 ? ? -52.14 89.63 140 18 ASN A 79 ? ? 57.84 72.40 141 19 GLU A 13 ? ? 70.21 147.81 142 19 CYS A 44 ? ? -149.86 -21.91 143 19 ALA A 48 ? ? -110.58 61.44 144 19 THR A 50 ? ? -50.70 88.98 145 19 PHE A 60 ? ? 64.73 82.77 146 19 ASN A 79 ? ? 56.44 74.10 147 20 CYS A 44 ? ? -176.51 -21.19 148 20 THR A 50 ? ? -47.87 92.13 149 20 PHE A 60 ? ? 57.71 74.35 150 20 ASN A 79 ? ? 60.15 70.16 151 20 HIS A 86 ? ? 57.80 71.56 # _pdbx_entry_details.entry_id 8ENP _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_nmr_ensemble.entry_id 8ENP _pdbx_nmr_ensemble.conformers_calculated_total_number 10000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8ENP _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.7 mM [U-99% 13C; U-99% 15N] UBE3A iso 3 AZUL, 10 mM MOPS, 450 mM sodium chloride, 10 mM beta-mercaptoethanol, 10 uM zinc sulfate, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 'UBE3A AZUL iso3 1' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'UBE3A iso 3 AZUL' 1.7 ? mM '[U-99% 13C; U-99% 15N]' 1 MOPS 10 ? mM 'natural abundance' 1 'sodium chloride' 450 ? mM 'natural abundance' 1 beta-mercaptoethanol 10 ? mM 'natural abundance' 1 'zinc sulfate' 10 ? uM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 450 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'structure conditions' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCO' 1 isotropic 3 1 1 '3D HNCA' 1 isotropic 4 1 1 '3D HN(CO)CA' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 6 1 1 '3D CBCA(CO)NH' 1 isotropic 7 1 1 '3D HBHA(CO)NH' 1 isotropic 8 1 1 '2D 1H-13C HSQC' 1 isotropic 9 1 1 '3D CCH-TOCSY' 1 isotropic 10 1 1 '3D HCCH-TOCSY' 1 isotropic 11 1 1 '3D 1H-15N NOESY' 1 isotropic 12 1 1 '3D 1H-13C NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 8ENP _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'CNS refinement in explicit water' _pdbx_nmr_refine.software_ordinal 5 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 5 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee, Tonelli, and Markley' 3 'geometry optimization' TALOS ? 'Cornilescu, Delaglio and Bax' 4 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 ZN ZN ZN N N 342 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'R35 GM128864' 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 'R21 AI135451' 2 'National Science Foundation (NSF, United States)' 'United States' 'NSF 1616184' 3 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model VNMRS _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Agilent _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 8ENP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S ZN # loop_