data_8FBK # _entry.id 8FBK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8FBK pdb_00008fbk 10.2210/pdb8fbk/pdb WWPDB D_1000270342 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-03-22 2 'Structure model' 1 1 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8FBK _pdbx_database_status.recvd_initial_deposition_date 2022-11-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email neil@ipd.uw.edu _pdbx_contact_author.name_first Neil _pdbx_contact_author.name_last King _pdbx_contact_author.name_mi P _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2978-4692 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, J.Y.' 1 ? 'Khmelinskaia, A.' 2 ? 'Bera, A.K.' 3 ? 'King, N.P.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 120 _citation.language ? _citation.page_first e2214556120 _citation.page_last e2214556120 _citation.title 'Improving the secretion of designed protein assemblies through negative design of cryptic transmembrane domains.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2214556120 _citation.pdbx_database_id_PubMed 36888664 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, J.Y.J.' 1 0000-0002-1511-6976 primary 'Khmelinskaia, A.' 2 ? primary 'Sheffler, W.' 3 ? primary 'Miranda, M.C.' 4 ? primary 'Antanasijevic, A.' 5 ? primary 'Borst, A.J.' 6 0000-0003-4297-7824 primary 'Torres, S.V.' 7 0000-0001-8226-8227 primary 'Shu, C.' 8 ? primary 'Hsia, Y.' 9 0000-0001-7467-8373 primary 'Nattermann, U.' 10 ? primary 'Ellis, D.' 11 ? primary 'Walkey, C.' 12 ? primary 'Ahlrichs, M.' 13 ? primary 'Chan, S.' 14 0000-0002-1617-0464 primary 'Kang, A.' 15 0000-0001-5487-0499 primary 'Nguyen, H.' 16 0000-0001-9696-4004 primary 'Sydeman, C.' 17 ? primary 'Sankaran, B.' 18 ? primary 'Wu, M.' 19 ? primary 'Bera, A.K.' 20 ? primary 'Carter, L.' 21 0000-0002-9837-9068 primary 'Fiala, B.' 22 0000-0003-0148-5268 primary 'Murphy, M.' 23 ? primary 'Baker, D.' 24 0000-0001-7896-6217 primary 'Ward, A.B.' 25 0000-0001-7153-3769 primary 'King, N.P.' 26 0000-0002-2978-4692 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description KWOCA_65 _entity.formula_weight 28111.396 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHGGSEQKLISEEDLSGGGSWSGSSKEVTERVAELAAEAVRATDKEEVIEIVKELAELAKQSTDSELVNFIVRAL AAVAIAAQDKELVIYIVKILAELAKQSTDSELVNEIVKALAEVAKAATDKELVKYIVDILLELAKQADDATLVAKIAEQL AEVREEAKDKELQERIDRVLKKLIEITLRALEESLRELRRILEELKEMLERLEKNPDKDVIVKVLKVIVKAIEASVRNQQ ISAANQKALALLA ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHGGSEQKLISEEDLSGGGSWSGSSKEVTERVAELAAEAVRATDKEEVIEIVKELAELAKQSTDSELVNFIVRAL AAVAIAAQDKELVIYIVKILAELAKQSTDSELVNEIVKALAEVAKAATDKELVKYIVDILLELAKQADDATLVAKIAEQL AEVREEAKDKELQERIDRVLKKLIEITLRALEESLRELRRILEELKEMLERLEKNPDKDVIVKVLKVIVKAIEASVRNQQ ISAANQKALALLA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 GLY n 1 9 GLY n 1 10 SER n 1 11 GLU n 1 12 GLN n 1 13 LYS n 1 14 LEU n 1 15 ILE n 1 16 SER n 1 17 GLU n 1 18 GLU n 1 19 ASP n 1 20 LEU n 1 21 SER n 1 22 GLY n 1 23 GLY n 1 24 GLY n 1 25 SER n 1 26 TRP n 1 27 SER n 1 28 GLY n 1 29 SER n 1 30 SER n 1 31 LYS n 1 32 GLU n 1 33 VAL n 1 34 THR n 1 35 GLU n 1 36 ARG n 1 37 VAL n 1 38 ALA n 1 39 GLU n 1 40 LEU n 1 41 ALA n 1 42 ALA n 1 43 GLU n 1 44 ALA n 1 45 VAL n 1 46 ARG n 1 47 ALA n 1 48 THR n 1 49 ASP n 1 50 LYS n 1 51 GLU n 1 52 GLU n 1 53 VAL n 1 54 ILE n 1 55 GLU n 1 56 ILE n 1 57 VAL n 1 58 LYS n 1 59 GLU n 1 60 LEU n 1 61 ALA n 1 62 GLU n 1 63 LEU n 1 64 ALA n 1 65 LYS n 1 66 GLN n 1 67 SER n 1 68 THR n 1 69 ASP n 1 70 SER n 1 71 GLU n 1 72 LEU n 1 73 VAL n 1 74 ASN n 1 75 PHE n 1 76 ILE n 1 77 VAL n 1 78 ARG n 1 79 ALA n 1 80 LEU n 1 81 ALA n 1 82 ALA n 1 83 VAL n 1 84 ALA n 1 85 ILE n 1 86 ALA n 1 87 ALA n 1 88 GLN n 1 89 ASP n 1 90 LYS n 1 91 GLU n 1 92 LEU n 1 93 VAL n 1 94 ILE n 1 95 TYR n 1 96 ILE n 1 97 VAL n 1 98 LYS n 1 99 ILE n 1 100 LEU n 1 101 ALA n 1 102 GLU n 1 103 LEU n 1 104 ALA n 1 105 LYS n 1 106 GLN n 1 107 SER n 1 108 THR n 1 109 ASP n 1 110 SER n 1 111 GLU n 1 112 LEU n 1 113 VAL n 1 114 ASN n 1 115 GLU n 1 116 ILE n 1 117 VAL n 1 118 LYS n 1 119 ALA n 1 120 LEU n 1 121 ALA n 1 122 GLU n 1 123 VAL n 1 124 ALA n 1 125 LYS n 1 126 ALA n 1 127 ALA n 1 128 THR n 1 129 ASP n 1 130 LYS n 1 131 GLU n 1 132 LEU n 1 133 VAL n 1 134 LYS n 1 135 TYR n 1 136 ILE n 1 137 VAL n 1 138 ASP n 1 139 ILE n 1 140 LEU n 1 141 LEU n 1 142 GLU n 1 143 LEU n 1 144 ALA n 1 145 LYS n 1 146 GLN n 1 147 ALA n 1 148 ASP n 1 149 ASP n 1 150 ALA n 1 151 THR n 1 152 LEU n 1 153 VAL n 1 154 ALA n 1 155 LYS n 1 156 ILE n 1 157 ALA n 1 158 GLU n 1 159 GLN n 1 160 LEU n 1 161 ALA n 1 162 GLU n 1 163 VAL n 1 164 ARG n 1 165 GLU n 1 166 GLU n 1 167 ALA n 1 168 LYS n 1 169 ASP n 1 170 LYS n 1 171 GLU n 1 172 LEU n 1 173 GLN n 1 174 GLU n 1 175 ARG n 1 176 ILE n 1 177 ASP n 1 178 ARG n 1 179 VAL n 1 180 LEU n 1 181 LYS n 1 182 LYS n 1 183 LEU n 1 184 ILE n 1 185 GLU n 1 186 ILE n 1 187 THR n 1 188 LEU n 1 189 ARG n 1 190 ALA n 1 191 LEU n 1 192 GLU n 1 193 GLU n 1 194 SER n 1 195 LEU n 1 196 ARG n 1 197 GLU n 1 198 LEU n 1 199 ARG n 1 200 ARG n 1 201 ILE n 1 202 LEU n 1 203 GLU n 1 204 GLU n 1 205 LEU n 1 206 LYS n 1 207 GLU n 1 208 MET n 1 209 LEU n 1 210 GLU n 1 211 ARG n 1 212 LEU n 1 213 GLU n 1 214 LYS n 1 215 ASN n 1 216 PRO n 1 217 ASP n 1 218 LYS n 1 219 ASP n 1 220 VAL n 1 221 ILE n 1 222 VAL n 1 223 LYS n 1 224 VAL n 1 225 LEU n 1 226 LYS n 1 227 VAL n 1 228 ILE n 1 229 VAL n 1 230 LYS n 1 231 ALA n 1 232 ILE n 1 233 GLU n 1 234 ALA n 1 235 SER n 1 236 VAL n 1 237 ARG n 1 238 ASN n 1 239 GLN n 1 240 GLN n 1 241 ILE n 1 242 SER n 1 243 ALA n 1 244 ALA n 1 245 ASN n 1 246 GLN n 1 247 LYS n 1 248 ALA n 1 249 LEU n 1 250 ALA n 1 251 LEU n 1 252 LEU n 1 253 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 253 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -28 ? ? ? A . n A 1 2 HIS 2 -27 ? ? ? A . n A 1 3 HIS 3 -26 ? ? ? A . n A 1 4 HIS 4 -25 ? ? ? A . n A 1 5 HIS 5 -24 ? ? ? A . n A 1 6 HIS 6 -23 ? ? ? A . n A 1 7 HIS 7 -22 ? ? ? A . n A 1 8 GLY 8 -21 ? ? ? A . n A 1 9 GLY 9 -20 ? ? ? A . n A 1 10 SER 10 -19 ? ? ? A . n A 1 11 GLU 11 -18 ? ? ? A . n A 1 12 GLN 12 -17 ? ? ? A . n A 1 13 LYS 13 -16 ? ? ? A . n A 1 14 LEU 14 -15 ? ? ? A . n A 1 15 ILE 15 -14 ? ? ? A . n A 1 16 SER 16 -13 ? ? ? A . n A 1 17 GLU 17 -12 ? ? ? A . n A 1 18 GLU 18 -11 ? ? ? A . n A 1 19 ASP 19 -10 ? ? ? A . n A 1 20 LEU 20 -9 ? ? ? A . n A 1 21 SER 21 -8 ? ? ? A . n A 1 22 GLY 22 -7 ? ? ? A . n A 1 23 GLY 23 -6 ? ? ? A . n A 1 24 GLY 24 -5 ? ? ? A . n A 1 25 SER 25 -4 ? ? ? A . n A 1 26 TRP 26 -3 ? ? ? A . n A 1 27 SER 27 -2 ? ? ? A . n A 1 28 GLY 28 -1 ? ? ? A . n A 1 29 SER 29 0 ? ? ? A . n A 1 30 SER 30 1 ? ? ? A . n A 1 31 LYS 31 2 ? ? ? A . n A 1 32 GLU 32 3 ? ? ? A . n A 1 33 VAL 33 4 ? ? ? A . n A 1 34 THR 34 5 ? ? ? A . n A 1 35 GLU 35 6 6 GLU GLU A . n A 1 36 ARG 36 7 7 ARG ARG A . n A 1 37 VAL 37 8 8 VAL VAL A . n A 1 38 ALA 38 9 9 ALA ALA A . n A 1 39 GLU 39 10 10 GLU GLU A . n A 1 40 LEU 40 11 11 LEU LEU A . n A 1 41 ALA 41 12 12 ALA ALA A . n A 1 42 ALA 42 13 13 ALA ALA A . n A 1 43 GLU 43 14 14 GLU GLU A . n A 1 44 ALA 44 15 15 ALA ALA A . n A 1 45 VAL 45 16 16 VAL VAL A . n A 1 46 ARG 46 17 17 ARG ARG A . n A 1 47 ALA 47 18 18 ALA ALA A . n A 1 48 THR 48 19 19 THR THR A . n A 1 49 ASP 49 20 20 ASP ASP A . n A 1 50 LYS 50 21 21 LYS LYS A . n A 1 51 GLU 51 22 22 GLU GLU A . n A 1 52 GLU 52 23 23 GLU GLU A . n A 1 53 VAL 53 24 24 VAL VAL A . n A 1 54 ILE 54 25 25 ILE ILE A . n A 1 55 GLU 55 26 26 GLU GLU A . n A 1 56 ILE 56 27 27 ILE ILE A . n A 1 57 VAL 57 28 28 VAL VAL A . n A 1 58 LYS 58 29 29 LYS LYS A . n A 1 59 GLU 59 30 30 GLU GLU A . n A 1 60 LEU 60 31 31 LEU LEU A . n A 1 61 ALA 61 32 32 ALA ALA A . n A 1 62 GLU 62 33 33 GLU GLU A . n A 1 63 LEU 63 34 34 LEU LEU A . n A 1 64 ALA 64 35 35 ALA ALA A . n A 1 65 LYS 65 36 36 LYS LYS A . n A 1 66 GLN 66 37 37 GLN GLN A . n A 1 67 SER 67 38 38 SER SER A . n A 1 68 THR 68 39 39 THR THR A . n A 1 69 ASP 69 40 40 ASP ASP A . n A 1 70 SER 70 41 41 SER SER A . n A 1 71 GLU 71 42 42 GLU GLU A . n A 1 72 LEU 72 43 43 LEU LEU A . n A 1 73 VAL 73 44 44 VAL VAL A . n A 1 74 ASN 74 45 45 ASN ASN A . n A 1 75 PHE 75 46 46 PHE PHE A . n A 1 76 ILE 76 47 47 ILE ILE A . n A 1 77 VAL 77 48 48 VAL VAL A . n A 1 78 ARG 78 49 49 ARG ARG A . n A 1 79 ALA 79 50 50 ALA ALA A . n A 1 80 LEU 80 51 51 LEU LEU A . n A 1 81 ALA 81 52 52 ALA ALA A . n A 1 82 ALA 82 53 53 ALA ALA A . n A 1 83 VAL 83 54 54 VAL VAL A . n A 1 84 ALA 84 55 55 ALA ALA A . n A 1 85 ILE 85 56 56 ILE ILE A . n A 1 86 ALA 86 57 57 ALA ALA A . n A 1 87 ALA 87 58 58 ALA ALA A . n A 1 88 GLN 88 59 59 GLN GLN A . n A 1 89 ASP 89 60 60 ASP ASP A . n A 1 90 LYS 90 61 61 LYS LYS A . n A 1 91 GLU 91 62 62 GLU GLU A . n A 1 92 LEU 92 63 63 LEU LEU A . n A 1 93 VAL 93 64 64 VAL VAL A . n A 1 94 ILE 94 65 65 ILE ILE A . n A 1 95 TYR 95 66 66 TYR TYR A . n A 1 96 ILE 96 67 67 ILE ILE A . n A 1 97 VAL 97 68 68 VAL VAL A . n A 1 98 LYS 98 69 69 LYS LYS A . n A 1 99 ILE 99 70 70 ILE ILE A . n A 1 100 LEU 100 71 71 LEU LEU A . n A 1 101 ALA 101 72 72 ALA ALA A . n A 1 102 GLU 102 73 73 GLU GLU A . n A 1 103 LEU 103 74 74 LEU LEU A . n A 1 104 ALA 104 75 75 ALA ALA A . n A 1 105 LYS 105 76 76 LYS LYS A . n A 1 106 GLN 106 77 77 GLN GLN A . n A 1 107 SER 107 78 78 SER SER A . n A 1 108 THR 108 79 79 THR THR A . n A 1 109 ASP 109 80 80 ASP ASP A . n A 1 110 SER 110 81 81 SER SER A . n A 1 111 GLU 111 82 82 GLU GLU A . n A 1 112 LEU 112 83 83 LEU LEU A . n A 1 113 VAL 113 84 84 VAL VAL A . n A 1 114 ASN 114 85 85 ASN ASN A . n A 1 115 GLU 115 86 86 GLU GLU A . n A 1 116 ILE 116 87 87 ILE ILE A . n A 1 117 VAL 117 88 88 VAL VAL A . n A 1 118 LYS 118 89 89 LYS LYS A . n A 1 119 ALA 119 90 90 ALA ALA A . n A 1 120 LEU 120 91 91 LEU LEU A . n A 1 121 ALA 121 92 92 ALA ALA A . n A 1 122 GLU 122 93 93 GLU GLU A . n A 1 123 VAL 123 94 94 VAL VAL A . n A 1 124 ALA 124 95 95 ALA ALA A . n A 1 125 LYS 125 96 96 LYS LYS A . n A 1 126 ALA 126 97 97 ALA ALA A . n A 1 127 ALA 127 98 98 ALA ALA A . n A 1 128 THR 128 99 99 THR THR A . n A 1 129 ASP 129 100 100 ASP ASP A . n A 1 130 LYS 130 101 101 LYS LYS A . n A 1 131 GLU 131 102 102 GLU GLU A . n A 1 132 LEU 132 103 103 LEU LEU A . n A 1 133 VAL 133 104 104 VAL VAL A . n A 1 134 LYS 134 105 105 LYS LYS A . n A 1 135 TYR 135 106 106 TYR TYR A . n A 1 136 ILE 136 107 107 ILE ILE A . n A 1 137 VAL 137 108 108 VAL VAL A . n A 1 138 ASP 138 109 109 ASP ASP A . n A 1 139 ILE 139 110 110 ILE ILE A . n A 1 140 LEU 140 111 111 LEU LEU A . n A 1 141 LEU 141 112 112 LEU LEU A . n A 1 142 GLU 142 113 113 GLU GLU A . n A 1 143 LEU 143 114 114 LEU LEU A . n A 1 144 ALA 144 115 115 ALA ALA A . n A 1 145 LYS 145 116 116 LYS LYS A . n A 1 146 GLN 146 117 117 GLN GLN A . n A 1 147 ALA 147 118 118 ALA ALA A . n A 1 148 ASP 148 119 119 ASP ASP A . n A 1 149 ASP 149 120 120 ASP ASP A . n A 1 150 ALA 150 121 121 ALA ALA A . n A 1 151 THR 151 122 122 THR THR A . n A 1 152 LEU 152 123 123 LEU LEU A . n A 1 153 VAL 153 124 124 VAL VAL A . n A 1 154 ALA 154 125 125 ALA ALA A . n A 1 155 LYS 155 126 126 LYS LYS A . n A 1 156 ILE 156 127 127 ILE ILE A . n A 1 157 ALA 157 128 128 ALA ALA A . n A 1 158 GLU 158 129 129 GLU GLU A . n A 1 159 GLN 159 130 130 GLN GLN A . n A 1 160 LEU 160 131 131 LEU LEU A . n A 1 161 ALA 161 132 132 ALA ALA A . n A 1 162 GLU 162 133 133 GLU GLU A . n A 1 163 VAL 163 134 134 VAL VAL A . n A 1 164 ARG 164 135 135 ARG ARG A . n A 1 165 GLU 165 136 136 GLU GLU A . n A 1 166 GLU 166 137 137 GLU GLU A . n A 1 167 ALA 167 138 138 ALA ALA A . n A 1 168 LYS 168 139 139 LYS LYS A . n A 1 169 ASP 169 140 140 ASP ASP A . n A 1 170 LYS 170 141 141 LYS LYS A . n A 1 171 GLU 171 142 142 GLU GLU A . n A 1 172 LEU 172 143 143 LEU LEU A . n A 1 173 GLN 173 144 144 GLN GLN A . n A 1 174 GLU 174 145 145 GLU GLU A . n A 1 175 ARG 175 146 146 ARG ARG A . n A 1 176 ILE 176 147 147 ILE ILE A . n A 1 177 ASP 177 148 148 ASP ASP A . n A 1 178 ARG 178 149 149 ARG ARG A . n A 1 179 VAL 179 150 150 VAL VAL A . n A 1 180 LEU 180 151 151 LEU LEU A . n A 1 181 LYS 181 152 152 LYS LYS A . n A 1 182 LYS 182 153 153 LYS LYS A . n A 1 183 LEU 183 154 154 LEU LEU A . n A 1 184 ILE 184 155 155 ILE ILE A . n A 1 185 GLU 185 156 156 GLU GLU A . n A 1 186 ILE 186 157 157 ILE ILE A . n A 1 187 THR 187 158 158 THR THR A . n A 1 188 LEU 188 159 159 LEU LEU A . n A 1 189 ARG 189 160 160 ARG ARG A . n A 1 190 ALA 190 161 161 ALA ALA A . n A 1 191 LEU 191 162 162 LEU LEU A . n A 1 192 GLU 192 163 163 GLU GLU A . n A 1 193 GLU 193 164 164 GLU GLU A . n A 1 194 SER 194 165 165 SER SER A . n A 1 195 LEU 195 166 166 LEU LEU A . n A 1 196 ARG 196 167 167 ARG ARG A . n A 1 197 GLU 197 168 168 GLU GLU A . n A 1 198 LEU 198 169 169 LEU LEU A . n A 1 199 ARG 199 170 170 ARG ARG A . n A 1 200 ARG 200 171 171 ARG ARG A . n A 1 201 ILE 201 172 172 ILE ILE A . n A 1 202 LEU 202 173 173 LEU LEU A . n A 1 203 GLU 203 174 174 GLU GLU A . n A 1 204 GLU 204 175 175 GLU GLU A . n A 1 205 LEU 205 176 176 LEU LEU A . n A 1 206 LYS 206 177 177 LYS LYS A . n A 1 207 GLU 207 178 178 GLU GLU A . n A 1 208 MET 208 179 179 MET MET A . n A 1 209 LEU 209 180 180 LEU LEU A . n A 1 210 GLU 210 181 181 GLU GLU A . n A 1 211 ARG 211 182 182 ARG ARG A . n A 1 212 LEU 212 183 183 LEU LEU A . n A 1 213 GLU 213 184 184 GLU GLU A . n A 1 214 LYS 214 185 185 LYS LYS A . n A 1 215 ASN 215 186 186 ASN ASN A . n A 1 216 PRO 216 187 187 PRO PRO A . n A 1 217 ASP 217 188 188 ASP ASP A . n A 1 218 LYS 218 189 189 LYS LYS A . n A 1 219 ASP 219 190 190 ASP ASP A . n A 1 220 VAL 220 191 191 VAL VAL A . n A 1 221 ILE 221 192 192 ILE ILE A . n A 1 222 VAL 222 193 193 VAL VAL A . n A 1 223 LYS 223 194 194 LYS LYS A . n A 1 224 VAL 224 195 195 VAL VAL A . n A 1 225 LEU 225 196 196 LEU LEU A . n A 1 226 LYS 226 197 197 LYS LYS A . n A 1 227 VAL 227 198 198 VAL VAL A . n A 1 228 ILE 228 199 199 ILE ILE A . n A 1 229 VAL 229 200 200 VAL VAL A . n A 1 230 LYS 230 201 201 LYS LYS A . n A 1 231 ALA 231 202 202 ALA ALA A . n A 1 232 ILE 232 203 203 ILE ILE A . n A 1 233 GLU 233 204 204 GLU GLU A . n A 1 234 ALA 234 205 205 ALA ALA A . n A 1 235 SER 235 206 206 SER SER A . n A 1 236 VAL 236 207 207 VAL VAL A . n A 1 237 ARG 237 208 208 ARG ARG A . n A 1 238 ASN 238 209 209 ASN ASN A . n A 1 239 GLN 239 210 210 GLN GLN A . n A 1 240 GLN 240 211 211 GLN GLN A . n A 1 241 ILE 241 212 212 ILE ILE A . n A 1 242 SER 242 213 213 SER SER A . n A 1 243 ALA 243 214 214 ALA ALA A . n A 1 244 ALA 244 215 215 ALA ALA A . n A 1 245 ASN 245 216 216 ASN ASN A . n A 1 246 GLN 246 217 217 GLN GLN A . n A 1 247 LYS 247 218 218 LYS LYS A . n A 1 248 ALA 248 219 219 ALA ALA A . n A 1 249 LEU 249 220 220 LEU LEU A . n A 1 250 ALA 250 221 221 ALA ALA A . n A 1 251 LEU 251 222 222 LEU LEU A . n A 1 252 LEU 252 223 223 LEU LEU A . n A 1 253 ALA 253 224 ? ? ? A . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.1_4122 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.1_4122 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8FBK _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.746 _cell.length_a_esd ? _cell.length_b 70.746 _cell.length_b_esd ? _cell.length_c 200.499 _cell.length_c_esd ? _cell.volume 869053.718 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8FBK _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 _symmetry.space_group_name_Hall 'P 6c 2c' _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8FBK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.26 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M magnesium chloride, 0.1 M imidazole, pH 8.0, 35% v/v MPD' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-04-27 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 95.79 _reflns.entry_id 8FBK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.15 _reflns.d_resolution_low 61.27 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5682 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.266 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.15 _reflns_shell.d_res_low 3.37 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 12073 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 12.1 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.648 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.286 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 96.78 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8FBK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.15 _refine.ls_d_res_low 61.27 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5660 _refine.ls_number_reflns_R_free 529 _refine.ls_number_reflns_R_work 5131 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.63 _refine.ls_percent_reflns_R_free 9.35 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2709 _refine.ls_R_factor_R_free 0.3088 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2671 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.63 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.0650 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5847 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.15 _refine_hist.d_res_low 61.27 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1710 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1710 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0016 ? 1713 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.3465 ? 2307 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0287 ? 297 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0021 ? 292 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.2266 ? 677 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.15 3.47 . . 141 1219 100.00 . . . . 0.3180 . . . . . . . . . . . 0.3888 'X-RAY DIFFRACTION' 3.47 3.97 . . 132 1238 99.93 . . . . 0.3126 . . . . . . . . . . . 0.3882 'X-RAY DIFFRACTION' 3.97 5.00 . . 126 1283 99.86 . . . . 0.2411 . . . . . . . . . . . 0.2598 'X-RAY DIFFRACTION' 5.00 61.27 . . 130 1391 98.83 . . . . 0.2535 . . . . . . . . . . . 0.2852 # _struct.entry_id 8FBK _struct.title 'Improving the secretion of designed protein assemblies through negative design of cryptic transmembrane domains' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8FBK _struct_keywords.text 'designed protein, protein assemblies, negative design, cryptic transmembrane domains, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8FBK _struct_ref.pdbx_db_accession 8FBK _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8FBK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 253 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8FBK _struct_ref_seq.db_align_beg -28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 224 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -28 _struct_ref_seq.pdbx_auth_seq_align_end 224 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5680 ? 1 MORE -54 ? 1 'SSA (A^2)' 32010 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -y+1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 70.7460000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 35.3730000000 -0.8660254038 -0.5000000000 0.0000000000 61.2678332161 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 35 ? ALA A 47 ? GLU A 6 ALA A 18 1 ? 13 HELX_P HELX_P2 AA2 ASP A 49 ? LYS A 65 ? ASP A 20 LYS A 36 1 ? 17 HELX_P HELX_P3 AA3 ASP A 69 ? ALA A 86 ? ASP A 40 ALA A 57 1 ? 18 HELX_P HELX_P4 AA4 ASP A 89 ? SER A 107 ? ASP A 60 SER A 78 1 ? 19 HELX_P HELX_P5 AA5 ASP A 109 ? ALA A 126 ? ASP A 80 ALA A 97 1 ? 18 HELX_P HELX_P6 AA6 ASP A 129 ? ALA A 147 ? ASP A 100 ALA A 118 1 ? 19 HELX_P HELX_P7 AA7 ASP A 149 ? LYS A 168 ? ASP A 120 LYS A 139 1 ? 20 HELX_P HELX_P8 AA8 GLU A 171 ? ASN A 215 ? GLU A 142 ASN A 186 1 ? 45 HELX_P HELX_P9 AA9 ASP A 217 ? LEU A 252 ? ASP A 188 LEU A 223 1 ? 36 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 58 ? ? 57.69 -166.85 2 1 ASP A 60 ? ? 68.81 121.69 3 1 ALA A 97 ? ? -103.05 64.21 4 1 LYS A 139 ? ? 57.23 -176.95 5 1 ASP A 140 ? ? 58.21 105.96 6 1 LYS A 141 ? ? -62.10 -178.71 7 1 GLU A 142 ? ? 71.96 -49.69 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/2 3 y,-x+y,z+1/2 4 -y,x-y,z 5 -x+y,-x,z 6 x-y,-y,-z 7 -x,-x+y,-z 8 -x,-y,z+1/2 9 y,x,-z 10 -y,-x,-z+1/2 11 -x+y,y,-z+1/2 12 x,x-y,-z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -28 ? A MET 1 2 1 Y 1 A HIS -27 ? A HIS 2 3 1 Y 1 A HIS -26 ? A HIS 3 4 1 Y 1 A HIS -25 ? A HIS 4 5 1 Y 1 A HIS -24 ? A HIS 5 6 1 Y 1 A HIS -23 ? A HIS 6 7 1 Y 1 A HIS -22 ? A HIS 7 8 1 Y 1 A GLY -21 ? A GLY 8 9 1 Y 1 A GLY -20 ? A GLY 9 10 1 Y 1 A SER -19 ? A SER 10 11 1 Y 1 A GLU -18 ? A GLU 11 12 1 Y 1 A GLN -17 ? A GLN 12 13 1 Y 1 A LYS -16 ? A LYS 13 14 1 Y 1 A LEU -15 ? A LEU 14 15 1 Y 1 A ILE -14 ? A ILE 15 16 1 Y 1 A SER -13 ? A SER 16 17 1 Y 1 A GLU -12 ? A GLU 17 18 1 Y 1 A GLU -11 ? A GLU 18 19 1 Y 1 A ASP -10 ? A ASP 19 20 1 Y 1 A LEU -9 ? A LEU 20 21 1 Y 1 A SER -8 ? A SER 21 22 1 Y 1 A GLY -7 ? A GLY 22 23 1 Y 1 A GLY -6 ? A GLY 23 24 1 Y 1 A GLY -5 ? A GLY 24 25 1 Y 1 A SER -4 ? A SER 25 26 1 Y 1 A TRP -3 ? A TRP 26 27 1 Y 1 A SER -2 ? A SER 27 28 1 Y 1 A GLY -1 ? A GLY 28 29 1 Y 1 A SER 0 ? A SER 29 30 1 Y 1 A SER 1 ? A SER 30 31 1 Y 1 A LYS 2 ? A LYS 31 32 1 Y 1 A GLU 3 ? A GLU 32 33 1 Y 1 A VAL 4 ? A VAL 33 34 1 Y 1 A THR 5 ? A THR 34 35 1 Y 1 A ALA 224 ? A ALA 253 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_audit_support.funding_organization 'Bill & Melinda Gates Foundation' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 63 2 2' _space_group.name_Hall 'P 6c 2c' _space_group.IT_number 182 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 8FBK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014135 _atom_sites.fract_transf_matrix[1][2] 0.008161 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016322 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004988 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_