data_8FD8 # _entry.id 8FD8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.366 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8FD8 pdb_00008fd8 10.2210/pdb8fd8/pdb WWPDB D_1000270428 ? ? EMDB EMD-29005 ? ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'human 15-PGDH with NADH bound' _pdbx_database_related.db_id EMD-29005 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8FD8 _pdbx_database_status.recvd_initial_deposition_date 2022-12-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Huang, W.' 1 0000-0003-2097-8148 'Taylor, D.' 2 0000-0001-9932-1856 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 784 _citation.page_last 784 _citation.title 'Small molecule inhibitors of 15-PGDH exploit a physiologic induced-fit closing system.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-023-36463-7 _citation.pdbx_database_id_PubMed 36774348 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, W.' 1 0000-0003-2097-8148 primary 'Li, H.' 2 ? primary 'Kiselar, J.' 3 ? primary 'Fink, S.P.' 4 ? primary 'Regmi, S.' 5 0000-0001-5104-6613 primary 'Day, A.' 6 ? primary 'Yuan, Y.' 7 ? primary 'Chance, M.' 8 ? primary 'Ready, J.M.' 9 0000-0003-1305-9581 primary 'Markowitz, S.D.' 10 0000-0001-5369-5254 primary 'Taylor, D.J.' 11 0000-0001-9932-1856 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8FD8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8FD8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '15-hydroxyprostaglandin dehydrogenase [NAD(+)]' 27886.053 2 1.1.1.141,1.1.1.-,1.1.1.232 ? ? ? 2 non-polymer syn '1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE' 665.441 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;15-PGDH,Eicosanoid/docosanoid dehydrogenase [NAD(+)],Prostaglandin dehydrogenase 1,Short chain dehydrogenase/reductase family 36C member 1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVD HFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVG FTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNG AIMKITTSKGIHFQDY ; _entity_poly.pdbx_seq_one_letter_code_can ;MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVD HFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVG FTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNG AIMKITTSKGIHFQDY ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 VAL n 1 4 ASN n 1 5 GLY n 1 6 LYS n 1 7 VAL n 1 8 ALA n 1 9 LEU n 1 10 VAL n 1 11 THR n 1 12 GLY n 1 13 ALA n 1 14 ALA n 1 15 GLN n 1 16 GLY n 1 17 ILE n 1 18 GLY n 1 19 ARG n 1 20 ALA n 1 21 PHE n 1 22 ALA n 1 23 GLU n 1 24 ALA n 1 25 LEU n 1 26 LEU n 1 27 LEU n 1 28 LYS n 1 29 GLY n 1 30 ALA n 1 31 LYS n 1 32 VAL n 1 33 ALA n 1 34 LEU n 1 35 VAL n 1 36 ASP n 1 37 TRP n 1 38 ASN n 1 39 LEU n 1 40 GLU n 1 41 ALA n 1 42 GLY n 1 43 VAL n 1 44 GLN n 1 45 CYS n 1 46 LYS n 1 47 ALA n 1 48 ALA n 1 49 LEU n 1 50 ASP n 1 51 GLU n 1 52 GLN n 1 53 PHE n 1 54 GLU n 1 55 PRO n 1 56 GLN n 1 57 LYS n 1 58 THR n 1 59 LEU n 1 60 PHE n 1 61 ILE n 1 62 GLN n 1 63 CYS n 1 64 ASP n 1 65 VAL n 1 66 ALA n 1 67 ASP n 1 68 GLN n 1 69 GLN n 1 70 GLN n 1 71 LEU n 1 72 ARG n 1 73 ASP n 1 74 THR n 1 75 PHE n 1 76 ARG n 1 77 LYS n 1 78 VAL n 1 79 VAL n 1 80 ASP n 1 81 HIS n 1 82 PHE n 1 83 GLY n 1 84 ARG n 1 85 LEU n 1 86 ASP n 1 87 ILE n 1 88 LEU n 1 89 VAL n 1 90 ASN n 1 91 ASN n 1 92 ALA n 1 93 GLY n 1 94 VAL n 1 95 ASN n 1 96 ASN n 1 97 GLU n 1 98 LYS n 1 99 ASN n 1 100 TRP n 1 101 GLU n 1 102 LYS n 1 103 THR n 1 104 LEU n 1 105 GLN n 1 106 ILE n 1 107 ASN n 1 108 LEU n 1 109 VAL n 1 110 SER n 1 111 VAL n 1 112 ILE n 1 113 SER n 1 114 GLY n 1 115 THR n 1 116 TYR n 1 117 LEU n 1 118 GLY n 1 119 LEU n 1 120 ASP n 1 121 TYR n 1 122 MET n 1 123 SER n 1 124 LYS n 1 125 GLN n 1 126 ASN n 1 127 GLY n 1 128 GLY n 1 129 GLU n 1 130 GLY n 1 131 GLY n 1 132 ILE n 1 133 ILE n 1 134 ILE n 1 135 ASN n 1 136 MET n 1 137 SER n 1 138 SER n 1 139 LEU n 1 140 ALA n 1 141 GLY n 1 142 LEU n 1 143 MET n 1 144 PRO n 1 145 VAL n 1 146 ALA n 1 147 GLN n 1 148 GLN n 1 149 PRO n 1 150 VAL n 1 151 TYR n 1 152 CYS n 1 153 ALA n 1 154 SER n 1 155 LYS n 1 156 HIS n 1 157 GLY n 1 158 ILE n 1 159 VAL n 1 160 GLY n 1 161 PHE n 1 162 THR n 1 163 ARG n 1 164 SER n 1 165 ALA n 1 166 ALA n 1 167 LEU n 1 168 ALA n 1 169 ALA n 1 170 ASN n 1 171 LEU n 1 172 MET n 1 173 ASN n 1 174 SER n 1 175 GLY n 1 176 VAL n 1 177 ARG n 1 178 LEU n 1 179 ASN n 1 180 ALA n 1 181 ILE n 1 182 CYS n 1 183 PRO n 1 184 GLY n 1 185 PHE n 1 186 VAL n 1 187 ASN n 1 188 THR n 1 189 ALA n 1 190 ILE n 1 191 LEU n 1 192 GLU n 1 193 SER n 1 194 ILE n 1 195 GLU n 1 196 LYS n 1 197 GLU n 1 198 GLU n 1 199 ASN n 1 200 MET n 1 201 GLY n 1 202 GLN n 1 203 TYR n 1 204 ILE n 1 205 GLU n 1 206 TYR n 1 207 LYS n 1 208 ASP n 1 209 HIS n 1 210 ILE n 1 211 LYS n 1 212 ASP n 1 213 MET n 1 214 ILE n 1 215 LYS n 1 216 TYR n 1 217 TYR n 1 218 GLY n 1 219 ILE n 1 220 LEU n 1 221 ASP n 1 222 PRO n 1 223 PRO n 1 224 LEU n 1 225 ILE n 1 226 ALA n 1 227 ASN n 1 228 GLY n 1 229 LEU n 1 230 ILE n 1 231 THR n 1 232 LEU n 1 233 ILE n 1 234 GLU n 1 235 ASP n 1 236 ASP n 1 237 ALA n 1 238 LEU n 1 239 ASN n 1 240 GLY n 1 241 ALA n 1 242 ILE n 1 243 MET n 1 244 LYS n 1 245 ILE n 1 246 THR n 1 247 THR n 1 248 SER n 1 249 LYS n 1 250 GLY n 1 251 ILE n 1 252 HIS n 1 253 PHE n 1 254 GLN n 1 255 ASP n 1 256 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 256 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HPGD, PGDH1, SDR36C1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PGDH_HUMAN _struct_ref.pdbx_db_accession P15428 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVD HFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVG FTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNG AIMKITTSKGIHFQDY ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8FD8 A 1 ? 256 ? P15428 1 ? 256 ? 1 256 2 1 8FD8 B 1 ? 256 ? P15428 1 ? 256 ? 1 256 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAI non-polymer . '1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE' NADH 'C21 H29 N7 O14 P2' 665.441 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8FD8 _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 51.83 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8FD8 _refine.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high . _refine.ls_d_res_low ? _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work ? _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'ELECTRON MICROSCOPY' ? 0.002 ? 8070 ? f_bond_d ? ? 'ELECTRON MICROSCOPY' ? 0.871 ? 14618 ? f_angle_d ? ? 'ELECTRON MICROSCOPY' ? 12.455 ? 2204 ? f_dihedral_angle_d ? ? 'ELECTRON MICROSCOPY' ? 0.056 ? 632 ? f_chiral_restr ? ? 'ELECTRON MICROSCOPY' ? 0.002 ? 1202 ? f_plane_restr ? ? # _struct.entry_id 8FD8 _struct.title 'human 15-PGDH with NADH bound' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8FD8 _struct_keywords.text 'DEHYDROGENASE, INHIBITOR, OXIDOREDUCTASE, OXIDOREDUCTASE-INHIBITOR complex' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 15 ? LYS A 28 ? GLN A 15 LYS A 28 1 ? 14 HELX_P HELX_P2 AA2 ASN A 38 ? GLU A 51 ? ASN A 38 GLU A 51 1 ? 14 HELX_P HELX_P3 AA3 GLU A 54 ? GLN A 56 ? GLU A 54 GLN A 56 5 ? 3 HELX_P HELX_P4 AA4 ASP A 67 ? GLY A 83 ? ASP A 67 GLY A 83 1 ? 17 HELX_P HELX_P5 AA5 ASN A 99 ? LEU A 108 ? ASN A 99 LEU A 108 1 ? 10 HELX_P HELX_P6 AA6 LEU A 108 ? SER A 123 ? LEU A 108 SER A 123 1 ? 16 HELX_P HELX_P7 AA7 LYS A 124 ? GLY A 127 ? LYS A 124 GLY A 127 5 ? 4 HELX_P HELX_P8 AA8 SER A 138 ? LEU A 142 ? SER A 138 LEU A 142 5 ? 5 HELX_P HELX_P9 AA9 GLN A 148 ? MET A 172 ? GLN A 148 MET A 172 1 ? 25 HELX_P HELX_P10 AB1 PRO A 222 ? ASP A 235 ? PRO A 222 ASP A 235 1 ? 14 HELX_P HELX_P11 AB2 GLY B 16 ? LYS B 28 ? GLY B 16 LYS B 28 1 ? 13 HELX_P HELX_P12 AB3 ASN B 38 ? GLU B 51 ? ASN B 38 GLU B 51 1 ? 14 HELX_P HELX_P13 AB4 GLN B 52 ? PHE B 53 ? GLN B 52 PHE B 53 5 ? 2 HELX_P HELX_P14 AB5 GLU B 54 ? GLN B 56 ? GLU B 54 GLN B 56 5 ? 3 HELX_P HELX_P15 AB6 ASP B 67 ? GLY B 83 ? ASP B 67 GLY B 83 1 ? 17 HELX_P HELX_P16 AB7 ASN B 99 ? LEU B 108 ? ASN B 99 LEU B 108 1 ? 10 HELX_P HELX_P17 AB8 LEU B 108 ? SER B 123 ? LEU B 108 SER B 123 1 ? 16 HELX_P HELX_P18 AB9 LYS B 124 ? GLY B 127 ? LYS B 124 GLY B 127 5 ? 4 HELX_P HELX_P19 AC1 SER B 138 ? LEU B 142 ? SER B 138 LEU B 142 5 ? 5 HELX_P HELX_P20 AC2 GLN B 148 ? ASN B 173 ? GLN B 148 ASN B 173 1 ? 26 HELX_P HELX_P21 AC3 PRO B 223 ? GLU B 234 ? PRO B 223 GLU B 234 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? parallel AA2 6 7 ? parallel AA2 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 58 ? GLN A 62 ? THR A 58 GLN A 62 AA1 2 LYS A 31 ? ASP A 36 ? LYS A 31 ASP A 36 AA1 3 VAL A 7 ? THR A 11 ? VAL A 7 THR A 11 AA1 4 ILE A 87 ? ASN A 90 ? ILE A 87 ASN A 90 AA1 5 ILE A 132 ? MET A 136 ? ILE A 132 MET A 136 AA1 6 ARG A 177 ? CYS A 182 ? ARG A 177 CYS A 182 AA1 7 ILE A 242 ? THR A 246 ? ILE A 242 THR A 246 AA1 8 GLY A 250 ? PHE A 253 ? GLY A 250 PHE A 253 AA2 1 THR B 58 ? ILE B 61 ? THR B 58 ILE B 61 AA2 2 LYS B 31 ? VAL B 35 ? LYS B 31 VAL B 35 AA2 3 VAL B 7 ? THR B 11 ? VAL B 7 THR B 11 AA2 4 ILE B 87 ? ASN B 90 ? ILE B 87 ASN B 90 AA2 5 ILE B 132 ? MET B 136 ? ILE B 132 MET B 136 AA2 6 LEU B 178 ? ILE B 181 ? LEU B 178 ILE B 181 AA2 7 ILE B 242 ? THR B 246 ? ILE B 242 THR B 246 AA2 8 GLY B 250 ? PHE B 253 ? GLY B 250 PHE B 253 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 59 ? O LEU A 59 N LEU A 34 ? N LEU A 34 AA1 2 3 O LYS A 31 ? O LYS A 31 N ALA A 8 ? N ALA A 8 AA1 3 4 N THR A 11 ? N THR A 11 O VAL A 89 ? O VAL A 89 AA1 4 5 N ASN A 90 ? N ASN A 90 O ILE A 134 ? O ILE A 134 AA1 5 6 N ASN A 135 ? N ASN A 135 O ILE A 181 ? O ILE A 181 AA1 6 7 N CYS A 182 ? N CYS A 182 O MET A 243 ? O MET A 243 AA1 7 8 N LYS A 244 ? N LYS A 244 O HIS A 252 ? O HIS A 252 AA2 1 2 O LEU B 59 ? O LEU B 59 N VAL B 32 ? N VAL B 32 AA2 2 3 O VAL B 35 ? O VAL B 35 N VAL B 10 ? N VAL B 10 AA2 3 4 N LEU B 9 ? N LEU B 9 O VAL B 89 ? O VAL B 89 AA2 4 5 N ASN B 90 ? N ASN B 90 O MET B 136 ? O MET B 136 AA2 5 6 N ASN B 135 ? N ASN B 135 O ILE B 181 ? O ILE B 181 AA2 6 7 N ALA B 180 ? N ALA B 180 O MET B 243 ? O MET B 243 AA2 7 8 N LYS B 244 ? N LYS B 244 O HIS B 252 ? O HIS B 252 # _atom_sites.entry_id 8FD8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 TRP 100 100 100 TRP TRP A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 MET 122 122 122 MET MET A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 MET 143 143 143 MET MET A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 CYS 152 152 152 CYS CYS A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 HIS 156 156 156 HIS HIS A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 MET 172 172 172 MET MET A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 ASN 179 179 179 ASN ASN A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 ILE 181 181 181 ILE ILE A . n A 1 182 CYS 182 182 182 CYS CYS A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 PHE 185 185 185 PHE PHE A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 ASN 187 187 ? ? ? A . n A 1 188 THR 188 188 ? ? ? A . n A 1 189 ALA 189 189 ? ? ? A . n A 1 190 ILE 190 190 ? ? ? A . n A 1 191 LEU 191 191 ? ? ? A . n A 1 192 GLU 192 192 ? ? ? A . n A 1 193 SER 193 193 ? ? ? A . n A 1 194 ILE 194 194 ? ? ? A . n A 1 195 GLU 195 195 ? ? ? A . n A 1 196 LYS 196 196 ? ? ? A . n A 1 197 GLU 197 197 ? ? ? A . n A 1 198 GLU 198 198 ? ? ? A . n A 1 199 ASN 199 199 ? ? ? A . n A 1 200 MET 200 200 ? ? ? A . n A 1 201 GLY 201 201 ? ? ? A . n A 1 202 GLN 202 202 ? ? ? A . n A 1 203 TYR 203 203 ? ? ? A . n A 1 204 ILE 204 204 ? ? ? A . n A 1 205 GLU 205 205 ? ? ? A . n A 1 206 TYR 206 206 ? ? ? A . n A 1 207 LYS 207 207 ? ? ? A . n A 1 208 ASP 208 208 ? ? ? A . n A 1 209 HIS 209 209 ? ? ? A . n A 1 210 ILE 210 210 ? ? ? A . n A 1 211 LYS 211 211 ? ? ? A . n A 1 212 ASP 212 212 ? ? ? A . n A 1 213 MET 213 213 ? ? ? A . n A 1 214 ILE 214 214 ? ? ? A . n A 1 215 LYS 215 215 ? ? ? A . n A 1 216 TYR 216 216 ? ? ? A . n A 1 217 TYR 217 217 ? ? ? A . n A 1 218 GLY 218 218 ? ? ? A . n A 1 219 ILE 219 219 ? ? ? A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 PRO 222 222 222 PRO PRO A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 ASN 227 227 227 ASN ASN A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 ILE 230 230 230 ILE ILE A . n A 1 231 THR 231 231 231 THR THR A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 ILE 233 233 233 ILE ILE A . n A 1 234 GLU 234 234 234 GLU GLU A . n A 1 235 ASP 235 235 235 ASP ASP A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 ASN 239 239 239 ASN ASN A . n A 1 240 GLY 240 240 240 GLY GLY A . n A 1 241 ALA 241 241 241 ALA ALA A . n A 1 242 ILE 242 242 242 ILE ILE A . n A 1 243 MET 243 243 243 MET MET A . n A 1 244 LYS 244 244 244 LYS LYS A . n A 1 245 ILE 245 245 245 ILE ILE A . n A 1 246 THR 246 246 246 THR THR A . n A 1 247 THR 247 247 247 THR THR A . n A 1 248 SER 248 248 248 SER SER A . n A 1 249 LYS 249 249 249 LYS LYS A . n A 1 250 GLY 250 250 250 GLY GLY A . n A 1 251 ILE 251 251 251 ILE ILE A . n A 1 252 HIS 252 252 252 HIS HIS A . n A 1 253 PHE 253 253 253 PHE PHE A . n A 1 254 GLN 254 254 254 GLN GLN A . n A 1 255 ASP 255 255 255 ASP ASP A . n A 1 256 TYR 256 256 256 TYR TYR A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 HIS 2 2 2 HIS HIS B . n B 1 3 VAL 3 3 3 VAL VAL B . n B 1 4 ASN 4 4 4 ASN ASN B . n B 1 5 GLY 5 5 5 GLY GLY B . n B 1 6 LYS 6 6 6 LYS LYS B . n B 1 7 VAL 7 7 7 VAL VAL B . n B 1 8 ALA 8 8 8 ALA ALA B . n B 1 9 LEU 9 9 9 LEU LEU B . n B 1 10 VAL 10 10 10 VAL VAL B . n B 1 11 THR 11 11 11 THR THR B . n B 1 12 GLY 12 12 12 GLY GLY B . n B 1 13 ALA 13 13 13 ALA ALA B . n B 1 14 ALA 14 14 14 ALA ALA B . n B 1 15 GLN 15 15 15 GLN GLN B . n B 1 16 GLY 16 16 16 GLY GLY B . n B 1 17 ILE 17 17 17 ILE ILE B . n B 1 18 GLY 18 18 18 GLY GLY B . n B 1 19 ARG 19 19 19 ARG ARG B . n B 1 20 ALA 20 20 20 ALA ALA B . n B 1 21 PHE 21 21 21 PHE PHE B . n B 1 22 ALA 22 22 22 ALA ALA B . n B 1 23 GLU 23 23 23 GLU GLU B . n B 1 24 ALA 24 24 24 ALA ALA B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 LEU 26 26 26 LEU LEU B . n B 1 27 LEU 27 27 27 LEU LEU B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 GLY 29 29 29 GLY GLY B . n B 1 30 ALA 30 30 30 ALA ALA B . n B 1 31 LYS 31 31 31 LYS LYS B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 ALA 33 33 33 ALA ALA B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 VAL 35 35 35 VAL VAL B . n B 1 36 ASP 36 36 36 ASP ASP B . n B 1 37 TRP 37 37 37 TRP TRP B . n B 1 38 ASN 38 38 38 ASN ASN B . n B 1 39 LEU 39 39 39 LEU LEU B . n B 1 40 GLU 40 40 40 GLU GLU B . n B 1 41 ALA 41 41 41 ALA ALA B . n B 1 42 GLY 42 42 42 GLY GLY B . n B 1 43 VAL 43 43 43 VAL VAL B . n B 1 44 GLN 44 44 44 GLN GLN B . n B 1 45 CYS 45 45 45 CYS CYS B . n B 1 46 LYS 46 46 46 LYS LYS B . n B 1 47 ALA 47 47 47 ALA ALA B . n B 1 48 ALA 48 48 48 ALA ALA B . n B 1 49 LEU 49 49 49 LEU LEU B . n B 1 50 ASP 50 50 50 ASP ASP B . n B 1 51 GLU 51 51 51 GLU GLU B . n B 1 52 GLN 52 52 52 GLN GLN B . n B 1 53 PHE 53 53 53 PHE PHE B . n B 1 54 GLU 54 54 54 GLU GLU B . n B 1 55 PRO 55 55 55 PRO PRO B . n B 1 56 GLN 56 56 56 GLN GLN B . n B 1 57 LYS 57 57 57 LYS LYS B . n B 1 58 THR 58 58 58 THR THR B . n B 1 59 LEU 59 59 59 LEU LEU B . n B 1 60 PHE 60 60 60 PHE PHE B . n B 1 61 ILE 61 61 61 ILE ILE B . n B 1 62 GLN 62 62 62 GLN GLN B . n B 1 63 CYS 63 63 63 CYS CYS B . n B 1 64 ASP 64 64 64 ASP ASP B . n B 1 65 VAL 65 65 65 VAL VAL B . n B 1 66 ALA 66 66 66 ALA ALA B . n B 1 67 ASP 67 67 67 ASP ASP B . n B 1 68 GLN 68 68 68 GLN GLN B . n B 1 69 GLN 69 69 69 GLN GLN B . n B 1 70 GLN 70 70 70 GLN GLN B . n B 1 71 LEU 71 71 71 LEU LEU B . n B 1 72 ARG 72 72 72 ARG ARG B . n B 1 73 ASP 73 73 73 ASP ASP B . n B 1 74 THR 74 74 74 THR THR B . n B 1 75 PHE 75 75 75 PHE PHE B . n B 1 76 ARG 76 76 76 ARG ARG B . n B 1 77 LYS 77 77 77 LYS LYS B . n B 1 78 VAL 78 78 78 VAL VAL B . n B 1 79 VAL 79 79 79 VAL VAL B . n B 1 80 ASP 80 80 80 ASP ASP B . n B 1 81 HIS 81 81 81 HIS HIS B . n B 1 82 PHE 82 82 82 PHE PHE B . n B 1 83 GLY 83 83 83 GLY GLY B . n B 1 84 ARG 84 84 84 ARG ARG B . n B 1 85 LEU 85 85 85 LEU LEU B . n B 1 86 ASP 86 86 86 ASP ASP B . n B 1 87 ILE 87 87 87 ILE ILE B . n B 1 88 LEU 88 88 88 LEU LEU B . n B 1 89 VAL 89 89 89 VAL VAL B . n B 1 90 ASN 90 90 90 ASN ASN B . n B 1 91 ASN 91 91 91 ASN ASN B . n B 1 92 ALA 92 92 92 ALA ALA B . n B 1 93 GLY 93 93 93 GLY GLY B . n B 1 94 VAL 94 94 94 VAL VAL B . n B 1 95 ASN 95 95 95 ASN ASN B . n B 1 96 ASN 96 96 96 ASN ASN B . n B 1 97 GLU 97 97 97 GLU GLU B . n B 1 98 LYS 98 98 98 LYS LYS B . n B 1 99 ASN 99 99 99 ASN ASN B . n B 1 100 TRP 100 100 100 TRP TRP B . n B 1 101 GLU 101 101 101 GLU GLU B . n B 1 102 LYS 102 102 102 LYS LYS B . n B 1 103 THR 103 103 103 THR THR B . n B 1 104 LEU 104 104 104 LEU LEU B . n B 1 105 GLN 105 105 105 GLN GLN B . n B 1 106 ILE 106 106 106 ILE ILE B . n B 1 107 ASN 107 107 107 ASN ASN B . n B 1 108 LEU 108 108 108 LEU LEU B . n B 1 109 VAL 109 109 109 VAL VAL B . n B 1 110 SER 110 110 110 SER SER B . n B 1 111 VAL 111 111 111 VAL VAL B . n B 1 112 ILE 112 112 112 ILE ILE B . n B 1 113 SER 113 113 113 SER SER B . n B 1 114 GLY 114 114 114 GLY GLY B . n B 1 115 THR 115 115 115 THR THR B . n B 1 116 TYR 116 116 116 TYR TYR B . n B 1 117 LEU 117 117 117 LEU LEU B . n B 1 118 GLY 118 118 118 GLY GLY B . n B 1 119 LEU 119 119 119 LEU LEU B . n B 1 120 ASP 120 120 120 ASP ASP B . n B 1 121 TYR 121 121 121 TYR TYR B . n B 1 122 MET 122 122 122 MET MET B . n B 1 123 SER 123 123 123 SER SER B . n B 1 124 LYS 124 124 124 LYS LYS B . n B 1 125 GLN 125 125 125 GLN GLN B . n B 1 126 ASN 126 126 126 ASN ASN B . n B 1 127 GLY 127 127 127 GLY GLY B . n B 1 128 GLY 128 128 128 GLY GLY B . n B 1 129 GLU 129 129 129 GLU GLU B . n B 1 130 GLY 130 130 130 GLY GLY B . n B 1 131 GLY 131 131 131 GLY GLY B . n B 1 132 ILE 132 132 132 ILE ILE B . n B 1 133 ILE 133 133 133 ILE ILE B . n B 1 134 ILE 134 134 134 ILE ILE B . n B 1 135 ASN 135 135 135 ASN ASN B . n B 1 136 MET 136 136 136 MET MET B . n B 1 137 SER 137 137 137 SER SER B . n B 1 138 SER 138 138 138 SER SER B . n B 1 139 LEU 139 139 139 LEU LEU B . n B 1 140 ALA 140 140 140 ALA ALA B . n B 1 141 GLY 141 141 141 GLY GLY B . n B 1 142 LEU 142 142 142 LEU LEU B . n B 1 143 MET 143 143 143 MET MET B . n B 1 144 PRO 144 144 144 PRO PRO B . n B 1 145 VAL 145 145 145 VAL VAL B . n B 1 146 ALA 146 146 146 ALA ALA B . n B 1 147 GLN 147 147 147 GLN GLN B . n B 1 148 GLN 148 148 148 GLN GLN B . n B 1 149 PRO 149 149 149 PRO PRO B . n B 1 150 VAL 150 150 150 VAL VAL B . n B 1 151 TYR 151 151 151 TYR TYR B . n B 1 152 CYS 152 152 152 CYS CYS B . n B 1 153 ALA 153 153 153 ALA ALA B . n B 1 154 SER 154 154 154 SER SER B . n B 1 155 LYS 155 155 155 LYS LYS B . n B 1 156 HIS 156 156 156 HIS HIS B . n B 1 157 GLY 157 157 157 GLY GLY B . n B 1 158 ILE 158 158 158 ILE ILE B . n B 1 159 VAL 159 159 159 VAL VAL B . n B 1 160 GLY 160 160 160 GLY GLY B . n B 1 161 PHE 161 161 161 PHE PHE B . n B 1 162 THR 162 162 162 THR THR B . n B 1 163 ARG 163 163 163 ARG ARG B . n B 1 164 SER 164 164 164 SER SER B . n B 1 165 ALA 165 165 165 ALA ALA B . n B 1 166 ALA 166 166 166 ALA ALA B . n B 1 167 LEU 167 167 167 LEU LEU B . n B 1 168 ALA 168 168 168 ALA ALA B . n B 1 169 ALA 169 169 169 ALA ALA B . n B 1 170 ASN 170 170 170 ASN ASN B . n B 1 171 LEU 171 171 171 LEU LEU B . n B 1 172 MET 172 172 172 MET MET B . n B 1 173 ASN 173 173 173 ASN ASN B . n B 1 174 SER 174 174 174 SER SER B . n B 1 175 GLY 175 175 175 GLY GLY B . n B 1 176 VAL 176 176 176 VAL VAL B . n B 1 177 ARG 177 177 177 ARG ARG B . n B 1 178 LEU 178 178 178 LEU LEU B . n B 1 179 ASN 179 179 179 ASN ASN B . n B 1 180 ALA 180 180 180 ALA ALA B . n B 1 181 ILE 181 181 181 ILE ILE B . n B 1 182 CYS 182 182 182 CYS CYS B . n B 1 183 PRO 183 183 183 PRO PRO B . n B 1 184 GLY 184 184 184 GLY GLY B . n B 1 185 PHE 185 185 ? ? ? B . n B 1 186 VAL 186 186 ? ? ? B . n B 1 187 ASN 187 187 ? ? ? B . n B 1 188 THR 188 188 ? ? ? B . n B 1 189 ALA 189 189 ? ? ? B . n B 1 190 ILE 190 190 ? ? ? B . n B 1 191 LEU 191 191 ? ? ? B . n B 1 192 GLU 192 192 ? ? ? B . n B 1 193 SER 193 193 ? ? ? B . n B 1 194 ILE 194 194 ? ? ? B . n B 1 195 GLU 195 195 ? ? ? B . n B 1 196 LYS 196 196 ? ? ? B . n B 1 197 GLU 197 197 ? ? ? B . n B 1 198 GLU 198 198 ? ? ? B . n B 1 199 ASN 199 199 ? ? ? B . n B 1 200 MET 200 200 ? ? ? B . n B 1 201 GLY 201 201 ? ? ? B . n B 1 202 GLN 202 202 ? ? ? B . n B 1 203 TYR 203 203 ? ? ? B . n B 1 204 ILE 204 204 ? ? ? B . n B 1 205 GLU 205 205 ? ? ? B . n B 1 206 TYR 206 206 ? ? ? B . n B 1 207 LYS 207 207 ? ? ? B . n B 1 208 ASP 208 208 ? ? ? B . n B 1 209 HIS 209 209 ? ? ? B . n B 1 210 ILE 210 210 ? ? ? B . n B 1 211 LYS 211 211 ? ? ? B . n B 1 212 ASP 212 212 ? ? ? B . n B 1 213 MET 213 213 ? ? ? B . n B 1 214 ILE 214 214 ? ? ? B . n B 1 215 LYS 215 215 ? ? ? B . n B 1 216 TYR 216 216 ? ? ? B . n B 1 217 TYR 217 217 ? ? ? B . n B 1 218 GLY 218 218 ? ? ? B . n B 1 219 ILE 219 219 ? ? ? B . n B 1 220 LEU 220 220 ? ? ? B . n B 1 221 ASP 221 221 ? ? ? B . n B 1 222 PRO 222 222 222 PRO PRO B . n B 1 223 PRO 223 223 223 PRO PRO B . n B 1 224 LEU 224 224 224 LEU LEU B . n B 1 225 ILE 225 225 225 ILE ILE B . n B 1 226 ALA 226 226 226 ALA ALA B . n B 1 227 ASN 227 227 227 ASN ASN B . n B 1 228 GLY 228 228 228 GLY GLY B . n B 1 229 LEU 229 229 229 LEU LEU B . n B 1 230 ILE 230 230 230 ILE ILE B . n B 1 231 THR 231 231 231 THR THR B . n B 1 232 LEU 232 232 232 LEU LEU B . n B 1 233 ILE 233 233 233 ILE ILE B . n B 1 234 GLU 234 234 234 GLU GLU B . n B 1 235 ASP 235 235 235 ASP ASP B . n B 1 236 ASP 236 236 236 ASP ASP B . n B 1 237 ALA 237 237 237 ALA ALA B . n B 1 238 LEU 238 238 238 LEU LEU B . n B 1 239 ASN 239 239 239 ASN ASN B . n B 1 240 GLY 240 240 240 GLY GLY B . n B 1 241 ALA 241 241 241 ALA ALA B . n B 1 242 ILE 242 242 242 ILE ILE B . n B 1 243 MET 243 243 243 MET MET B . n B 1 244 LYS 244 244 244 LYS LYS B . n B 1 245 ILE 245 245 245 ILE ILE B . n B 1 246 THR 246 246 246 THR THR B . n B 1 247 THR 247 247 247 THR THR B . n B 1 248 SER 248 248 248 SER SER B . n B 1 249 LYS 249 249 249 LYS LYS B . n B 1 250 GLY 250 250 250 GLY GLY B . n B 1 251 ILE 251 251 251 ILE ILE B . n B 1 252 HIS 252 252 252 HIS HIS B . n B 1 253 PHE 253 253 253 PHE PHE B . n B 1 254 GLN 254 254 254 GLN GLN B . n B 1 255 ASP 255 255 255 ASP ASP B . n B 1 256 TYR 256 256 256 TYR TYR B . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email djt36@case.edu _pdbx_contact_author.name_first Derek _pdbx_contact_author.name_last Taylor _pdbx_contact_author.name_mi J. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9932-1856 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 NAI 1 300 300 NAI NAI A . D 2 NAI 1 300 300 NAI NAI B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-03-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _software.citation_id ? _software.classification refinement _software.compiler_name ? _software.compiler_version ? _software.contact_author ? _software.contact_author_email ? _software.date ? _software.description ? _software.dependencies ? _software.hardware ? _software.language ? _software.location ? _software.mods ? _software.name PHENIX _software.os ? _software.os_version ? _software.type ? _software.version 1.20.1_4487: _software.pdbx_ordinal 1 # _pdbx_entry_details.entry_id 8FD8 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 8FD8 _em_3d_fitting.method ? _em_3d_fitting.target_criteria ? _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_space ? _em_3d_fitting.ref_protocol ? # loop_ _em_3d_reconstruction.entry_id _em_3d_reconstruction.id _em_3d_reconstruction.method _em_3d_reconstruction.algorithm _em_3d_reconstruction.citation_id _em_3d_reconstruction.details _em_3d_reconstruction.resolution _em_3d_reconstruction.resolution_method _em_3d_reconstruction.magnification_calibration _em_3d_reconstruction.nominal_pixel_size _em_3d_reconstruction.actual_pixel_size _em_3d_reconstruction.num_particles _em_3d_reconstruction.euler_angles_details _em_3d_reconstruction.num_class_averages _em_3d_reconstruction.refinement_type _em_3d_reconstruction.image_processing_id _em_3d_reconstruction.symmetry_type 8FD8 1 ? ? ? ? 3.3 'FSC 0.143 CUT-OFF' ? ? ? 267049 ? 1 ? 1 POINT 8FD8 2 ? ? ? ? 3.3 'FSC 0.143 CUT-OFF' ? ? ? 267049 ? 1 ? 1 POINT 8FD8 3 ? ? ? ? 3.3 'FSC 0.143 CUT-OFF' ? ? ? 267049 ? ? ? 2 POINT 8FD8 4 ? ? ? ? 3.3 'FSC 0.143 CUT-OFF' ? ? ? 267049 ? ? ? 2 POINT # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name ? _em_buffer.details ? _em_buffer.pH 7.40 # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type COMPLEX _em_entity_assembly.name ;HUMAN 15-PGDH IN COMPLEX WITH INHIBITOR ; _em_entity_assembly.details ? _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? _em_entity_assembly.entity_id_list 1 # _em_imaging.entry_id 8FD8 _em_imaging.id 1 _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.residual_tilt ? _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model ? _em_imaging.details ? _em_imaging.date ? _em_imaging.accelerating_voltage 300 _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_min 250 _em_imaging.nominal_defocus_max 2000 _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_defocus_max ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_magnification ? _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.citation_id ? _em_imaging.temperature ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_minimum ? _em_imaging.recording_temperature_maximum ? _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.specimen_id 1 _em_imaging.cryogen ? # _em_vitrification.entry_id 8FD8 _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity ? _em_vitrification.temp ? _em_vitrification.chamber_temperature ? _em_vitrification.instrument ? _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? _em_vitrification.details ? # _em_experiment.entry_id 8FD8 _em_experiment.id 1 _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.aggregation_state PARTICLE _em_experiment.entity_assembly_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLU 40 ? ? NE2 A GLN 44 ? ? 2.04 2 1 NE2 A GLN 125 ? ? O A ASN 173 ? ? 2.10 3 1 O B GLU 40 ? ? NE2 B GLN 44 ? ? 2.12 4 1 OG B SER 123 ? ? OG B SER 174 ? ? 2.16 5 1 O B VAL 65 ? ? OG B SER 110 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 85 ? ? -170.17 133.75 2 1 SER A 137 ? ? -126.67 -166.93 3 1 ASN A 173 ? ? 61.76 61.28 4 1 THR A 247 ? ? -91.02 49.34 5 1 CYS B 63 ? ? -162.31 118.65 6 1 ALA B 66 ? ? -140.82 -15.56 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 187 ? A ASN 187 2 1 Y 1 A THR 188 ? A THR 188 3 1 Y 1 A ALA 189 ? A ALA 189 4 1 Y 1 A ILE 190 ? A ILE 190 5 1 Y 1 A LEU 191 ? A LEU 191 6 1 Y 1 A GLU 192 ? A GLU 192 7 1 Y 1 A SER 193 ? A SER 193 8 1 Y 1 A ILE 194 ? A ILE 194 9 1 Y 1 A GLU 195 ? A GLU 195 10 1 Y 1 A LYS 196 ? A LYS 196 11 1 Y 1 A GLU 197 ? A GLU 197 12 1 Y 1 A GLU 198 ? A GLU 198 13 1 Y 1 A ASN 199 ? A ASN 199 14 1 Y 1 A MET 200 ? A MET 200 15 1 Y 1 A GLY 201 ? A GLY 201 16 1 Y 1 A GLN 202 ? A GLN 202 17 1 Y 1 A TYR 203 ? A TYR 203 18 1 Y 1 A ILE 204 ? A ILE 204 19 1 Y 1 A GLU 205 ? A GLU 205 20 1 Y 1 A TYR 206 ? A TYR 206 21 1 Y 1 A LYS 207 ? A LYS 207 22 1 Y 1 A ASP 208 ? A ASP 208 23 1 Y 1 A HIS 209 ? A HIS 209 24 1 Y 1 A ILE 210 ? A ILE 210 25 1 Y 1 A LYS 211 ? A LYS 211 26 1 Y 1 A ASP 212 ? A ASP 212 27 1 Y 1 A MET 213 ? A MET 213 28 1 Y 1 A ILE 214 ? A ILE 214 29 1 Y 1 A LYS 215 ? A LYS 215 30 1 Y 1 A TYR 216 ? A TYR 216 31 1 Y 1 A TYR 217 ? A TYR 217 32 1 Y 1 A GLY 218 ? A GLY 218 33 1 Y 1 A ILE 219 ? A ILE 219 34 1 Y 1 B PHE 185 ? B PHE 185 35 1 Y 1 B VAL 186 ? B VAL 186 36 1 Y 1 B ASN 187 ? B ASN 187 37 1 Y 1 B THR 188 ? B THR 188 38 1 Y 1 B ALA 189 ? B ALA 189 39 1 Y 1 B ILE 190 ? B ILE 190 40 1 Y 1 B LEU 191 ? B LEU 191 41 1 Y 1 B GLU 192 ? B GLU 192 42 1 Y 1 B SER 193 ? B SER 193 43 1 Y 1 B ILE 194 ? B ILE 194 44 1 Y 1 B GLU 195 ? B GLU 195 45 1 Y 1 B LYS 196 ? B LYS 196 46 1 Y 1 B GLU 197 ? B GLU 197 47 1 Y 1 B GLU 198 ? B GLU 198 48 1 Y 1 B ASN 199 ? B ASN 199 49 1 Y 1 B MET 200 ? B MET 200 50 1 Y 1 B GLY 201 ? B GLY 201 51 1 Y 1 B GLN 202 ? B GLN 202 52 1 Y 1 B TYR 203 ? B TYR 203 53 1 Y 1 B ILE 204 ? B ILE 204 54 1 Y 1 B GLU 205 ? B GLU 205 55 1 Y 1 B TYR 206 ? B TYR 206 56 1 Y 1 B LYS 207 ? B LYS 207 57 1 Y 1 B ASP 208 ? B ASP 208 58 1 Y 1 B HIS 209 ? B HIS 209 59 1 Y 1 B ILE 210 ? B ILE 210 60 1 Y 1 B LYS 211 ? B LYS 211 61 1 Y 1 B ASP 212 ? B ASP 212 62 1 Y 1 B MET 213 ? B MET 213 63 1 Y 1 B ILE 214 ? B ILE 214 64 1 Y 1 B LYS 215 ? B LYS 215 65 1 Y 1 B TYR 216 ? B TYR 216 66 1 Y 1 B TYR 217 ? B TYR 217 67 1 Y 1 B GLY 218 ? B GLY 218 68 1 Y 1 B ILE 219 ? B ILE 219 69 1 Y 1 B LEU 220 ? B LEU 220 70 1 Y 1 B ASP 221 ? B ASP 221 # loop_ _em_ctf_correction.details _em_ctf_correction.em_image_processing_id _em_ctf_correction.id _em_ctf_correction.type ? 1 1 'PHASE FLIPPING AND AMPLITUDE CORRECTION' ? 2 2 'PHASE FLIPPING AND AMPLITUDE CORRECTION' # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.ncbi_tax_id 9606 _em_entity_assembly_naturalsource.organism 'Homo sapiens' _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.ncbi_tax_id 562 _em_entity_assembly_recombinant.organism 'Escherichia coli' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain ? # loop_ _em_image_processing.details _em_image_processing.id _em_image_processing.image_recording_id ? 1 1 ? 2 1 # _em_image_recording.average_exposure_time ? _em_image_recording.avg_electron_dose_per_subtomogram ? _em_image_recording.avg_electron_dose_per_image 1.08 _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K3 BIOQUANTUM (6k x 4k)' _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # loop_ _em_software.category _em_software.details _em_software.id _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id _em_software.name _em_software.version 'IMAGE ACQUISITION' ? 1 1 ? 1 ? ? MASKING ? 2 1 ? 1 ? ? 'CTF CORRECTION' ? 3 1 ? ? ? ? 'LAYERLINE INDEXING' ? 4 1 ? 1 ? ? 'DIFFRACTION INDEXING' ? 5 1 ? 1 ? ? 'MODEL FITTING' ? 6 1 ? 1 ? ? 'MODEL REFINEMENT' ? 7 1 ? 1 ? ? OTHER ? 8 1 ? 1 ? ? 'INITIAL EULER ASSIGNMENT' ? 9 1 ? ? ? ? 'FINAL EULER ASSIGNMENT' ? 10 1 ? ? ? ? CLASSIFICATION ? 11 1 ? ? ? ? RECONSTRUCTION ? 12 1 ? ? ? ? 'PARTICLE SELECTION' ? 13 2 ? ? ? ? 'CTF CORRECTION' ? 14 2 ? ? ? ? 'INITIAL EULER ASSIGNMENT' ? 15 2 ? ? ? ? 'FINAL EULER ASSIGNMENT' ? 16 2 ? ? ? ? CLASSIFICATION ? 17 2 ? ? ? ? RECONSTRUCTION ? 18 2 ? ? ? ? 'VOLUME SELECTION' ? 19 1 1 1 ? ? 'SERIES ALIGNMENT' ? 20 1 1 1 ? ? 'MOLECULAR REPLACEMENT' ? 21 1 1 1 ? ? 'LATTICE DISTORTION CORRECTION' ? 22 1 1 1 ? ? 'SYMMETRY DETERMINATION' ? 23 1 1 1 ? ? 'CRYSTALLOGRAPHY MERGING' ? 24 1 1 1 ? ? # _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 1RM1GM142002 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE' _pdbx_entity_nonpoly.comp_id NAI # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details ? #