data_8ESU # _entry.id 8ESU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8ESU pdb_00008esu 10.2210/pdb8esu/pdb WWPDB D_1000269327 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8ESU _pdbx_database_status.recvd_initial_deposition_date 2022-10-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bacik, J.P.' 1 0000-0001-9315-5332 'Fasan, R.' 2 0000-0003-4636-9578 'Ando, N.' 3 0000-0001-7062-1644 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 7985 _citation.page_last 7985 _citation.title 'Mechanistic manifold in a hemoprotein-catalyzed cyclopropanation reaction with diazoketone.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-023-43559-7 _citation.pdbx_database_id_PubMed 38042860 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nam, D.' 1 ? primary 'Bacik, J.P.' 2 ? primary 'Khade, R.L.' 3 ? primary 'Aguilera, M.C.' 4 ? primary 'Wei, Y.' 5 0000-0002-8979-5967 primary 'Villada, J.D.' 6 ? primary 'Neidig, M.L.' 7 0000-0002-2300-3867 primary 'Zhang, Y.' 8 0000-0001-7207-6416 primary 'Ando, N.' 9 0000-0001-7062-1644 primary 'Fasan, R.' 10 0000-0003-4636-9578 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8ESU _cell.details ? _cell.formula_units_Z ? _cell.length_a 90.425 _cell.length_a_esd ? _cell.length_b 90.425 _cell.length_b_esd ? _cell.length_c 45.442 _cell.length_c_esd ? _cell.volume 321784.488 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8ESU _symmetry.cell_setting ? _symmetry.Int_Tables_number 168 _symmetry.space_group_name_Hall 'P 6' _symmetry.space_group_name_H-M 'P 6' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Myoglobin 17256.016 1 ? ? ? ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 3 non-polymer syn IMIDAZOLE 69.085 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 5 water nat water 18.015 281 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKGGVTALTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_seq_one_letter_code_can ;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKGGVTALTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 LEU n 1 4 SER n 1 5 GLU n 1 6 GLY n 1 7 GLU n 1 8 TRP n 1 9 GLN n 1 10 LEU n 1 11 VAL n 1 12 LEU n 1 13 HIS n 1 14 VAL n 1 15 TRP n 1 16 ALA n 1 17 LYS n 1 18 VAL n 1 19 GLU n 1 20 ALA n 1 21 ASP n 1 22 VAL n 1 23 ALA n 1 24 GLY n 1 25 HIS n 1 26 GLY n 1 27 GLN n 1 28 ASP n 1 29 ILE n 1 30 LEU n 1 31 ILE n 1 32 ARG n 1 33 LEU n 1 34 PHE n 1 35 LYS n 1 36 SER n 1 37 HIS n 1 38 PRO n 1 39 GLU n 1 40 THR n 1 41 LEU n 1 42 GLU n 1 43 LYS n 1 44 PHE n 1 45 ASP n 1 46 ARG n 1 47 PHE n 1 48 LYS n 1 49 HIS n 1 50 LEU n 1 51 LYS n 1 52 THR n 1 53 GLU n 1 54 ALA n 1 55 GLU n 1 56 MET n 1 57 LYS n 1 58 ALA n 1 59 SER n 1 60 GLU n 1 61 ASP n 1 62 LEU n 1 63 LYS n 1 64 LYS n 1 65 GLY n 1 66 GLY n 1 67 VAL n 1 68 THR n 1 69 ALA n 1 70 LEU n 1 71 THR n 1 72 ALA n 1 73 LEU n 1 74 GLY n 1 75 ALA n 1 76 ILE n 1 77 LEU n 1 78 LYS n 1 79 LYS n 1 80 LYS n 1 81 GLY n 1 82 HIS n 1 83 HIS n 1 84 GLU n 1 85 ALA n 1 86 GLU n 1 87 LEU n 1 88 LYS n 1 89 PRO n 1 90 LEU n 1 91 ALA n 1 92 GLN n 1 93 SER n 1 94 HIS n 1 95 ALA n 1 96 THR n 1 97 LYS n 1 98 HIS n 1 99 LYS n 1 100 ILE n 1 101 PRO n 1 102 ILE n 1 103 LYS n 1 104 TYR n 1 105 LEU n 1 106 GLU n 1 107 PHE n 1 108 ILE n 1 109 SER n 1 110 GLU n 1 111 ALA n 1 112 ILE n 1 113 ILE n 1 114 HIS n 1 115 VAL n 1 116 LEU n 1 117 HIS n 1 118 SER n 1 119 ARG n 1 120 HIS n 1 121 PRO n 1 122 GLY n 1 123 ASN n 1 124 PHE n 1 125 GLY n 1 126 ALA n 1 127 ASP n 1 128 ALA n 1 129 GLN n 1 130 GLY n 1 131 ALA n 1 132 MET n 1 133 ASN n 1 134 LYS n 1 135 ALA n 1 136 LEU n 1 137 GLU n 1 138 LEU n 1 139 PHE n 1 140 ARG n 1 141 LYS n 1 142 ASP n 1 143 ILE n 1 144 ALA n 1 145 ALA n 1 146 LYS n 1 147 TYR n 1 148 LYS n 1 149 GLU n 1 150 LEU n 1 151 GLY n 1 152 TYR n 1 153 GLN n 1 154 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 154 _entity_src_gen.gene_src_common_name 'sperm whale' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Physeter catodon' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9755 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYG_PHYMC _struct_ref.pdbx_db_accession P02185 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8ESU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 154 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02185 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 154 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 153 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8ESU GLY A 65 ? UNP P02185 HIS 65 'engineered mutation' 64 1 1 8ESU ALA A 69 ? UNP P02185 VAL 69 'engineered mutation' 68 2 1 8ESU ASN A 123 ? UNP P02185 ASP 123 conflict 122 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IMD non-polymer . IMIDAZOLE ? 'C3 H5 N2 1' 69.085 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8ESU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.11 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.42 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Mb(H64G,V68A) at 3.6 mM in 20 mM Tris-HCl pH 8.4, 1 mM EDTA, was mixed with an equal volume of reservoir solution (200 mM Tris-HCl pH 8.9 and 2.46 M ammonium sulfate). The crystal was dunked in a cryoprotection solution (reservoir buffer supplemented with 9% sucrose (w/v), 2% glucose (w/v), 8% glycerol (v/v), and 8% ethylene glycol (v/v)) prior to being flash-frozen in liquid nitrogen. Note that imidazole was present in lysis buffer at 10 mM prior to two-step purification. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-11-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 8.65 _reflns.entry_id 8ESU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.04 _reflns.d_resolution_low 78.31 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 101447 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.2 _reflns.pdbx_Rmerge_I_obs 0.067 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.022 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 1.04 _reflns_shell.d_res_low 1.06 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4642 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.504 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.234 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.817 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 15.27 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8ESU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.04 _refine.ls_d_res_low 78.31 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 101444 _refine.ls_number_reflns_R_free 5080 _refine.ls_number_reflns_R_work 96364 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.60 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1290 _refine.ls_R_factor_R_free 0.1406 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1284 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6M8F _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 9.5982 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.0944 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.04 _refine_hist.d_res_low 78.31 _refine_hist.number_atoms_solvent 281 _refine_hist.number_atoms_total 1546 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1207 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 58 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0076 ? 1360 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0192 ? 1850 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0781 ? 193 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0064 ? 229 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.4027 ? 504 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.04 1.05 . . 148 2902 90.18 . . . 0.2683 . 0.2620 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.05 1.06 . . 166 3214 99.97 . . . 0.2428 . 0.2276 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.06 1.08 . . 173 3222 99.97 . . . 0.2154 . 0.1890 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.08 1.09 . . 167 3166 100.00 . . . 0.1620 . 0.1636 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.09 1.10 . . 179 3228 99.97 . . . 0.1374 . 0.1377 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.10 1.12 . . 160 3181 100.00 . . . 0.1282 . 0.1166 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.12 1.14 . . 164 3236 99.97 . . . 0.1102 . 0.1096 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.14 1.15 . . 186 3186 99.88 . . . 0.1178 . 0.1038 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.15 1.17 . . 189 3189 100.00 . . . 0.1111 . 0.0993 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.17 1.19 . . 171 3220 100.00 . . . 0.1166 . 0.1029 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.19 1.21 . . 155 3209 100.00 . . . 0.1263 . 0.1102 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.21 1.23 . . 177 3217 99.97 . . . 0.1358 . 0.1181 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.23 1.26 . . 193 3194 99.94 . . . 0.1361 . 0.1200 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.26 1.28 . . 171 3214 99.97 . . . 0.1290 . 0.1320 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.28 1.31 . . 157 3212 99.91 . . . 0.1409 . 0.1277 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.31 1.34 . . 151 3234 100.00 . . . 0.1377 . 0.1068 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.34 1.37 . . 174 3220 100.00 . . . 0.1115 . 0.1034 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.37 1.41 . . 146 3235 99.94 . . . 0.1146 . 0.1002 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.41 1.45 . . 133 3251 100.00 . . . 0.1066 . 0.1012 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.45 1.50 . . 176 3206 100.00 . . . 0.1109 . 0.0956 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.50 1.55 . . 156 3256 99.97 . . . 0.1216 . 0.1023 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.55 1.61 . . 172 3218 99.82 . . . 0.1101 . 0.1060 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.61 1.69 . . 166 3238 100.00 . . . 0.1238 . 0.1140 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.69 1.78 . . 169 3239 100.00 . . . 0.1375 . 0.1273 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.78 1.89 . . 170 3225 100.00 . . . 0.1345 . 0.1286 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.89 2.03 . . 164 3223 99.82 . . . 0.1249 . 0.1312 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.03 2.24 . . 166 3243 99.56 . . . 0.1388 . 0.1297 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.24 2.56 . . 191 3234 100.00 . . . 0.1491 . 0.1360 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.56 3.23 . . 216 3231 100.00 . . . 0.1572 . 0.1413 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.23 78.31 . . 174 3321 99.23 . . . 0.1597 . 0.1430 . . . . . . . . . . . # _struct.entry_id 8ESU _struct.title 'Myoglobin variant Mb-imi complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8ESU _struct_keywords.text 'HEME, METALLOPROTEIN, MYOGLOBIN, OXYGEN STORAGE, IMIDAZOLE' _struct_keywords.pdbx_keywords 'OXYGEN STORAGE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 4 ? GLU A 19 ? SER A 3 GLU A 18 1 ? 16 HELX_P HELX_P2 AA2 ASP A 21 ? HIS A 37 ? ASP A 20 HIS A 36 1 ? 17 HELX_P HELX_P3 AA3 PRO A 38 ? PHE A 44 ? PRO A 37 PHE A 43 5 ? 7 HELX_P HELX_P4 AA4 THR A 52 ? SER A 59 ? THR A 51 SER A 58 1 ? 8 HELX_P HELX_P5 AA5 SER A 59 ? LYS A 79 ? SER A 58 LYS A 78 1 ? 21 HELX_P HELX_P6 AA6 HIS A 83 ? LYS A 97 ? HIS A 82 LYS A 96 1 ? 15 HELX_P HELX_P7 AA7 PRO A 101 ? HIS A 120 ? PRO A 100 HIS A 119 1 ? 20 HELX_P HELX_P8 AA8 GLY A 125 ? GLY A 151 ? GLY A 124 GLY A 150 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 94 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 93 A HEM 201 1_555 ? ? ? ? ? ? ? 2.079 ? ? metalc2 metalc ? ? B HEM . FE ? ? ? 1_555 C IMD . N1 ? ? A HEM 201 A IMD 202 1_555 ? ? ? ? ? ? ? 2.066 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 8ESU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011059 _atom_sites.fract_transf_matrix[1][2] 0.006385 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012770 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022006 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? FE ? ? 13.53868 8.76290 3.62829 ? 5.59997 0.29039 49.61845 ? 0.0 ;3-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 VAL 2 1 1 VAL VAL A . n A 1 3 LEU 3 2 2 LEU LEU A . n A 1 4 SER 4 3 3 SER SER A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 GLY 6 5 5 GLY GLY A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 TRP 8 7 7 TRP TRP A . n A 1 9 GLN 9 8 8 GLN GLN A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 VAL 11 10 10 VAL VAL A . n A 1 12 LEU 12 11 11 LEU LEU A . n A 1 13 HIS 13 12 12 HIS HIS A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 TRP 15 14 14 TRP TRP A . n A 1 16 ALA 16 15 15 ALA ALA A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 VAL 18 17 17 VAL VAL A . n A 1 19 GLU 19 18 18 GLU GLU A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 ASP 21 20 20 ASP ASP A . n A 1 22 VAL 22 21 21 VAL VAL A . n A 1 23 ALA 23 22 22 ALA ALA A . n A 1 24 GLY 24 23 23 GLY GLY A . n A 1 25 HIS 25 24 24 HIS HIS A . n A 1 26 GLY 26 25 25 GLY GLY A . n A 1 27 GLN 27 26 26 GLN GLN A . n A 1 28 ASP 28 27 27 ASP ASP A . n A 1 29 ILE 29 28 28 ILE ILE A . n A 1 30 LEU 30 29 29 LEU LEU A . n A 1 31 ILE 31 30 30 ILE ILE A . n A 1 32 ARG 32 31 31 ARG ARG A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 PHE 34 33 33 PHE PHE A . n A 1 35 LYS 35 34 34 LYS LYS A . n A 1 36 SER 36 35 35 SER SER A . n A 1 37 HIS 37 36 36 HIS HIS A . n A 1 38 PRO 38 37 37 PRO PRO A . n A 1 39 GLU 39 38 38 GLU GLU A . n A 1 40 THR 40 39 39 THR THR A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 GLU 42 41 41 GLU GLU A . n A 1 43 LYS 43 42 42 LYS LYS A . n A 1 44 PHE 44 43 43 PHE PHE A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ARG 46 45 45 ARG ARG A . n A 1 47 PHE 47 46 46 PHE PHE A . n A 1 48 LYS 48 47 47 LYS LYS A . n A 1 49 HIS 49 48 48 HIS HIS A . n A 1 50 LEU 50 49 49 LEU LEU A . n A 1 51 LYS 51 50 50 LYS LYS A . n A 1 52 THR 52 51 51 THR THR A . n A 1 53 GLU 53 52 52 GLU GLU A . n A 1 54 ALA 54 53 53 ALA ALA A . n A 1 55 GLU 55 54 54 GLU GLU A . n A 1 56 MET 56 55 55 MET MET A . n A 1 57 LYS 57 56 56 LYS LYS A . n A 1 58 ALA 58 57 57 ALA ALA A . n A 1 59 SER 59 58 58 SER SER A . n A 1 60 GLU 60 59 59 GLU GLU A . n A 1 61 ASP 61 60 60 ASP ASP A . n A 1 62 LEU 62 61 61 LEU LEU A . n A 1 63 LYS 63 62 62 LYS LYS A . n A 1 64 LYS 64 63 63 LYS LYS A . n A 1 65 GLY 65 64 64 GLY GLY A . n A 1 66 GLY 66 65 65 GLY GLY A . n A 1 67 VAL 67 66 66 VAL VAL A . n A 1 68 THR 68 67 67 THR THR A . n A 1 69 ALA 69 68 68 ALA ALA A . n A 1 70 LEU 70 69 69 LEU LEU A . n A 1 71 THR 71 70 70 THR THR A . n A 1 72 ALA 72 71 71 ALA ALA A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 GLY 74 73 73 GLY GLY A . n A 1 75 ALA 75 74 74 ALA ALA A . n A 1 76 ILE 76 75 75 ILE ILE A . n A 1 77 LEU 77 76 76 LEU LEU A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 LYS 79 78 78 LYS LYS A . n A 1 80 LYS 80 79 79 LYS LYS A . n A 1 81 GLY 81 80 80 GLY GLY A . n A 1 82 HIS 82 81 81 HIS HIS A . n A 1 83 HIS 83 82 82 HIS HIS A . n A 1 84 GLU 84 83 83 GLU GLU A . n A 1 85 ALA 85 84 84 ALA ALA A . n A 1 86 GLU 86 85 85 GLU GLU A . n A 1 87 LEU 87 86 86 LEU LEU A . n A 1 88 LYS 88 87 87 LYS LYS A . n A 1 89 PRO 89 88 88 PRO PRO A . n A 1 90 LEU 90 89 89 LEU LEU A . n A 1 91 ALA 91 90 90 ALA ALA A . n A 1 92 GLN 92 91 91 GLN GLN A . n A 1 93 SER 93 92 92 SER SER A . n A 1 94 HIS 94 93 93 HIS HIS A . n A 1 95 ALA 95 94 94 ALA ALA A . n A 1 96 THR 96 95 95 THR THR A . n A 1 97 LYS 97 96 96 LYS LYS A . n A 1 98 HIS 98 97 97 HIS HIS A . n A 1 99 LYS 99 98 98 LYS LYS A . n A 1 100 ILE 100 99 99 ILE ILE A . n A 1 101 PRO 101 100 100 PRO PRO A . n A 1 102 ILE 102 101 101 ILE ILE A . n A 1 103 LYS 103 102 102 LYS LYS A . n A 1 104 TYR 104 103 103 TYR TYR A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 GLU 106 105 105 GLU GLU A . n A 1 107 PHE 107 106 106 PHE PHE A . n A 1 108 ILE 108 107 107 ILE ILE A . n A 1 109 SER 109 108 108 SER SER A . n A 1 110 GLU 110 109 109 GLU GLU A . n A 1 111 ALA 111 110 110 ALA ALA A . n A 1 112 ILE 112 111 111 ILE ILE A . n A 1 113 ILE 113 112 112 ILE ILE A . n A 1 114 HIS 114 113 113 HIS HIS A . n A 1 115 VAL 115 114 114 VAL VAL A . n A 1 116 LEU 116 115 115 LEU LEU A . n A 1 117 HIS 117 116 116 HIS HIS A . n A 1 118 SER 118 117 117 SER SER A . n A 1 119 ARG 119 118 118 ARG ARG A . n A 1 120 HIS 120 119 119 HIS HIS A . n A 1 121 PRO 121 120 120 PRO PRO A . n A 1 122 GLY 122 121 121 GLY GLY A . n A 1 123 ASN 123 122 122 ASN ASN A . n A 1 124 PHE 124 123 123 PHE PHE A . n A 1 125 GLY 125 124 124 GLY GLY A . n A 1 126 ALA 126 125 125 ALA ALA A . n A 1 127 ASP 127 126 126 ASP ASP A . n A 1 128 ALA 128 127 127 ALA ALA A . n A 1 129 GLN 129 128 128 GLN GLN A . n A 1 130 GLY 130 129 129 GLY GLY A . n A 1 131 ALA 131 130 130 ALA ALA A . n A 1 132 MET 132 131 131 MET MET A . n A 1 133 ASN 133 132 132 ASN ASN A . n A 1 134 LYS 134 133 133 LYS LYS A . n A 1 135 ALA 135 134 134 ALA ALA A . n A 1 136 LEU 136 135 135 LEU LEU A . n A 1 137 GLU 137 136 136 GLU GLU A . n A 1 138 LEU 138 137 137 LEU LEU A . n A 1 139 PHE 139 138 138 PHE PHE A . n A 1 140 ARG 140 139 139 ARG ARG A . n A 1 141 LYS 141 140 140 LYS LYS A . n A 1 142 ASP 142 141 141 ASP ASP A . n A 1 143 ILE 143 142 142 ILE ILE A . n A 1 144 ALA 144 143 143 ALA ALA A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 LYS 146 145 145 LYS LYS A . n A 1 147 TYR 147 146 146 TYR TYR A . n A 1 148 LYS 148 147 147 LYS LYS A . n A 1 149 GLU 149 148 148 GLU GLU A . n A 1 150 LEU 150 149 149 LEU LEU A . n A 1 151 GLY 151 150 150 GLY GLY A . n A 1 152 TYR 152 151 151 TYR TYR A . n A 1 153 GLN 153 152 152 GLN GLN A . n A 1 154 GLY 154 153 153 GLY GLY A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email nozomi.ando@cornell.edu _pdbx_contact_author.name_first Nozomi _pdbx_contact_author.name_last Ando _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7062-1644 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEM 1 201 202 HEM HEM A . C 3 IMD 1 202 155 IMD IMD A . D 4 SO4 1 203 1 SO4 SO4 A . E 4 SO4 1 204 2 SO4 SO4 A . F 5 HOH 1 301 155 HOH HOH A . F 5 HOH 2 302 293 HOH HOH A . F 5 HOH 3 303 124 HOH HOH A . F 5 HOH 4 304 160 HOH HOH A . F 5 HOH 5 305 40 HOH HOH A . F 5 HOH 6 306 170 HOH HOH A . F 5 HOH 7 307 173 HOH HOH A . F 5 HOH 8 308 32 HOH HOH A . F 5 HOH 9 309 252 HOH HOH A . F 5 HOH 10 310 213 HOH HOH A . F 5 HOH 11 311 278 HOH HOH A . F 5 HOH 12 312 87 HOH HOH A . F 5 HOH 13 313 154 HOH HOH A . F 5 HOH 14 314 276 HOH HOH A . F 5 HOH 15 315 106 HOH HOH A . F 5 HOH 16 316 183 HOH HOH A . F 5 HOH 17 317 89 HOH HOH A . F 5 HOH 18 318 54 HOH HOH A . F 5 HOH 19 319 203 HOH HOH A . F 5 HOH 20 320 81 HOH HOH A . F 5 HOH 21 321 105 HOH HOH A . F 5 HOH 22 322 225 HOH HOH A . F 5 HOH 23 323 171 HOH HOH A . F 5 HOH 24 324 143 HOH HOH A . F 5 HOH 25 325 35 HOH HOH A . F 5 HOH 26 326 104 HOH HOH A . F 5 HOH 27 327 135 HOH HOH A . F 5 HOH 28 328 63 HOH HOH A . F 5 HOH 29 329 57 HOH HOH A . F 5 HOH 30 330 134 HOH HOH A . F 5 HOH 31 331 88 HOH HOH A . F 5 HOH 32 332 130 HOH HOH A . F 5 HOH 33 333 214 HOH HOH A . F 5 HOH 34 334 234 HOH HOH A . F 5 HOH 35 335 97 HOH HOH A . F 5 HOH 36 336 285 HOH HOH A . F 5 HOH 37 337 132 HOH HOH A . F 5 HOH 38 338 69 HOH HOH A . F 5 HOH 39 339 126 HOH HOH A . F 5 HOH 40 340 17 HOH HOH A . F 5 HOH 41 341 176 HOH HOH A . F 5 HOH 42 342 94 HOH HOH A . F 5 HOH 43 343 6 HOH HOH A . F 5 HOH 44 344 139 HOH HOH A . F 5 HOH 45 345 42 HOH HOH A . F 5 HOH 46 346 73 HOH HOH A . F 5 HOH 47 347 233 HOH HOH A . F 5 HOH 48 348 72 HOH HOH A . F 5 HOH 49 349 43 HOH HOH A . F 5 HOH 50 350 68 HOH HOH A . F 5 HOH 51 351 62 HOH HOH A . F 5 HOH 52 352 24 HOH HOH A . F 5 HOH 53 353 91 HOH HOH A . F 5 HOH 54 354 34 HOH HOH A . F 5 HOH 55 355 18 HOH HOH A . F 5 HOH 56 356 1 HOH HOH A . F 5 HOH 57 357 82 HOH HOH A . F 5 HOH 58 358 189 HOH HOH A . F 5 HOH 59 359 39 HOH HOH A . F 5 HOH 60 360 12 HOH HOH A . F 5 HOH 61 361 44 HOH HOH A . F 5 HOH 62 362 67 HOH HOH A . F 5 HOH 63 363 107 HOH HOH A . F 5 HOH 64 364 114 HOH HOH A . F 5 HOH 65 365 101 HOH HOH A . F 5 HOH 66 366 60 HOH HOH A . F 5 HOH 67 367 10 HOH HOH A . F 5 HOH 68 368 137 HOH HOH A . F 5 HOH 69 369 261 HOH HOH A . F 5 HOH 70 370 128 HOH HOH A . F 5 HOH 71 371 49 HOH HOH A . F 5 HOH 72 372 161 HOH HOH A . F 5 HOH 73 373 290 HOH HOH A . F 5 HOH 74 374 66 HOH HOH A . F 5 HOH 75 375 102 HOH HOH A . F 5 HOH 76 376 217 HOH HOH A . F 5 HOH 77 377 28 HOH HOH A . F 5 HOH 78 378 80 HOH HOH A . F 5 HOH 79 379 58 HOH HOH A . F 5 HOH 80 380 151 HOH HOH A . F 5 HOH 81 381 14 HOH HOH A . F 5 HOH 82 382 5 HOH HOH A . F 5 HOH 83 383 13 HOH HOH A . F 5 HOH 84 384 9 HOH HOH A . F 5 HOH 85 385 86 HOH HOH A . F 5 HOH 86 386 76 HOH HOH A . F 5 HOH 87 387 7 HOH HOH A . F 5 HOH 88 388 70 HOH HOH A . F 5 HOH 89 389 53 HOH HOH A . F 5 HOH 90 390 125 HOH HOH A . F 5 HOH 91 391 52 HOH HOH A . F 5 HOH 92 392 25 HOH HOH A . F 5 HOH 93 393 74 HOH HOH A . F 5 HOH 94 394 273 HOH HOH A . F 5 HOH 95 395 287 HOH HOH A . F 5 HOH 96 396 208 HOH HOH A . F 5 HOH 97 397 200 HOH HOH A . F 5 HOH 98 398 47 HOH HOH A . F 5 HOH 99 399 51 HOH HOH A . F 5 HOH 100 400 192 HOH HOH A . F 5 HOH 101 401 59 HOH HOH A . F 5 HOH 102 402 11 HOH HOH A . F 5 HOH 103 403 46 HOH HOH A . F 5 HOH 104 404 45 HOH HOH A . F 5 HOH 105 405 110 HOH HOH A . F 5 HOH 106 406 152 HOH HOH A . F 5 HOH 107 407 120 HOH HOH A . F 5 HOH 108 408 98 HOH HOH A . F 5 HOH 109 409 167 HOH HOH A . F 5 HOH 110 410 163 HOH HOH A . F 5 HOH 111 411 26 HOH HOH A . F 5 HOH 112 412 55 HOH HOH A . F 5 HOH 113 413 29 HOH HOH A . F 5 HOH 114 414 182 HOH HOH A . F 5 HOH 115 415 8 HOH HOH A . F 5 HOH 116 416 119 HOH HOH A . F 5 HOH 117 417 77 HOH HOH A . F 5 HOH 118 418 79 HOH HOH A . F 5 HOH 119 419 174 HOH HOH A . F 5 HOH 120 420 248 HOH HOH A . F 5 HOH 121 421 20 HOH HOH A . F 5 HOH 122 422 169 HOH HOH A . F 5 HOH 123 423 83 HOH HOH A . F 5 HOH 124 424 238 HOH HOH A . F 5 HOH 125 425 30 HOH HOH A . F 5 HOH 126 426 277 HOH HOH A . F 5 HOH 127 427 216 HOH HOH A . F 5 HOH 128 428 4 HOH HOH A . F 5 HOH 129 429 235 HOH HOH A . F 5 HOH 130 430 123 HOH HOH A . F 5 HOH 131 431 22 HOH HOH A . F 5 HOH 132 432 36 HOH HOH A . F 5 HOH 133 433 3 HOH HOH A . F 5 HOH 134 434 95 HOH HOH A . F 5 HOH 135 435 65 HOH HOH A . F 5 HOH 136 436 48 HOH HOH A . F 5 HOH 137 437 282 HOH HOH A . F 5 HOH 138 438 187 HOH HOH A . F 5 HOH 139 439 21 HOH HOH A . F 5 HOH 140 440 2 HOH HOH A . F 5 HOH 141 441 61 HOH HOH A . F 5 HOH 142 442 224 HOH HOH A . F 5 HOH 143 443 129 HOH HOH A . F 5 HOH 144 444 16 HOH HOH A . F 5 HOH 145 445 280 HOH HOH A . F 5 HOH 146 446 56 HOH HOH A . F 5 HOH 147 447 113 HOH HOH A . F 5 HOH 148 448 19 HOH HOH A . F 5 HOH 149 449 201 HOH HOH A . F 5 HOH 150 450 112 HOH HOH A . F 5 HOH 151 451 251 HOH HOH A . F 5 HOH 152 452 15 HOH HOH A . F 5 HOH 153 453 100 HOH HOH A . F 5 HOH 154 454 23 HOH HOH A . F 5 HOH 155 455 33 HOH HOH A . F 5 HOH 156 456 84 HOH HOH A . F 5 HOH 157 457 177 HOH HOH A . F 5 HOH 158 458 292 HOH HOH A . F 5 HOH 159 459 274 HOH HOH A . F 5 HOH 160 460 85 HOH HOH A . F 5 HOH 161 461 195 HOH HOH A . F 5 HOH 162 462 194 HOH HOH A . F 5 HOH 163 463 78 HOH HOH A . F 5 HOH 164 464 180 HOH HOH A . F 5 HOH 165 465 172 HOH HOH A . F 5 HOH 166 466 71 HOH HOH A . F 5 HOH 167 467 99 HOH HOH A . F 5 HOH 168 468 289 HOH HOH A . F 5 HOH 169 469 239 HOH HOH A . F 5 HOH 170 470 193 HOH HOH A . F 5 HOH 171 471 37 HOH HOH A . F 5 HOH 172 472 150 HOH HOH A . F 5 HOH 173 473 207 HOH HOH A . F 5 HOH 174 474 166 HOH HOH A . F 5 HOH 175 475 259 HOH HOH A . F 5 HOH 176 476 267 HOH HOH A . F 5 HOH 177 477 111 HOH HOH A . F 5 HOH 178 478 244 HOH HOH A . F 5 HOH 179 479 266 HOH HOH A . F 5 HOH 180 480 262 HOH HOH A . F 5 HOH 181 481 242 HOH HOH A . F 5 HOH 182 482 157 HOH HOH A . F 5 HOH 183 483 156 HOH HOH A . F 5 HOH 184 484 275 HOH HOH A . F 5 HOH 185 485 121 HOH HOH A . F 5 HOH 186 486 75 HOH HOH A . F 5 HOH 187 487 31 HOH HOH A . F 5 HOH 188 488 127 HOH HOH A . F 5 HOH 189 489 179 HOH HOH A . F 5 HOH 190 490 185 HOH HOH A . F 5 HOH 191 491 232 HOH HOH A . F 5 HOH 192 492 145 HOH HOH A . F 5 HOH 193 493 253 HOH HOH A . F 5 HOH 194 494 212 HOH HOH A . F 5 HOH 195 495 162 HOH HOH A . F 5 HOH 196 496 245 HOH HOH A . F 5 HOH 197 497 223 HOH HOH A . F 5 HOH 198 498 286 HOH HOH A . F 5 HOH 199 499 206 HOH HOH A . F 5 HOH 200 500 93 HOH HOH A . F 5 HOH 201 501 92 HOH HOH A . F 5 HOH 202 502 272 HOH HOH A . F 5 HOH 203 503 254 HOH HOH A . F 5 HOH 204 504 199 HOH HOH A . F 5 HOH 205 505 191 HOH HOH A . F 5 HOH 206 506 227 HOH HOH A . F 5 HOH 207 507 249 HOH HOH A . F 5 HOH 208 508 284 HOH HOH A . F 5 HOH 209 509 270 HOH HOH A . F 5 HOH 210 510 202 HOH HOH A . F 5 HOH 211 511 265 HOH HOH A . F 5 HOH 212 512 136 HOH HOH A . F 5 HOH 213 513 190 HOH HOH A . F 5 HOH 214 514 116 HOH HOH A . F 5 HOH 215 515 229 HOH HOH A . F 5 HOH 216 516 165 HOH HOH A . F 5 HOH 217 517 142 HOH HOH A . F 5 HOH 218 518 231 HOH HOH A . F 5 HOH 219 519 158 HOH HOH A . F 5 HOH 220 520 103 HOH HOH A . F 5 HOH 221 521 288 HOH HOH A . F 5 HOH 222 522 186 HOH HOH A . F 5 HOH 223 523 263 HOH HOH A . F 5 HOH 224 524 219 HOH HOH A . F 5 HOH 225 525 264 HOH HOH A . F 5 HOH 226 526 148 HOH HOH A . F 5 HOH 227 527 281 HOH HOH A . F 5 HOH 228 528 269 HOH HOH A . F 5 HOH 229 529 196 HOH HOH A . F 5 HOH 230 530 250 HOH HOH A . F 5 HOH 231 531 256 HOH HOH A . F 5 HOH 232 532 197 HOH HOH A . F 5 HOH 233 533 218 HOH HOH A . F 5 HOH 234 534 291 HOH HOH A . F 5 HOH 235 535 178 HOH HOH A . F 5 HOH 236 536 41 HOH HOH A . F 5 HOH 237 537 141 HOH HOH A . F 5 HOH 238 538 247 HOH HOH A . F 5 HOH 239 539 210 HOH HOH A . F 5 HOH 240 540 96 HOH HOH A . F 5 HOH 241 541 164 HOH HOH A . F 5 HOH 242 542 138 HOH HOH A . F 5 HOH 243 543 211 HOH HOH A . F 5 HOH 244 544 117 HOH HOH A . F 5 HOH 245 545 221 HOH HOH A . F 5 HOH 246 546 133 HOH HOH A . F 5 HOH 247 547 122 HOH HOH A . F 5 HOH 248 548 205 HOH HOH A . F 5 HOH 249 549 144 HOH HOH A . F 5 HOH 250 550 222 HOH HOH A . F 5 HOH 251 551 226 HOH HOH A . F 5 HOH 252 552 246 HOH HOH A . F 5 HOH 253 553 38 HOH HOH A . F 5 HOH 254 554 64 HOH HOH A . F 5 HOH 255 555 146 HOH HOH A . F 5 HOH 256 556 188 HOH HOH A . F 5 HOH 257 557 283 HOH HOH A . F 5 HOH 258 558 271 HOH HOH A . F 5 HOH 259 559 237 HOH HOH A . F 5 HOH 260 560 115 HOH HOH A . F 5 HOH 261 561 168 HOH HOH A . F 5 HOH 262 562 50 HOH HOH A . F 5 HOH 263 563 240 HOH HOH A . F 5 HOH 264 564 159 HOH HOH A . F 5 HOH 265 565 140 HOH HOH A . F 5 HOH 266 566 220 HOH HOH A . F 5 HOH 267 567 241 HOH HOH A . F 5 HOH 268 568 181 HOH HOH A . F 5 HOH 269 569 228 HOH HOH A . F 5 HOH 270 570 255 HOH HOH A . F 5 HOH 271 571 258 HOH HOH A . F 5 HOH 272 572 118 HOH HOH A . F 5 HOH 273 573 147 HOH HOH A . F 5 HOH 274 574 230 HOH HOH A . F 5 HOH 275 575 198 HOH HOH A . F 5 HOH 276 576 209 HOH HOH A . F 5 HOH 277 577 153 HOH HOH A . F 5 HOH 278 578 279 HOH HOH A . F 5 HOH 279 579 268 HOH HOH A . F 5 HOH 280 580 236 HOH HOH A . F 5 HOH 281 581 257 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 536 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NA ? B HEM . ? A HEM 201 ? 1_555 90.4 ? 2 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NB ? B HEM . ? A HEM 201 ? 1_555 91.0 ? 3 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NB ? B HEM . ? A HEM 201 ? 1_555 90.5 ? 4 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NC ? B HEM . ? A HEM 201 ? 1_555 93.2 ? 5 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NC ? B HEM . ? A HEM 201 ? 1_555 176.5 ? 6 NB ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NC ? B HEM . ? A HEM 201 ? 1_555 89.7 ? 7 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 91.7 ? 8 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 89.3 ? 9 NB ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 177.3 ? 10 NC ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 90.4 ? 11 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 N1 ? C IMD . ? A IMD 202 ? 1_555 178.4 ? 12 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 N1 ? C IMD . ? A IMD 202 ? 1_555 88.1 ? 13 NB ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 N1 ? C IMD . ? A IMD 202 ? 1_555 89.4 ? 14 NC ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 N1 ? C IMD . ? A IMD 202 ? 1_555 88.4 ? 15 ND ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 N1 ? C IMD . ? A IMD 202 ? 1_555 87.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-12-06 2 'Structure model' 1 1 2023-12-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_DOI' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation_author.identifier_ORCID' 8 2 'Structure model' '_citation_author.name' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z 3 y,-x+y,z 4 -y,x-y,z 5 -x+y,-x,z 6 -x,-y,z # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_entry_details.entry_id 8ESU _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 20 ? ? -161.68 73.62 2 1 HIS A 81 ? ? -90.43 59.03 3 1 LYS A 98 ? ? 61.55 65.50 4 1 PHE A 123 ? ? -143.22 46.07 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 577 ? 5.82 . 2 1 O ? A HOH 578 ? 5.84 . 3 1 O ? A HOH 579 ? 6.10 . 4 1 O ? A HOH 580 ? 6.37 . 5 1 O ? A HOH 581 ? 7.30 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 0 ? CG ? A MET 1 CG 2 1 Y 1 A MET 0 ? SD ? A MET 1 SD 3 1 Y 1 A MET 0 ? CE ? A MET 1 CE 4 1 Y 1 A LYS 98 ? CD ? A LYS 99 CD 5 1 Y 1 A LYS 98 ? CE ? A LYS 99 CE 6 1 Y 1 A LYS 98 ? NZ ? A LYS 99 NZ 7 1 Y 1 A LYS 102 ? CG ? A LYS 103 CG 8 1 Y 1 A LYS 102 ? CD ? A LYS 103 CD 9 1 Y 1 A LYS 102 ? CE ? A LYS 103 CE 10 1 Y 1 A LYS 102 ? NZ ? A LYS 103 NZ # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HEM CHA C N N 123 HEM CHB C N N 124 HEM CHC C N N 125 HEM CHD C N N 126 HEM C1A C Y N 127 HEM C2A C Y N 128 HEM C3A C Y N 129 HEM C4A C Y N 130 HEM CMA C N N 131 HEM CAA C N N 132 HEM CBA C N N 133 HEM CGA C N N 134 HEM O1A O N N 135 HEM O2A O N N 136 HEM C1B C N N 137 HEM C2B C N N 138 HEM C3B C N N 139 HEM C4B C N N 140 HEM CMB C N N 141 HEM CAB C N N 142 HEM CBB C N N 143 HEM C1C C Y N 144 HEM C2C C Y N 145 HEM C3C C Y N 146 HEM C4C C Y N 147 HEM CMC C N N 148 HEM CAC C N N 149 HEM CBC C N N 150 HEM C1D C N N 151 HEM C2D C N N 152 HEM C3D C N N 153 HEM C4D C N N 154 HEM CMD C N N 155 HEM CAD C N N 156 HEM CBD C N N 157 HEM CGD C N N 158 HEM O1D O N N 159 HEM O2D O N N 160 HEM NA N Y N 161 HEM NB N N N 162 HEM NC N Y N 163 HEM ND N N N 164 HEM FE FE N N 165 HEM HHB H N N 166 HEM HHC H N N 167 HEM HHD H N N 168 HEM HMA H N N 169 HEM HMAA H N N 170 HEM HMAB H N N 171 HEM HAA H N N 172 HEM HAAA H N N 173 HEM HBA H N N 174 HEM HBAA H N N 175 HEM HMB H N N 176 HEM HMBA H N N 177 HEM HMBB H N N 178 HEM HAB H N N 179 HEM HBB H N N 180 HEM HBBA H N N 181 HEM HMC H N N 182 HEM HMCA H N N 183 HEM HMCB H N N 184 HEM HAC H N N 185 HEM HBC H N N 186 HEM HBCA H N N 187 HEM HMD H N N 188 HEM HMDA H N N 189 HEM HMDB H N N 190 HEM HAD H N N 191 HEM HADA H N N 192 HEM HBD H N N 193 HEM HBDA H N N 194 HEM H2A H N N 195 HEM H2D H N N 196 HEM HHA H N N 197 HIS N N N N 198 HIS CA C N S 199 HIS C C N N 200 HIS O O N N 201 HIS CB C N N 202 HIS CG C Y N 203 HIS ND1 N Y N 204 HIS CD2 C Y N 205 HIS CE1 C Y N 206 HIS NE2 N Y N 207 HIS OXT O N N 208 HIS H H N N 209 HIS H2 H N N 210 HIS HA H N N 211 HIS HB2 H N N 212 HIS HB3 H N N 213 HIS HD1 H N N 214 HIS HD2 H N N 215 HIS HE1 H N N 216 HIS HE2 H N N 217 HIS HXT H N N 218 HOH O O N N 219 HOH H1 H N N 220 HOH H2 H N N 221 ILE N N N N 222 ILE CA C N S 223 ILE C C N N 224 ILE O O N N 225 ILE CB C N S 226 ILE CG1 C N N 227 ILE CG2 C N N 228 ILE CD1 C N N 229 ILE OXT O N N 230 ILE H H N N 231 ILE H2 H N N 232 ILE HA H N N 233 ILE HB H N N 234 ILE HG12 H N N 235 ILE HG13 H N N 236 ILE HG21 H N N 237 ILE HG22 H N N 238 ILE HG23 H N N 239 ILE HD11 H N N 240 ILE HD12 H N N 241 ILE HD13 H N N 242 ILE HXT H N N 243 IMD N1 N Y N 244 IMD C2 C Y N 245 IMD N3 N Y N 246 IMD C4 C Y N 247 IMD C5 C Y N 248 IMD HN1 H N N 249 IMD H2 H N N 250 IMD HN3 H N N 251 IMD H4 H N N 252 IMD H5 H N N 253 LEU N N N N 254 LEU CA C N S 255 LEU C C N N 256 LEU O O N N 257 LEU CB C N N 258 LEU CG C N N 259 LEU CD1 C N N 260 LEU CD2 C N N 261 LEU OXT O N N 262 LEU H H N N 263 LEU H2 H N N 264 LEU HA H N N 265 LEU HB2 H N N 266 LEU HB3 H N N 267 LEU HG H N N 268 LEU HD11 H N N 269 LEU HD12 H N N 270 LEU HD13 H N N 271 LEU HD21 H N N 272 LEU HD22 H N N 273 LEU HD23 H N N 274 LEU HXT H N N 275 LYS N N N N 276 LYS CA C N S 277 LYS C C N N 278 LYS O O N N 279 LYS CB C N N 280 LYS CG C N N 281 LYS CD C N N 282 LYS CE C N N 283 LYS NZ N N N 284 LYS OXT O N N 285 LYS H H N N 286 LYS H2 H N N 287 LYS HA H N N 288 LYS HB2 H N N 289 LYS HB3 H N N 290 LYS HG2 H N N 291 LYS HG3 H N N 292 LYS HD2 H N N 293 LYS HD3 H N N 294 LYS HE2 H N N 295 LYS HE3 H N N 296 LYS HZ1 H N N 297 LYS HZ2 H N N 298 LYS HZ3 H N N 299 LYS HXT H N N 300 MET N N N N 301 MET CA C N S 302 MET C C N N 303 MET O O N N 304 MET CB C N N 305 MET CG C N N 306 MET SD S N N 307 MET CE C N N 308 MET OXT O N N 309 MET H H N N 310 MET H2 H N N 311 MET HA H N N 312 MET HB2 H N N 313 MET HB3 H N N 314 MET HG2 H N N 315 MET HG3 H N N 316 MET HE1 H N N 317 MET HE2 H N N 318 MET HE3 H N N 319 MET HXT H N N 320 PHE N N N N 321 PHE CA C N S 322 PHE C C N N 323 PHE O O N N 324 PHE CB C N N 325 PHE CG C Y N 326 PHE CD1 C Y N 327 PHE CD2 C Y N 328 PHE CE1 C Y N 329 PHE CE2 C Y N 330 PHE CZ C Y N 331 PHE OXT O N N 332 PHE H H N N 333 PHE H2 H N N 334 PHE HA H N N 335 PHE HB2 H N N 336 PHE HB3 H N N 337 PHE HD1 H N N 338 PHE HD2 H N N 339 PHE HE1 H N N 340 PHE HE2 H N N 341 PHE HZ H N N 342 PHE HXT H N N 343 PRO N N N N 344 PRO CA C N S 345 PRO C C N N 346 PRO O O N N 347 PRO CB C N N 348 PRO CG C N N 349 PRO CD C N N 350 PRO OXT O N N 351 PRO H H N N 352 PRO HA H N N 353 PRO HB2 H N N 354 PRO HB3 H N N 355 PRO HG2 H N N 356 PRO HG3 H N N 357 PRO HD2 H N N 358 PRO HD3 H N N 359 PRO HXT H N N 360 SER N N N N 361 SER CA C N S 362 SER C C N N 363 SER O O N N 364 SER CB C N N 365 SER OG O N N 366 SER OXT O N N 367 SER H H N N 368 SER H2 H N N 369 SER HA H N N 370 SER HB2 H N N 371 SER HB3 H N N 372 SER HG H N N 373 SER HXT H N N 374 SO4 S S N N 375 SO4 O1 O N N 376 SO4 O2 O N N 377 SO4 O3 O N N 378 SO4 O4 O N N 379 THR N N N N 380 THR CA C N S 381 THR C C N N 382 THR O O N N 383 THR CB C N R 384 THR OG1 O N N 385 THR CG2 C N N 386 THR OXT O N N 387 THR H H N N 388 THR H2 H N N 389 THR HA H N N 390 THR HB H N N 391 THR HG1 H N N 392 THR HG21 H N N 393 THR HG22 H N N 394 THR HG23 H N N 395 THR HXT H N N 396 TRP N N N N 397 TRP CA C N S 398 TRP C C N N 399 TRP O O N N 400 TRP CB C N N 401 TRP CG C Y N 402 TRP CD1 C Y N 403 TRP CD2 C Y N 404 TRP NE1 N Y N 405 TRP CE2 C Y N 406 TRP CE3 C Y N 407 TRP CZ2 C Y N 408 TRP CZ3 C Y N 409 TRP CH2 C Y N 410 TRP OXT O N N 411 TRP H H N N 412 TRP H2 H N N 413 TRP HA H N N 414 TRP HB2 H N N 415 TRP HB3 H N N 416 TRP HD1 H N N 417 TRP HE1 H N N 418 TRP HE3 H N N 419 TRP HZ2 H N N 420 TRP HZ3 H N N 421 TRP HH2 H N N 422 TRP HXT H N N 423 TYR N N N N 424 TYR CA C N S 425 TYR C C N N 426 TYR O O N N 427 TYR CB C N N 428 TYR CG C Y N 429 TYR CD1 C Y N 430 TYR CD2 C Y N 431 TYR CE1 C Y N 432 TYR CE2 C Y N 433 TYR CZ C Y N 434 TYR OH O N N 435 TYR OXT O N N 436 TYR H H N N 437 TYR H2 H N N 438 TYR HA H N N 439 TYR HB2 H N N 440 TYR HB3 H N N 441 TYR HD1 H N N 442 TYR HD2 H N N 443 TYR HE1 H N N 444 TYR HE2 H N N 445 TYR HH H N N 446 TYR HXT H N N 447 VAL N N N N 448 VAL CA C N S 449 VAL C C N N 450 VAL O O N N 451 VAL CB C N N 452 VAL CG1 C N N 453 VAL CG2 C N N 454 VAL OXT O N N 455 VAL H H N N 456 VAL H2 H N N 457 VAL HA H N N 458 VAL HB H N N 459 VAL HG11 H N N 460 VAL HG12 H N N 461 VAL HG13 H N N 462 VAL HG21 H N N 463 VAL HG22 H N N 464 VAL HG23 H N N 465 VAL HXT H N N 466 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HEM CHA C1A sing N N 116 HEM CHA C4D doub N N 117 HEM CHA HHA sing N N 118 HEM CHB C4A sing N N 119 HEM CHB C1B doub N N 120 HEM CHB HHB sing N N 121 HEM CHC C4B sing N N 122 HEM CHC C1C doub N N 123 HEM CHC HHC sing N N 124 HEM CHD C4C doub N N 125 HEM CHD C1D sing N N 126 HEM CHD HHD sing N N 127 HEM C1A C2A doub Y N 128 HEM C1A NA sing Y N 129 HEM C2A C3A sing Y N 130 HEM C2A CAA sing N N 131 HEM C3A C4A doub Y N 132 HEM C3A CMA sing N N 133 HEM C4A NA sing Y N 134 HEM CMA HMA sing N N 135 HEM CMA HMAA sing N N 136 HEM CMA HMAB sing N N 137 HEM CAA CBA sing N N 138 HEM CAA HAA sing N N 139 HEM CAA HAAA sing N N 140 HEM CBA CGA sing N N 141 HEM CBA HBA sing N N 142 HEM CBA HBAA sing N N 143 HEM CGA O1A doub N N 144 HEM CGA O2A sing N N 145 HEM C1B C2B sing N N 146 HEM C1B NB sing N N 147 HEM C2B C3B doub N N 148 HEM C2B CMB sing N N 149 HEM C3B C4B sing N N 150 HEM C3B CAB sing N N 151 HEM C4B NB doub N N 152 HEM CMB HMB sing N N 153 HEM CMB HMBA sing N N 154 HEM CMB HMBB sing N N 155 HEM CAB CBB doub N N 156 HEM CAB HAB sing N N 157 HEM CBB HBB sing N N 158 HEM CBB HBBA sing N N 159 HEM C1C C2C sing Y N 160 HEM C1C NC sing Y N 161 HEM C2C C3C doub Y N 162 HEM C2C CMC sing N N 163 HEM C3C C4C sing Y N 164 HEM C3C CAC sing N N 165 HEM C4C NC sing Y N 166 HEM CMC HMC sing N N 167 HEM CMC HMCA sing N N 168 HEM CMC HMCB sing N N 169 HEM CAC CBC doub N N 170 HEM CAC HAC sing N N 171 HEM CBC HBC sing N N 172 HEM CBC HBCA sing N N 173 HEM C1D C2D sing N N 174 HEM C1D ND doub N N 175 HEM C2D C3D doub N N 176 HEM C2D CMD sing N N 177 HEM C3D C4D sing N N 178 HEM C3D CAD sing N N 179 HEM C4D ND sing N N 180 HEM CMD HMD sing N N 181 HEM CMD HMDA sing N N 182 HEM CMD HMDB sing N N 183 HEM CAD CBD sing N N 184 HEM CAD HAD sing N N 185 HEM CAD HADA sing N N 186 HEM CBD CGD sing N N 187 HEM CBD HBD sing N N 188 HEM CBD HBDA sing N N 189 HEM CGD O1D doub N N 190 HEM CGD O2D sing N N 191 HEM O2A H2A sing N N 192 HEM O2D H2D sing N N 193 HEM FE NA sing N N 194 HEM FE NB sing N N 195 HEM FE NC sing N N 196 HEM FE ND sing N N 197 HIS N CA sing N N 198 HIS N H sing N N 199 HIS N H2 sing N N 200 HIS CA C sing N N 201 HIS CA CB sing N N 202 HIS CA HA sing N N 203 HIS C O doub N N 204 HIS C OXT sing N N 205 HIS CB CG sing N N 206 HIS CB HB2 sing N N 207 HIS CB HB3 sing N N 208 HIS CG ND1 sing Y N 209 HIS CG CD2 doub Y N 210 HIS ND1 CE1 doub Y N 211 HIS ND1 HD1 sing N N 212 HIS CD2 NE2 sing Y N 213 HIS CD2 HD2 sing N N 214 HIS CE1 NE2 sing Y N 215 HIS CE1 HE1 sing N N 216 HIS NE2 HE2 sing N N 217 HIS OXT HXT sing N N 218 HOH O H1 sing N N 219 HOH O H2 sing N N 220 ILE N CA sing N N 221 ILE N H sing N N 222 ILE N H2 sing N N 223 ILE CA C sing N N 224 ILE CA CB sing N N 225 ILE CA HA sing N N 226 ILE C O doub N N 227 ILE C OXT sing N N 228 ILE CB CG1 sing N N 229 ILE CB CG2 sing N N 230 ILE CB HB sing N N 231 ILE CG1 CD1 sing N N 232 ILE CG1 HG12 sing N N 233 ILE CG1 HG13 sing N N 234 ILE CG2 HG21 sing N N 235 ILE CG2 HG22 sing N N 236 ILE CG2 HG23 sing N N 237 ILE CD1 HD11 sing N N 238 ILE CD1 HD12 sing N N 239 ILE CD1 HD13 sing N N 240 ILE OXT HXT sing N N 241 IMD N1 C2 sing Y N 242 IMD N1 C5 sing Y N 243 IMD N1 HN1 sing N N 244 IMD C2 N3 doub Y N 245 IMD C2 H2 sing N N 246 IMD N3 C4 sing Y N 247 IMD N3 HN3 sing N N 248 IMD C4 C5 doub Y N 249 IMD C4 H4 sing N N 250 IMD C5 H5 sing N N 251 LEU N CA sing N N 252 LEU N H sing N N 253 LEU N H2 sing N N 254 LEU CA C sing N N 255 LEU CA CB sing N N 256 LEU CA HA sing N N 257 LEU C O doub N N 258 LEU C OXT sing N N 259 LEU CB CG sing N N 260 LEU CB HB2 sing N N 261 LEU CB HB3 sing N N 262 LEU CG CD1 sing N N 263 LEU CG CD2 sing N N 264 LEU CG HG sing N N 265 LEU CD1 HD11 sing N N 266 LEU CD1 HD12 sing N N 267 LEU CD1 HD13 sing N N 268 LEU CD2 HD21 sing N N 269 LEU CD2 HD22 sing N N 270 LEU CD2 HD23 sing N N 271 LEU OXT HXT sing N N 272 LYS N CA sing N N 273 LYS N H sing N N 274 LYS N H2 sing N N 275 LYS CA C sing N N 276 LYS CA CB sing N N 277 LYS CA HA sing N N 278 LYS C O doub N N 279 LYS C OXT sing N N 280 LYS CB CG sing N N 281 LYS CB HB2 sing N N 282 LYS CB HB3 sing N N 283 LYS CG CD sing N N 284 LYS CG HG2 sing N N 285 LYS CG HG3 sing N N 286 LYS CD CE sing N N 287 LYS CD HD2 sing N N 288 LYS CD HD3 sing N N 289 LYS CE NZ sing N N 290 LYS CE HE2 sing N N 291 LYS CE HE3 sing N N 292 LYS NZ HZ1 sing N N 293 LYS NZ HZ2 sing N N 294 LYS NZ HZ3 sing N N 295 LYS OXT HXT sing N N 296 MET N CA sing N N 297 MET N H sing N N 298 MET N H2 sing N N 299 MET CA C sing N N 300 MET CA CB sing N N 301 MET CA HA sing N N 302 MET C O doub N N 303 MET C OXT sing N N 304 MET CB CG sing N N 305 MET CB HB2 sing N N 306 MET CB HB3 sing N N 307 MET CG SD sing N N 308 MET CG HG2 sing N N 309 MET CG HG3 sing N N 310 MET SD CE sing N N 311 MET CE HE1 sing N N 312 MET CE HE2 sing N N 313 MET CE HE3 sing N N 314 MET OXT HXT sing N N 315 PHE N CA sing N N 316 PHE N H sing N N 317 PHE N H2 sing N N 318 PHE CA C sing N N 319 PHE CA CB sing N N 320 PHE CA HA sing N N 321 PHE C O doub N N 322 PHE C OXT sing N N 323 PHE CB CG sing N N 324 PHE CB HB2 sing N N 325 PHE CB HB3 sing N N 326 PHE CG CD1 doub Y N 327 PHE CG CD2 sing Y N 328 PHE CD1 CE1 sing Y N 329 PHE CD1 HD1 sing N N 330 PHE CD2 CE2 doub Y N 331 PHE CD2 HD2 sing N N 332 PHE CE1 CZ doub Y N 333 PHE CE1 HE1 sing N N 334 PHE CE2 CZ sing Y N 335 PHE CE2 HE2 sing N N 336 PHE CZ HZ sing N N 337 PHE OXT HXT sing N N 338 PRO N CA sing N N 339 PRO N CD sing N N 340 PRO N H sing N N 341 PRO CA C sing N N 342 PRO CA CB sing N N 343 PRO CA HA sing N N 344 PRO C O doub N N 345 PRO C OXT sing N N 346 PRO CB CG sing N N 347 PRO CB HB2 sing N N 348 PRO CB HB3 sing N N 349 PRO CG CD sing N N 350 PRO CG HG2 sing N N 351 PRO CG HG3 sing N N 352 PRO CD HD2 sing N N 353 PRO CD HD3 sing N N 354 PRO OXT HXT sing N N 355 SER N CA sing N N 356 SER N H sing N N 357 SER N H2 sing N N 358 SER CA C sing N N 359 SER CA CB sing N N 360 SER CA HA sing N N 361 SER C O doub N N 362 SER C OXT sing N N 363 SER CB OG sing N N 364 SER CB HB2 sing N N 365 SER CB HB3 sing N N 366 SER OG HG sing N N 367 SER OXT HXT sing N N 368 SO4 S O1 doub N N 369 SO4 S O2 doub N N 370 SO4 S O3 sing N N 371 SO4 S O4 sing N N 372 THR N CA sing N N 373 THR N H sing N N 374 THR N H2 sing N N 375 THR CA C sing N N 376 THR CA CB sing N N 377 THR CA HA sing N N 378 THR C O doub N N 379 THR C OXT sing N N 380 THR CB OG1 sing N N 381 THR CB CG2 sing N N 382 THR CB HB sing N N 383 THR OG1 HG1 sing N N 384 THR CG2 HG21 sing N N 385 THR CG2 HG22 sing N N 386 THR CG2 HG23 sing N N 387 THR OXT HXT sing N N 388 TRP N CA sing N N 389 TRP N H sing N N 390 TRP N H2 sing N N 391 TRP CA C sing N N 392 TRP CA CB sing N N 393 TRP CA HA sing N N 394 TRP C O doub N N 395 TRP C OXT sing N N 396 TRP CB CG sing N N 397 TRP CB HB2 sing N N 398 TRP CB HB3 sing N N 399 TRP CG CD1 doub Y N 400 TRP CG CD2 sing Y N 401 TRP CD1 NE1 sing Y N 402 TRP CD1 HD1 sing N N 403 TRP CD2 CE2 doub Y N 404 TRP CD2 CE3 sing Y N 405 TRP NE1 CE2 sing Y N 406 TRP NE1 HE1 sing N N 407 TRP CE2 CZ2 sing Y N 408 TRP CE3 CZ3 doub Y N 409 TRP CE3 HE3 sing N N 410 TRP CZ2 CH2 doub Y N 411 TRP CZ2 HZ2 sing N N 412 TRP CZ3 CH2 sing Y N 413 TRP CZ3 HZ3 sing N N 414 TRP CH2 HH2 sing N N 415 TRP OXT HXT sing N N 416 TYR N CA sing N N 417 TYR N H sing N N 418 TYR N H2 sing N N 419 TYR CA C sing N N 420 TYR CA CB sing N N 421 TYR CA HA sing N N 422 TYR C O doub N N 423 TYR C OXT sing N N 424 TYR CB CG sing N N 425 TYR CB HB2 sing N N 426 TYR CB HB3 sing N N 427 TYR CG CD1 doub Y N 428 TYR CG CD2 sing Y N 429 TYR CD1 CE1 sing Y N 430 TYR CD1 HD1 sing N N 431 TYR CD2 CE2 doub Y N 432 TYR CD2 HD2 sing N N 433 TYR CE1 CZ doub Y N 434 TYR CE1 HE1 sing N N 435 TYR CE2 CZ sing Y N 436 TYR CE2 HE2 sing N N 437 TYR CZ OH sing N N 438 TYR OH HH sing N N 439 TYR OXT HXT sing N N 440 VAL N CA sing N N 441 VAL N H sing N N 442 VAL N H2 sing N N 443 VAL CA C sing N N 444 VAL CA CB sing N N 445 VAL CA HA sing N N 446 VAL C O doub N N 447 VAL C OXT sing N N 448 VAL CB CG1 sing N N 449 VAL CB CG2 sing N N 450 VAL CB HB sing N N 451 VAL CG1 HG11 sing N N 452 VAL CG1 HG12 sing N N 453 VAL CG1 HG13 sing N N 454 VAL CG2 HG21 sing N N 455 VAL CG2 HG22 sing N N 456 VAL CG2 HG23 sing N N 457 VAL OXT HXT sing N N 458 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HEM _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HEM _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PROTOPORPHYRIN IX CONTAINING FE' HEM 3 IMIDAZOLE IMD 4 'SULFATE ION' SO4 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 6' _space_group.name_Hall 'P 6' _space_group.IT_number 168 _space_group.crystal_system hexagonal _space_group.id 1 #