data_8EQE # _entry.id 8EQE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8EQE pdb_00008eqe 10.2210/pdb8eqe/pdb WWPDB D_1000269218 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 8EQ9 unspecified PDB . 8EQD unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8EQE _pdbx_database_status.recvd_initial_deposition_date 2022-10-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhu, G.' 1 0000-0003-4228-135X 'Surman, M.D.' 2 ? 'Mulvihill, M.J.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Pharmaceutics _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1999-4923 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Optimization of a Novel Mandelamide-Derived Pyrrolopyrimidine Series of PERK Inhibitors.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/pharmaceutics14102233 _citation.pdbx_database_id_PubMed 36297668 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Stokes, M.E.' 1 ? primary 'Surman, M.D.' 2 ? primary 'Calvo, V.' 3 ? primary 'Surguladze, D.' 4 ? primary 'Li, A.H.' 5 ? primary 'Gasparek, J.' 6 ? primary 'Betzenhauser, M.' 7 ? primary 'Zhu, G.' 8 0000-0003-4228-135X primary 'Du, H.' 9 ? primary 'Rigby, A.C.' 10 ? primary 'Mulvihill, M.J.' 11 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8EQE _cell.details ? _cell.formula_units_Z ? _cell.length_a 125.342 _cell.length_a_esd ? _cell.length_b 125.342 _cell.length_b_esd ? _cell.length_c 58.084 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8EQE _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Eukaryotic translation initiation factor 2-alpha kinase 3' 36816.363 1 2.7.11.1 ? ? ? 2 non-polymer syn ;(2R)-N-[(4M)-4-(4-amino-2,7-dimethyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-3-methylphenyl]-2-hydroxy-2-[3-(trifluoromethyl)phenyl]acetamide ; 469.459 1 ? ? ? ? 3 water nat water 18.015 6 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PRKR-like endoplasmic reticulum kinase,Pancreatic eIF2-alpha kinase,HsPEK' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSSWNDIKNSGYISRYLTDFEPIQCLGRGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIV RYFNAWLEAPPEKWQEKLQPSSPKVYLYIQMQLCRKENLKDWMNGRCTIEERERSVCLHIFLQIAEAVEFLHSKGLMHRN LKPSNIFFTMDDVVKVGDFGLVTAMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFEL LYPFSTQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEAINIIENAVFEDLDFPGKTVLRQRSRS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSSWNDIKNSGYISRYLTDFEPIQCLGRGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIV RYFNAWLEAPPEKWQEKLQPSSPKVYLYIQMQLCRKENLKDWMNGRCTIEERERSVCLHIFLQIAEAVEFLHSKGLMHRN LKPSNIFFTMDDVVKVGDFGLVTAMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFEL LYPFSTQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEAINIIENAVFEDLDFPGKTVLRQRSRS ; _entity_poly.pdbx_strand_id AAA _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 SER n 1 5 TRP n 1 6 ASN n 1 7 ASP n 1 8 ILE n 1 9 LYS n 1 10 ASN n 1 11 SER n 1 12 GLY n 1 13 TYR n 1 14 ILE n 1 15 SER n 1 16 ARG n 1 17 TYR n 1 18 LEU n 1 19 THR n 1 20 ASP n 1 21 PHE n 1 22 GLU n 1 23 PRO n 1 24 ILE n 1 25 GLN n 1 26 CYS n 1 27 LEU n 1 28 GLY n 1 29 ARG n 1 30 GLY n 1 31 GLY n 1 32 PHE n 1 33 GLY n 1 34 VAL n 1 35 VAL n 1 36 PHE n 1 37 GLU n 1 38 ALA n 1 39 LYS n 1 40 ASN n 1 41 LYS n 1 42 VAL n 1 43 ASP n 1 44 ASP n 1 45 CYS n 1 46 ASN n 1 47 TYR n 1 48 ALA n 1 49 ILE n 1 50 LYS n 1 51 ARG n 1 52 ILE n 1 53 ARG n 1 54 LEU n 1 55 PRO n 1 56 ASN n 1 57 ARG n 1 58 GLU n 1 59 LEU n 1 60 ALA n 1 61 ARG n 1 62 GLU n 1 63 LYS n 1 64 VAL n 1 65 MET n 1 66 ARG n 1 67 GLU n 1 68 VAL n 1 69 LYS n 1 70 ALA n 1 71 LEU n 1 72 ALA n 1 73 LYS n 1 74 LEU n 1 75 GLU n 1 76 HIS n 1 77 PRO n 1 78 GLY n 1 79 ILE n 1 80 VAL n 1 81 ARG n 1 82 TYR n 1 83 PHE n 1 84 ASN n 1 85 ALA n 1 86 TRP n 1 87 LEU n 1 88 GLU n 1 89 ALA n 1 90 PRO n 1 91 PRO n 1 92 GLU n 1 93 LYS n 1 94 TRP n 1 95 GLN n 1 96 GLU n 1 97 LYS n 1 98 LEU n 1 99 GLN n 1 100 PRO n 1 101 SER n 1 102 SER n 1 103 PRO n 1 104 LYS n 1 105 VAL n 1 106 TYR n 1 107 LEU n 1 108 TYR n 1 109 ILE n 1 110 GLN n 1 111 MET n 1 112 GLN n 1 113 LEU n 1 114 CYS n 1 115 ARG n 1 116 LYS n 1 117 GLU n 1 118 ASN n 1 119 LEU n 1 120 LYS n 1 121 ASP n 1 122 TRP n 1 123 MET n 1 124 ASN n 1 125 GLY n 1 126 ARG n 1 127 CYS n 1 128 THR n 1 129 ILE n 1 130 GLU n 1 131 GLU n 1 132 ARG n 1 133 GLU n 1 134 ARG n 1 135 SER n 1 136 VAL n 1 137 CYS n 1 138 LEU n 1 139 HIS n 1 140 ILE n 1 141 PHE n 1 142 LEU n 1 143 GLN n 1 144 ILE n 1 145 ALA n 1 146 GLU n 1 147 ALA n 1 148 VAL n 1 149 GLU n 1 150 PHE n 1 151 LEU n 1 152 HIS n 1 153 SER n 1 154 LYS n 1 155 GLY n 1 156 LEU n 1 157 MET n 1 158 HIS n 1 159 ARG n 1 160 ASN n 1 161 LEU n 1 162 LYS n 1 163 PRO n 1 164 SER n 1 165 ASN n 1 166 ILE n 1 167 PHE n 1 168 PHE n 1 169 THR n 1 170 MET n 1 171 ASP n 1 172 ASP n 1 173 VAL n 1 174 VAL n 1 175 LYS n 1 176 VAL n 1 177 GLY n 1 178 ASP n 1 179 PHE n 1 180 GLY n 1 181 LEU n 1 182 VAL n 1 183 THR n 1 184 ALA n 1 185 MET n 1 186 ASP n 1 187 GLN n 1 188 ASP n 1 189 GLU n 1 190 GLU n 1 191 GLU n 1 192 GLN n 1 193 THR n 1 194 VAL n 1 195 LEU n 1 196 THR n 1 197 PRO n 1 198 MET n 1 199 PRO n 1 200 ALA n 1 201 TYR n 1 202 ALA n 1 203 ARG n 1 204 HIS n 1 205 THR n 1 206 GLY n 1 207 GLN n 1 208 VAL n 1 209 GLY n 1 210 THR n 1 211 LYS n 1 212 LEU n 1 213 TYR n 1 214 MET n 1 215 SER n 1 216 PRO n 1 217 GLU n 1 218 GLN n 1 219 ILE n 1 220 HIS n 1 221 GLY n 1 222 ASN n 1 223 SER n 1 224 TYR n 1 225 SER n 1 226 HIS n 1 227 LYS n 1 228 VAL n 1 229 ASP n 1 230 ILE n 1 231 PHE n 1 232 SER n 1 233 LEU n 1 234 GLY n 1 235 LEU n 1 236 ILE n 1 237 LEU n 1 238 PHE n 1 239 GLU n 1 240 LEU n 1 241 LEU n 1 242 TYR n 1 243 PRO n 1 244 PHE n 1 245 SER n 1 246 THR n 1 247 GLN n 1 248 MET n 1 249 GLU n 1 250 ARG n 1 251 VAL n 1 252 ARG n 1 253 THR n 1 254 LEU n 1 255 THR n 1 256 ASP n 1 257 VAL n 1 258 ARG n 1 259 ASN n 1 260 LEU n 1 261 LYS n 1 262 PHE n 1 263 PRO n 1 264 PRO n 1 265 LEU n 1 266 PHE n 1 267 THR n 1 268 GLN n 1 269 LYS n 1 270 TYR n 1 271 PRO n 1 272 CYS n 1 273 GLU n 1 274 TYR n 1 275 VAL n 1 276 MET n 1 277 VAL n 1 278 GLN n 1 279 ASP n 1 280 MET n 1 281 LEU n 1 282 SER n 1 283 PRO n 1 284 SER n 1 285 PRO n 1 286 MET n 1 287 GLU n 1 288 ARG n 1 289 PRO n 1 290 GLU n 1 291 ALA n 1 292 ILE n 1 293 ASN n 1 294 ILE n 1 295 ILE n 1 296 GLU n 1 297 ASN n 1 298 ALA n 1 299 VAL n 1 300 PHE n 1 301 GLU n 1 302 ASP n 1 303 LEU n 1 304 ASP n 1 305 PHE n 1 306 PRO n 1 307 GLY n 1 308 LYS n 1 309 THR n 1 310 VAL n 1 311 LEU n 1 312 ARG n 1 313 GLN n 1 314 ARG n 1 315 SER n 1 316 ARG n 1 317 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 95 human ? 'EIF2AK3, PEK, PERK' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 96 317 human ? 'EIF2AK3, PEK, PERK' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP E2AK3_HUMAN Q9NZJ5 ? 1 ;SSWNDIKNSGYISRYLTDFEPIQCLGRGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRY FNAWLEAPPEKWQ ; 575 2 UNP E2AK3_HUMAN Q9NZJ5 ? 1 ;EKLQPSSPKVYLYIQMQLCRKENLKDWMNGRCTIEERERSVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVK VGDFGLVTAMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYPFSTQMERVRTLT DVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEAINIIENAVFEDLDFPGKTVLRQRSRS ; 873 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8EQE AAA 3 ? 95 ? Q9NZJ5 575 ? 667 ? 575 872 2 2 8EQE AAA 96 ? 317 ? Q9NZJ5 873 ? 1094 ? 873 1094 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8EQE GLY AAA 1 ? UNP Q9NZJ5 ? ? 'expression tag' 573 1 1 8EQE SER AAA 2 ? UNP Q9NZJ5 ? ? 'expression tag' 574 2 2 8EQE ASN AAA 160 ? UNP Q9NZJ5 ASP 937 'engineered mutation' 937 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 WQ2 non-polymer . ;(2R)-N-[(4M)-4-(4-amino-2,7-dimethyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-3-methylphenyl]-2-hydroxy-2-[3-(trifluoromethyl)phenyl]acetamide ; ? 'C24 H22 F3 N5 O2' 469.459 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8EQE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 65.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '4% tacsimate pH 7.0 and 12% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-12-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0332 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0332 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8EQE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.559 _reflns.d_resolution_low 54.275 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17214 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.7 _reflns.pdbx_Rmerge_I_obs 0.072 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.559 _reflns_shell.d_res_low 2.63 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1254 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.18 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -4.949 _refine.aniso_B[1][2] -2.474 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -4.949 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 16.055 _refine.B_iso_max ? _refine.B_iso_mean 78.053 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.955 _refine.correlation_coeff_Fo_to_Fc_free 0.923 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8EQE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.559 _refine.ls_d_res_low 54.275 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17195 _refine.ls_number_reflns_R_free 883 _refine.ls_number_reflns_R_work 16312 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.866 _refine.ls_percent_reflns_R_free 5.135 _refine.ls_R_factor_all 0.227 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2873 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2242 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4X7J _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.308 _refine.pdbx_overall_ESU_R_Free 0.272 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 19.599 _refine.overall_SU_ML 0.338 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2108 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 2148 _refine_hist.d_res_high 2.559 _refine_hist.d_res_low 54.275 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 0.013 2193 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2071 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.249 1.674 2963 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.055 1.587 4796 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.411 5.000 252 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 29.007 21.570 121 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.925 15.000 397 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.016 15.000 17 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.043 0.200 272 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 2383 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 482 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.193 0.200 431 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.169 0.200 1916 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.165 0.200 1035 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.072 0.200 1067 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.134 0.200 40 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.097 0.200 4 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.162 0.200 35 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.193 0.200 5 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 3.893 8.226 1020 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.891 8.222 1021 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.526 12.300 1269 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.527 12.311 1269 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.132 8.489 1173 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.131 8.487 1174 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 5.520 12.606 1694 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.518 12.604 1695 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 8.772 91.360 2411 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 8.770 91.340 2412 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.559 2.625 1252 . 76 1160 98.7220 . 0.477 . 0.480 . 0.477 . . . . . 0.446 . 20 . 0.024 0.019 'X-RAY DIFFRACTION' 2.625 2.697 1207 . 58 1149 100.0000 . 0.432 . 0.420 . 0.433 . . . . . 0.407 . 20 . 0.087 0.119 'X-RAY DIFFRACTION' 2.697 2.775 1220 . 74 1144 99.8361 . 0.417 . 0.502 . 0.412 . . . . . 0.377 . 20 . 0.201 0.155 'X-RAY DIFFRACTION' 2.775 2.860 1142 . 67 1074 99.9124 . 0.397 . 0.380 . 0.398 . . . . . 0.357 . 20 . 0.510 0.467 'X-RAY DIFFRACTION' 2.860 2.954 1134 . 58 1076 100.0000 . 0.342 . 0.378 . 0.340 . . . . . 0.308 . 20 . 0.672 0.614 'X-RAY DIFFRACTION' 2.954 3.057 1085 . 59 1026 100.0000 . 0.339 . 0.466 . 0.331 . . . . . 0.301 . 20 . 0.701 0.662 'X-RAY DIFFRACTION' 3.057 3.172 1043 . 56 987 100.0000 . 0.314 . 0.422 . 0.308 . . . . . 0.281 . 20 . 0.747 0.710 'X-RAY DIFFRACTION' 3.172 3.301 1019 . 47 972 100.0000 . 0.290 . 0.406 . 0.283 . . . . . 0.258 . 20 . 0.793 0.704 'X-RAY DIFFRACTION' 3.301 3.447 968 . 46 922 100.0000 . 0.253 . 0.323 . 0.251 . . . . . 0.233 . 20 . 0.870 0.778 'X-RAY DIFFRACTION' 3.447 3.615 944 . 60 884 100.0000 . 0.261 . 0.287 . 0.258 . . . . . 0.248 . 20 . 0.890 0.895 'X-RAY DIFFRACTION' 3.615 3.809 868 . 35 833 100.0000 . 0.216 . 0.220 . 0.216 . . . . . 0.210 . 20 . 0.920 0.921 'X-RAY DIFFRACTION' 3.809 4.039 851 . 56 793 99.7650 . 0.215 . 0.277 . 0.211 . . . . . 0.206 . 20 . 0.935 0.927 'X-RAY DIFFRACTION' 4.039 4.317 794 . 41 753 100.0000 . 0.180 . 0.201 . 0.178 . . . . . 0.179 . 20 . 0.946 0.938 'X-RAY DIFFRACTION' 4.317 4.660 731 . 32 699 100.0000 . 0.164 . 0.204 . 0.162 . . . . . 0.170 . 20 . 0.963 0.952 'X-RAY DIFFRACTION' 4.660 5.101 685 . 23 662 100.0000 . 0.153 . 0.178 . 0.152 . . . . . 0.160 . 20 . 0.966 0.961 'X-RAY DIFFRACTION' 5.101 5.697 631 . 17 614 100.0000 . 0.177 . 0.231 . 0.175 . . . . . 0.181 . 20 . 0.955 0.951 'X-RAY DIFFRACTION' 5.697 6.566 553 . 30 523 100.0000 . 0.196 . 0.299 . 0.191 . . . . . 0.202 . 20 . 0.944 0.913 'X-RAY DIFFRACTION' 6.566 8.012 475 . 19 456 100.0000 . 0.163 . 0.359 . 0.157 . . . . . 0.171 . 20 . 0.962 0.899 'X-RAY DIFFRACTION' 8.012 11.210 383 . 23 360 100.0000 . 0.138 . 0.139 . 0.137 . . . . . 0.160 . 20 . 0.974 0.976 'X-RAY DIFFRACTION' 11.210 54.275 231 . 6 225 100.0000 . 0.226 . 0.343 . 0.223 . . . . . 0.246 . 20 . 0.945 0.818 # _struct.entry_id 8EQE _struct.title 'Co-crystal structure of PERK with compound 26' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8EQE _struct_keywords.text 'kinase, PERK, inhibitor, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 15 ? ASP A 20 ? SER AAA 587 ASP AAA 592 1 ? 6 HELX_P HELX_P2 AA2 ARG A 57 ? LYS A 73 ? ARG AAA 629 LYS AAA 645 1 ? 17 HELX_P HELX_P3 AA3 ASN A 118 ? GLY A 125 ? ASN AAA 895 GLY AAA 902 1 ? 8 HELX_P HELX_P4 AA4 GLU A 133 ? LYS A 154 ? GLU AAA 910 LYS AAA 931 1 ? 22 HELX_P HELX_P5 AA5 LYS A 162 ? SER A 164 ? LYS AAA 939 SER AAA 941 5 ? 3 HELX_P HELX_P6 AA6 SER A 215 ? HIS A 220 ? SER AAA 992 HIS AAA 997 1 ? 6 HELX_P HELX_P7 AA7 LYS A 227 ? TYR A 242 ? LYS AAA 1004 TYR AAA 1019 1 ? 16 HELX_P HELX_P8 AA8 THR A 246 ? ASN A 259 ? THR AAA 1023 ASN AAA 1036 1 ? 14 HELX_P HELX_P9 AA9 PRO A 263 ? TYR A 270 ? PRO AAA 1040 TYR AAA 1047 1 ? 8 HELX_P HELX_P10 AB1 TYR A 270 ? LEU A 281 ? TYR AAA 1047 LEU AAA 1058 1 ? 12 HELX_P HELX_P11 AB2 SER A 284 ? ARG A 288 ? SER AAA 1061 ARG AAA 1065 5 ? 5 HELX_P HELX_P12 AB3 GLU A 290 ? ASN A 297 ? GLU AAA 1067 ASN AAA 1074 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 21 ? GLY A 28 ? PHE AAA 593 GLY AAA 600 AA1 2 VAL A 34 ? ASN A 40 ? VAL AAA 606 ASN AAA 612 AA1 3 ASN A 46 ? ARG A 53 ? ASN AAA 618 ARG AAA 625 AA1 4 TYR A 106 ? GLN A 112 ? TYR AAA 883 GLN AAA 889 AA1 5 TYR A 82 ? GLU A 88 ? TYR AAA 654 GLU AAA 660 AA2 1 ILE A 166 ? PHE A 168 ? ILE AAA 943 PHE AAA 945 AA2 2 VAL A 174 ? VAL A 176 ? VAL AAA 951 VAL AAA 953 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 27 ? N LEU AAA 599 O VAL A 35 ? O VAL AAA 607 AA1 2 3 N PHE A 36 ? N PHE AAA 608 O ILE A 49 ? O ILE AAA 621 AA1 3 4 N ILE A 52 ? N ILE AAA 624 O LEU A 107 ? O LEU AAA 884 AA1 4 5 O GLN A 110 ? O GLN AAA 887 N ASN A 84 ? N ASN AAA 656 AA2 1 2 N PHE A 167 ? N PHE AAA 944 O LYS A 175 ? O LYS AAA 952 # _atom_sites.entry_id 8EQE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.007978 _atom_sites.fract_transf_matrix[1][2] 0.004606 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009212 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017216 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 F 9 9 3.539 10.282 2.641 4.294 1.517 0.262 1.024 26.148 0.308 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.065 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 573 ? ? ? AAA . n A 1 2 SER 2 574 ? ? ? AAA . n A 1 3 SER 3 575 ? ? ? AAA . n A 1 4 SER 4 576 ? ? ? AAA . n A 1 5 TRP 5 577 ? ? ? AAA . n A 1 6 ASN 6 578 ? ? ? AAA . n A 1 7 ASP 7 579 ? ? ? AAA . n A 1 8 ILE 8 580 ? ? ? AAA . n A 1 9 LYS 9 581 ? ? ? AAA . n A 1 10 ASN 10 582 ? ? ? AAA . n A 1 11 SER 11 583 ? ? ? AAA . n A 1 12 GLY 12 584 ? ? ? AAA . n A 1 13 TYR 13 585 585 TYR TYR AAA . n A 1 14 ILE 14 586 586 ILE ILE AAA . n A 1 15 SER 15 587 587 SER SER AAA . n A 1 16 ARG 16 588 588 ARG ARG AAA . n A 1 17 TYR 17 589 589 TYR TYR AAA . n A 1 18 LEU 18 590 590 LEU LEU AAA . n A 1 19 THR 19 591 591 THR THR AAA . n A 1 20 ASP 20 592 592 ASP ASP AAA . n A 1 21 PHE 21 593 593 PHE PHE AAA . n A 1 22 GLU 22 594 594 GLU GLU AAA . n A 1 23 PRO 23 595 595 PRO PRO AAA . n A 1 24 ILE 24 596 596 ILE ILE AAA . n A 1 25 GLN 25 597 597 GLN GLN AAA . n A 1 26 CYS 26 598 598 CYS CYS AAA . n A 1 27 LEU 27 599 599 LEU LEU AAA . n A 1 28 GLY 28 600 600 GLY GLY AAA . n A 1 29 ARG 29 601 601 ARG ARG AAA . n A 1 30 GLY 30 602 602 GLY GLY AAA . n A 1 31 GLY 31 603 603 GLY GLY AAA . n A 1 32 PHE 32 604 ? ? ? AAA . n A 1 33 GLY 33 605 605 GLY GLY AAA . n A 1 34 VAL 34 606 606 VAL VAL AAA . n A 1 35 VAL 35 607 607 VAL VAL AAA . n A 1 36 PHE 36 608 608 PHE PHE AAA . n A 1 37 GLU 37 609 609 GLU GLU AAA . n A 1 38 ALA 38 610 610 ALA ALA AAA . n A 1 39 LYS 39 611 611 LYS LYS AAA . n A 1 40 ASN 40 612 612 ASN ASN AAA . n A 1 41 LYS 41 613 613 LYS LYS AAA . n A 1 42 VAL 42 614 614 VAL VAL AAA . n A 1 43 ASP 43 615 615 ASP ASP AAA . n A 1 44 ASP 44 616 616 ASP ASP AAA . n A 1 45 CYS 45 617 617 CYS CYS AAA . n A 1 46 ASN 46 618 618 ASN ASN AAA . n A 1 47 TYR 47 619 619 TYR TYR AAA . n A 1 48 ALA 48 620 620 ALA ALA AAA . n A 1 49 ILE 49 621 621 ILE ILE AAA . n A 1 50 LYS 50 622 622 LYS LYS AAA . n A 1 51 ARG 51 623 623 ARG ARG AAA . n A 1 52 ILE 52 624 624 ILE ILE AAA . n A 1 53 ARG 53 625 625 ARG ARG AAA . n A 1 54 LEU 54 626 626 LEU LEU AAA . n A 1 55 PRO 55 627 627 PRO PRO AAA . n A 1 56 ASN 56 628 628 ASN ASN AAA . n A 1 57 ARG 57 629 629 ARG ARG AAA . n A 1 58 GLU 58 630 630 GLU GLU AAA . n A 1 59 LEU 59 631 631 LEU LEU AAA . n A 1 60 ALA 60 632 632 ALA ALA AAA . n A 1 61 ARG 61 633 633 ARG ARG AAA . n A 1 62 GLU 62 634 634 GLU GLU AAA . n A 1 63 LYS 63 635 635 LYS LYS AAA . n A 1 64 VAL 64 636 636 VAL VAL AAA . n A 1 65 MET 65 637 637 MET MET AAA . n A 1 66 ARG 66 638 638 ARG ARG AAA . n A 1 67 GLU 67 639 639 GLU GLU AAA . n A 1 68 VAL 68 640 640 VAL VAL AAA . n A 1 69 LYS 69 641 641 LYS LYS AAA . n A 1 70 ALA 70 642 642 ALA ALA AAA . n A 1 71 LEU 71 643 643 LEU LEU AAA . n A 1 72 ALA 72 644 644 ALA ALA AAA . n A 1 73 LYS 73 645 645 LYS LYS AAA . n A 1 74 LEU 74 646 646 LEU LEU AAA . n A 1 75 GLU 75 647 647 GLU GLU AAA . n A 1 76 HIS 76 648 648 HIS HIS AAA . n A 1 77 PRO 77 649 649 PRO PRO AAA . n A 1 78 GLY 78 650 650 GLY GLY AAA . n A 1 79 ILE 79 651 651 ILE ILE AAA . n A 1 80 VAL 80 652 652 VAL VAL AAA . n A 1 81 ARG 81 653 653 ARG ARG AAA . n A 1 82 TYR 82 654 654 TYR TYR AAA . n A 1 83 PHE 83 655 655 PHE PHE AAA . n A 1 84 ASN 84 656 656 ASN ASN AAA . n A 1 85 ALA 85 657 657 ALA ALA AAA . n A 1 86 TRP 86 658 658 TRP TRP AAA . n A 1 87 LEU 87 659 659 LEU LEU AAA . n A 1 88 GLU 88 660 660 GLU GLU AAA . n A 1 89 ALA 89 661 661 ALA ALA AAA . n A 1 90 PRO 90 662 662 PRO PRO AAA . n A 1 91 PRO 91 663 663 PRO PRO AAA . n A 1 92 GLU 92 664 664 GLU GLU AAA . n A 1 93 LYS 93 665 665 LYS LYS AAA . n A 1 94 TRP 94 666 666 TRP TRP AAA . n A 1 95 GLN 95 872 ? ? ? AAA . n A 1 96 GLU 96 873 ? ? ? AAA . n A 1 97 LYS 97 874 ? ? ? AAA . n A 1 98 LEU 98 875 ? ? ? AAA . n A 1 99 GLN 99 876 ? ? ? AAA . n A 1 100 PRO 100 877 ? ? ? AAA . n A 1 101 SER 101 878 ? ? ? AAA . n A 1 102 SER 102 879 ? ? ? AAA . n A 1 103 PRO 103 880 880 PRO PRO AAA . n A 1 104 LYS 104 881 881 LYS LYS AAA . n A 1 105 VAL 105 882 882 VAL VAL AAA . n A 1 106 TYR 106 883 883 TYR TYR AAA . n A 1 107 LEU 107 884 884 LEU LEU AAA . n A 1 108 TYR 108 885 885 TYR TYR AAA . n A 1 109 ILE 109 886 886 ILE ILE AAA . n A 1 110 GLN 110 887 887 GLN GLN AAA . n A 1 111 MET 111 888 888 MET MET AAA . n A 1 112 GLN 112 889 889 GLN GLN AAA . n A 1 113 LEU 113 890 890 LEU LEU AAA . n A 1 114 CYS 114 891 891 CYS CYS AAA . n A 1 115 ARG 115 892 892 ARG ARG AAA . n A 1 116 LYS 116 893 893 LYS LYS AAA . n A 1 117 GLU 117 894 894 GLU GLU AAA . n A 1 118 ASN 118 895 895 ASN ASN AAA . n A 1 119 LEU 119 896 896 LEU LEU AAA . n A 1 120 LYS 120 897 897 LYS LYS AAA . n A 1 121 ASP 121 898 898 ASP ASP AAA . n A 1 122 TRP 122 899 899 TRP TRP AAA . n A 1 123 MET 123 900 900 MET MET AAA . n A 1 124 ASN 124 901 901 ASN ASN AAA . n A 1 125 GLY 125 902 902 GLY GLY AAA . n A 1 126 ARG 126 903 903 ARG ARG AAA . n A 1 127 CYS 127 904 904 CYS CYS AAA . n A 1 128 THR 128 905 905 THR THR AAA . n A 1 129 ILE 129 906 906 ILE ILE AAA . n A 1 130 GLU 130 907 907 GLU GLU AAA . n A 1 131 GLU 131 908 908 GLU GLU AAA . n A 1 132 ARG 132 909 909 ARG ARG AAA . n A 1 133 GLU 133 910 910 GLU GLU AAA . n A 1 134 ARG 134 911 911 ARG ARG AAA . n A 1 135 SER 135 912 912 SER SER AAA . n A 1 136 VAL 136 913 913 VAL VAL AAA . n A 1 137 CYS 137 914 914 CYS CYS AAA . n A 1 138 LEU 138 915 915 LEU LEU AAA . n A 1 139 HIS 139 916 916 HIS HIS AAA . n A 1 140 ILE 140 917 917 ILE ILE AAA . n A 1 141 PHE 141 918 918 PHE PHE AAA . n A 1 142 LEU 142 919 919 LEU LEU AAA . n A 1 143 GLN 143 920 920 GLN GLN AAA . n A 1 144 ILE 144 921 921 ILE ILE AAA . n A 1 145 ALA 145 922 922 ALA ALA AAA . n A 1 146 GLU 146 923 923 GLU GLU AAA . n A 1 147 ALA 147 924 924 ALA ALA AAA . n A 1 148 VAL 148 925 925 VAL VAL AAA . n A 1 149 GLU 149 926 926 GLU GLU AAA . n A 1 150 PHE 150 927 927 PHE PHE AAA . n A 1 151 LEU 151 928 928 LEU LEU AAA . n A 1 152 HIS 152 929 929 HIS HIS AAA . n A 1 153 SER 153 930 930 SER SER AAA . n A 1 154 LYS 154 931 931 LYS LYS AAA . n A 1 155 GLY 155 932 932 GLY GLY AAA . n A 1 156 LEU 156 933 933 LEU LEU AAA . n A 1 157 MET 157 934 934 MET MET AAA . n A 1 158 HIS 158 935 935 HIS HIS AAA . n A 1 159 ARG 159 936 936 ARG ARG AAA . n A 1 160 ASN 160 937 937 ASN ASN AAA . n A 1 161 LEU 161 938 938 LEU LEU AAA . n A 1 162 LYS 162 939 939 LYS LYS AAA . n A 1 163 PRO 163 940 940 PRO PRO AAA . n A 1 164 SER 164 941 941 SER SER AAA . n A 1 165 ASN 165 942 942 ASN ASN AAA . n A 1 166 ILE 166 943 943 ILE ILE AAA . n A 1 167 PHE 167 944 944 PHE PHE AAA . n A 1 168 PHE 168 945 945 PHE PHE AAA . n A 1 169 THR 169 946 946 THR THR AAA . n A 1 170 MET 170 947 947 MET MET AAA . n A 1 171 ASP 171 948 948 ASP ASP AAA . n A 1 172 ASP 172 949 949 ASP ASP AAA . n A 1 173 VAL 173 950 950 VAL VAL AAA . n A 1 174 VAL 174 951 951 VAL VAL AAA . n A 1 175 LYS 175 952 952 LYS LYS AAA . n A 1 176 VAL 176 953 953 VAL VAL AAA . n A 1 177 GLY 177 954 954 GLY GLY AAA . n A 1 178 ASP 178 955 955 ASP ASP AAA . n A 1 179 PHE 179 956 956 PHE PHE AAA . n A 1 180 GLY 180 957 957 GLY GLY AAA . n A 1 181 LEU 181 958 958 LEU LEU AAA . n A 1 182 VAL 182 959 959 VAL VAL AAA . n A 1 183 THR 183 960 960 THR THR AAA . n A 1 184 ALA 184 961 ? ? ? AAA . n A 1 185 MET 185 962 ? ? ? AAA . n A 1 186 ASP 186 963 ? ? ? AAA . n A 1 187 GLN 187 964 ? ? ? AAA . n A 1 188 ASP 188 965 ? ? ? AAA . n A 1 189 GLU 189 966 ? ? ? AAA . n A 1 190 GLU 190 967 ? ? ? AAA . n A 1 191 GLU 191 968 ? ? ? AAA . n A 1 192 GLN 192 969 ? ? ? AAA . n A 1 193 THR 193 970 ? ? ? AAA . n A 1 194 VAL 194 971 ? ? ? AAA . n A 1 195 LEU 195 972 ? ? ? AAA . n A 1 196 THR 196 973 ? ? ? AAA . n A 1 197 PRO 197 974 ? ? ? AAA . n A 1 198 MET 198 975 ? ? ? AAA . n A 1 199 PRO 199 976 ? ? ? AAA . n A 1 200 ALA 200 977 ? ? ? AAA . n A 1 201 TYR 201 978 ? ? ? AAA . n A 1 202 ALA 202 979 ? ? ? AAA . n A 1 203 ARG 203 980 ? ? ? AAA . n A 1 204 HIS 204 981 ? ? ? AAA . n A 1 205 THR 205 982 ? ? ? AAA . n A 1 206 GLY 206 983 ? ? ? AAA . n A 1 207 GLN 207 984 ? ? ? AAA . n A 1 208 VAL 208 985 ? ? ? AAA . n A 1 209 GLY 209 986 ? ? ? AAA . n A 1 210 THR 210 987 987 THR THR AAA . n A 1 211 LYS 211 988 988 LYS LYS AAA . n A 1 212 LEU 212 989 989 LEU LEU AAA . n A 1 213 TYR 213 990 990 TYR TYR AAA . n A 1 214 MET 214 991 991 MET MET AAA . n A 1 215 SER 215 992 992 SER SER AAA . n A 1 216 PRO 216 993 993 PRO PRO AAA . n A 1 217 GLU 217 994 994 GLU GLU AAA . n A 1 218 GLN 218 995 995 GLN GLN AAA . n A 1 219 ILE 219 996 996 ILE ILE AAA . n A 1 220 HIS 220 997 997 HIS HIS AAA . n A 1 221 GLY 221 998 998 GLY GLY AAA . n A 1 222 ASN 222 999 999 ASN ASN AAA . n A 1 223 SER 223 1000 1000 SER SER AAA . n A 1 224 TYR 224 1001 1001 TYR TYR AAA . n A 1 225 SER 225 1002 1002 SER SER AAA . n A 1 226 HIS 226 1003 1003 HIS HIS AAA . n A 1 227 LYS 227 1004 1004 LYS LYS AAA . n A 1 228 VAL 228 1005 1005 VAL VAL AAA . n A 1 229 ASP 229 1006 1006 ASP ASP AAA . n A 1 230 ILE 230 1007 1007 ILE ILE AAA . n A 1 231 PHE 231 1008 1008 PHE PHE AAA . n A 1 232 SER 232 1009 1009 SER SER AAA . n A 1 233 LEU 233 1010 1010 LEU LEU AAA . n A 1 234 GLY 234 1011 1011 GLY GLY AAA . n A 1 235 LEU 235 1012 1012 LEU LEU AAA . n A 1 236 ILE 236 1013 1013 ILE ILE AAA . n A 1 237 LEU 237 1014 1014 LEU LEU AAA . n A 1 238 PHE 238 1015 1015 PHE PHE AAA . n A 1 239 GLU 239 1016 1016 GLU GLU AAA . n A 1 240 LEU 240 1017 1017 LEU LEU AAA . n A 1 241 LEU 241 1018 1018 LEU LEU AAA . n A 1 242 TYR 242 1019 1019 TYR TYR AAA . n A 1 243 PRO 243 1020 1020 PRO PRO AAA . n A 1 244 PHE 244 1021 1021 PHE PHE AAA . n A 1 245 SER 245 1022 1022 SER SER AAA . n A 1 246 THR 246 1023 1023 THR THR AAA . n A 1 247 GLN 247 1024 1024 GLN GLN AAA . n A 1 248 MET 248 1025 1025 MET MET AAA . n A 1 249 GLU 249 1026 1026 GLU GLU AAA . n A 1 250 ARG 250 1027 1027 ARG ARG AAA . n A 1 251 VAL 251 1028 1028 VAL VAL AAA . n A 1 252 ARG 252 1029 1029 ARG ARG AAA . n A 1 253 THR 253 1030 1030 THR THR AAA . n A 1 254 LEU 254 1031 1031 LEU LEU AAA . n A 1 255 THR 255 1032 1032 THR THR AAA . n A 1 256 ASP 256 1033 1033 ASP ASP AAA . n A 1 257 VAL 257 1034 1034 VAL VAL AAA . n A 1 258 ARG 258 1035 1035 ARG ARG AAA . n A 1 259 ASN 259 1036 1036 ASN ASN AAA . n A 1 260 LEU 260 1037 1037 LEU LEU AAA . n A 1 261 LYS 261 1038 1038 LYS LYS AAA . n A 1 262 PHE 262 1039 1039 PHE PHE AAA . n A 1 263 PRO 263 1040 1040 PRO PRO AAA . n A 1 264 PRO 264 1041 1041 PRO PRO AAA . n A 1 265 LEU 265 1042 1042 LEU LEU AAA . n A 1 266 PHE 266 1043 1043 PHE PHE AAA . n A 1 267 THR 267 1044 1044 THR THR AAA . n A 1 268 GLN 268 1045 1045 GLN GLN AAA . n A 1 269 LYS 269 1046 1046 LYS LYS AAA . n A 1 270 TYR 270 1047 1047 TYR TYR AAA . n A 1 271 PRO 271 1048 1048 PRO PRO AAA . n A 1 272 CYS 272 1049 1049 CYS CYS AAA . n A 1 273 GLU 273 1050 1050 GLU GLU AAA . n A 1 274 TYR 274 1051 1051 TYR TYR AAA . n A 1 275 VAL 275 1052 1052 VAL VAL AAA . n A 1 276 MET 276 1053 1053 MET MET AAA . n A 1 277 VAL 277 1054 1054 VAL VAL AAA . n A 1 278 GLN 278 1055 1055 GLN GLN AAA . n A 1 279 ASP 279 1056 1056 ASP ASP AAA . n A 1 280 MET 280 1057 1057 MET MET AAA . n A 1 281 LEU 281 1058 1058 LEU LEU AAA . n A 1 282 SER 282 1059 1059 SER SER AAA . n A 1 283 PRO 283 1060 1060 PRO PRO AAA . n A 1 284 SER 284 1061 1061 SER SER AAA . n A 1 285 PRO 285 1062 1062 PRO PRO AAA . n A 1 286 MET 286 1063 1063 MET MET AAA . n A 1 287 GLU 287 1064 1064 GLU GLU AAA . n A 1 288 ARG 288 1065 1065 ARG ARG AAA . n A 1 289 PRO 289 1066 1066 PRO PRO AAA . n A 1 290 GLU 290 1067 1067 GLU GLU AAA . n A 1 291 ALA 291 1068 1068 ALA ALA AAA . n A 1 292 ILE 292 1069 1069 ILE ILE AAA . n A 1 293 ASN 293 1070 1070 ASN ASN AAA . n A 1 294 ILE 294 1071 1071 ILE ILE AAA . n A 1 295 ILE 295 1072 1072 ILE ILE AAA . n A 1 296 GLU 296 1073 1073 GLU GLU AAA . n A 1 297 ASN 297 1074 1074 ASN ASN AAA . n A 1 298 ALA 298 1075 1075 ALA ALA AAA . n A 1 299 VAL 299 1076 1076 VAL VAL AAA . n A 1 300 PHE 300 1077 1077 PHE PHE AAA . n A 1 301 GLU 301 1078 1078 GLU GLU AAA . n A 1 302 ASP 302 1079 1079 ASP ASP AAA . n A 1 303 LEU 303 1080 1080 LEU LEU AAA . n A 1 304 ASP 304 1081 ? ? ? AAA . n A 1 305 PHE 305 1082 ? ? ? AAA . n A 1 306 PRO 306 1083 ? ? ? AAA . n A 1 307 GLY 307 1084 ? ? ? AAA . n A 1 308 LYS 308 1085 ? ? ? AAA . n A 1 309 THR 309 1086 ? ? ? AAA . n A 1 310 VAL 310 1087 ? ? ? AAA . n A 1 311 LEU 311 1088 ? ? ? AAA . n A 1 312 ARG 312 1089 ? ? ? AAA . n A 1 313 GLN 313 1090 ? ? ? AAA . n A 1 314 ARG 314 1091 ? ? ? AAA . n A 1 315 SER 315 1092 ? ? ? AAA . n A 1 316 ARG 316 1093 ? ? ? AAA . n A 1 317 SER 317 1094 ? ? ? AAA . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email guangyu.zhu@curiaglobal.com _pdbx_contact_author.name_first Guangyu _pdbx_contact_author.name_last Zhu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4228-135X # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 WQ2 1 1101 1 WQ2 S70 AAA . C 3 HOH 1 1201 2 HOH HOH AAA . C 3 HOH 2 1202 1 HOH HOH AAA . C 3 HOH 3 1203 7 HOH HOH AAA . C 3 HOH 4 1204 4 HOH HOH AAA . C 3 HOH 5 1205 3 HOH HOH AAA . C 3 HOH 6 1206 6 HOH HOH AAA . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-30 2 'Structure model' 1 1 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' citation 4 2 'Structure model' pdbx_initial_refinement_model # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_citation.country' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 8EQE _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN AAA 597 ? ? -171.66 -177.83 2 1 PHE AAA 655 ? ? -126.12 -60.40 3 1 GLU AAA 910 ? ? -55.10 109.79 4 1 ASN AAA 937 ? ? -153.80 29.11 5 1 ASP AAA 949 ? ? 72.36 33.34 6 1 SER AAA 1059 ? ? -38.58 125.96 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA GLY 573 ? A GLY 1 2 1 Y 1 AAA SER 574 ? A SER 2 3 1 Y 1 AAA SER 575 ? A SER 3 4 1 Y 1 AAA SER 576 ? A SER 4 5 1 Y 1 AAA TRP 577 ? A TRP 5 6 1 Y 1 AAA ASN 578 ? A ASN 6 7 1 Y 1 AAA ASP 579 ? A ASP 7 8 1 Y 1 AAA ILE 580 ? A ILE 8 9 1 Y 1 AAA LYS 581 ? A LYS 9 10 1 Y 1 AAA ASN 582 ? A ASN 10 11 1 Y 1 AAA SER 583 ? A SER 11 12 1 Y 1 AAA GLY 584 ? A GLY 12 13 1 Y 1 AAA PHE 604 ? A PHE 32 14 1 Y 1 AAA GLN 872 ? A GLN 95 15 1 Y 1 AAA GLU 873 ? A GLU 96 16 1 Y 1 AAA LYS 874 ? A LYS 97 17 1 Y 1 AAA LEU 875 ? A LEU 98 18 1 Y 1 AAA GLN 876 ? A GLN 99 19 1 Y 1 AAA PRO 877 ? A PRO 100 20 1 Y 1 AAA SER 878 ? A SER 101 21 1 Y 1 AAA SER 879 ? A SER 102 22 1 Y 1 AAA ALA 961 ? A ALA 184 23 1 Y 1 AAA MET 962 ? A MET 185 24 1 Y 1 AAA ASP 963 ? A ASP 186 25 1 Y 1 AAA GLN 964 ? A GLN 187 26 1 Y 1 AAA ASP 965 ? A ASP 188 27 1 Y 1 AAA GLU 966 ? A GLU 189 28 1 Y 1 AAA GLU 967 ? A GLU 190 29 1 Y 1 AAA GLU 968 ? A GLU 191 30 1 Y 1 AAA GLN 969 ? A GLN 192 31 1 Y 1 AAA THR 970 ? A THR 193 32 1 Y 1 AAA VAL 971 ? A VAL 194 33 1 Y 1 AAA LEU 972 ? A LEU 195 34 1 Y 1 AAA THR 973 ? A THR 196 35 1 Y 1 AAA PRO 974 ? A PRO 197 36 1 Y 1 AAA MET 975 ? A MET 198 37 1 Y 1 AAA PRO 976 ? A PRO 199 38 1 Y 1 AAA ALA 977 ? A ALA 200 39 1 Y 1 AAA TYR 978 ? A TYR 201 40 1 Y 1 AAA ALA 979 ? A ALA 202 41 1 Y 1 AAA ARG 980 ? A ARG 203 42 1 Y 1 AAA HIS 981 ? A HIS 204 43 1 Y 1 AAA THR 982 ? A THR 205 44 1 Y 1 AAA GLY 983 ? A GLY 206 45 1 Y 1 AAA GLN 984 ? A GLN 207 46 1 Y 1 AAA VAL 985 ? A VAL 208 47 1 Y 1 AAA GLY 986 ? A GLY 209 48 1 Y 1 AAA ASP 1081 ? A ASP 304 49 1 Y 1 AAA PHE 1082 ? A PHE 305 50 1 Y 1 AAA PRO 1083 ? A PRO 306 51 1 Y 1 AAA GLY 1084 ? A GLY 307 52 1 Y 1 AAA LYS 1085 ? A LYS 308 53 1 Y 1 AAA THR 1086 ? A THR 309 54 1 Y 1 AAA VAL 1087 ? A VAL 310 55 1 Y 1 AAA LEU 1088 ? A LEU 311 56 1 Y 1 AAA ARG 1089 ? A ARG 312 57 1 Y 1 AAA GLN 1090 ? A GLN 313 58 1 Y 1 AAA ARG 1091 ? A ARG 314 59 1 Y 1 AAA SER 1092 ? A SER 315 60 1 Y 1 AAA ARG 1093 ? A ARG 316 61 1 Y 1 AAA SER 1094 ? A SER 317 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 WQ2 C1 C Y N 391 WQ2 C2 C Y N 392 WQ2 C3 C Y N 393 WQ2 C4 C Y N 394 WQ2 F2 F N N 395 WQ2 C23 C N N 396 WQ2 F F N N 397 WQ2 F1 F N N 398 WQ2 C12 C Y N 399 WQ2 C11 C Y N 400 WQ2 C13 C Y N 401 WQ2 C14 C Y N 402 WQ2 C15 C Y N 403 WQ2 C10 C Y N 404 WQ2 C9 C N R 405 WQ2 O1 O N N 406 WQ2 C8 C N N 407 WQ2 O O N N 408 WQ2 N N N N 409 WQ2 C5 C Y N 410 WQ2 C C Y N 411 WQ2 C6 C N N 412 WQ2 C7 C Y N 413 WQ2 C18 C Y N 414 WQ2 N1 N Y N 415 WQ2 C21 C N N 416 WQ2 C17 C Y N 417 WQ2 N3 N Y N 418 WQ2 C20 C Y N 419 WQ2 C22 C N N 420 WQ2 N2 N Y N 421 WQ2 C19 C Y N 422 WQ2 C16 C Y N 423 WQ2 N4 N N N 424 WQ2 H1 H N N 425 WQ2 H2 H N N 426 WQ2 H3 H N N 427 WQ2 H4 H N N 428 WQ2 H5 H N N 429 WQ2 H6 H N N 430 WQ2 H7 H N N 431 WQ2 H8 H N N 432 WQ2 H9 H N N 433 WQ2 H10 H N N 434 WQ2 H11 H N N 435 WQ2 H12 H N N 436 WQ2 H13 H N N 437 WQ2 H14 H N N 438 WQ2 H15 H N N 439 WQ2 H16 H N N 440 WQ2 H17 H N N 441 WQ2 H18 H N N 442 WQ2 H19 H N N 443 WQ2 H20 H N N 444 WQ2 H21 H N N 445 WQ2 H22 H N N 446 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 WQ2 C22 C20 sing N N 376 WQ2 C20 N3 doub Y N 377 WQ2 C20 N2 sing Y N 378 WQ2 N3 C17 sing Y N 379 WQ2 N2 C19 doub Y N 380 WQ2 C21 N1 sing N N 381 WQ2 C17 N1 sing Y N 382 WQ2 C17 C16 doub Y N 383 WQ2 C19 C16 sing Y N 384 WQ2 C19 N4 sing N N 385 WQ2 N1 C18 sing Y N 386 WQ2 C16 C7 sing Y N 387 WQ2 C18 C7 doub Y N 388 WQ2 C7 C1 sing N N 389 WQ2 C1 C doub Y N 390 WQ2 C1 C2 sing Y N 391 WQ2 C6 C2 sing N N 392 WQ2 C C5 sing Y N 393 WQ2 C2 C3 doub Y N 394 WQ2 C5 C4 doub Y N 395 WQ2 C3 C4 sing Y N 396 WQ2 C4 N sing N N 397 WQ2 N C8 sing N N 398 WQ2 O C8 doub N N 399 WQ2 C8 C9 sing N N 400 WQ2 C9 O1 sing N N 401 WQ2 C9 C10 sing N N 402 WQ2 C10 C15 doub Y N 403 WQ2 C10 C11 sing Y N 404 WQ2 C15 C14 sing Y N 405 WQ2 F1 C23 sing N N 406 WQ2 C11 C12 doub Y N 407 WQ2 C14 C13 doub Y N 408 WQ2 C12 C13 sing Y N 409 WQ2 C12 C23 sing N N 410 WQ2 C23 F sing N N 411 WQ2 C23 F2 sing N N 412 WQ2 C3 H1 sing N N 413 WQ2 C11 H2 sing N N 414 WQ2 C13 H3 sing N N 415 WQ2 C14 H4 sing N N 416 WQ2 C15 H5 sing N N 417 WQ2 C9 H6 sing N N 418 WQ2 O1 H7 sing N N 419 WQ2 N H8 sing N N 420 WQ2 C5 H9 sing N N 421 WQ2 C H10 sing N N 422 WQ2 C6 H11 sing N N 423 WQ2 C6 H12 sing N N 424 WQ2 C6 H13 sing N N 425 WQ2 C18 H14 sing N N 426 WQ2 C21 H15 sing N N 427 WQ2 C21 H16 sing N N 428 WQ2 C21 H17 sing N N 429 WQ2 C22 H18 sing N N 430 WQ2 C22 H19 sing N N 431 WQ2 C22 H20 sing N N 432 WQ2 N4 H21 sing N N 433 WQ2 N4 H22 sing N N 434 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id WQ2 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id WQ2 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(2R)-N-[(4M)-4-(4-amino-2,7-dimethyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-3-methylphenyl]-2-hydroxy-2-[3-(trifluoromethyl)phenyl]acetamide ; WQ2 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4X7J _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #