data_8FJG # _entry.id 8FJG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8FJG pdb_00008fjg 10.2210/pdb8fjg/pdb WWPDB D_1000270902 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8FJG _pdbx_database_status.recvd_initial_deposition_date 2022-12-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bera, A.K.' 1 ? 'An, L.' 2 ? 'Baker, D.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1545-9985 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 30 _citation.language ? _citation.page_first 1755 _citation.page_last 1760 _citation.title 'Hallucination of closed repeat proteins containing central pockets.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41594-023-01112-6 _citation.pdbx_database_id_PubMed 37770718 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'An, L.' 1 0000-0001-9858-9105 primary 'Hicks, D.R.' 2 ? primary 'Zorine, D.' 3 0000-0001-7770-8929 primary 'Dauparas, J.' 4 ? primary 'Wicky, B.I.M.' 5 0000-0002-2501-7875 primary 'Milles, L.F.' 6 0000-0001-8417-3205 primary 'Courbet, A.' 7 0000-0003-0539-7011 primary 'Bera, A.K.' 8 0000-0001-9473-2912 primary 'Nguyen, H.' 9 0000-0001-9696-4004 primary 'Kang, A.' 10 ? primary 'Carter, L.' 11 ? primary 'Baker, D.' 12 0000-0001-7896-6217 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8FJG _cell.details ? _cell.formula_units_Z ? _cell.length_a 30.456 _cell.length_a_esd ? _cell.length_b 46.595 _cell.length_b_esd ? _cell.length_c 73.458 _cell.length_c_esd ? _cell.volume 104244.051 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8FJG _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man H12 12844.756 1 ? ? ? ? 2 water nat water 18.015 5 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SGDIEKYFEEAKKKIDEEFEKLQTDPSVTLEEFKEKLKKILEEAYEKLKEAGYKGIEKYFEKMEEKIKEEFEKLKKDPSV TLEDFKKKLKEILDEMLEAIKKSGISGSG ; _entity_poly.pdbx_seq_one_letter_code_can ;SGDIEKYFEEAKKKIDEEFEKLQTDPSVTLEEFKEKLKKILEEAYEKLKEAGYKGIEKYFEKMEEKIKEEFEKLKKDPSV TLEDFKKKLKEILDEMLEAIKKSGISGSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 ASP n 1 4 ILE n 1 5 GLU n 1 6 LYS n 1 7 TYR n 1 8 PHE n 1 9 GLU n 1 10 GLU n 1 11 ALA n 1 12 LYS n 1 13 LYS n 1 14 LYS n 1 15 ILE n 1 16 ASP n 1 17 GLU n 1 18 GLU n 1 19 PHE n 1 20 GLU n 1 21 LYS n 1 22 LEU n 1 23 GLN n 1 24 THR n 1 25 ASP n 1 26 PRO n 1 27 SER n 1 28 VAL n 1 29 THR n 1 30 LEU n 1 31 GLU n 1 32 GLU n 1 33 PHE n 1 34 LYS n 1 35 GLU n 1 36 LYS n 1 37 LEU n 1 38 LYS n 1 39 LYS n 1 40 ILE n 1 41 LEU n 1 42 GLU n 1 43 GLU n 1 44 ALA n 1 45 TYR n 1 46 GLU n 1 47 LYS n 1 48 LEU n 1 49 LYS n 1 50 GLU n 1 51 ALA n 1 52 GLY n 1 53 TYR n 1 54 LYS n 1 55 GLY n 1 56 ILE n 1 57 GLU n 1 58 LYS n 1 59 TYR n 1 60 PHE n 1 61 GLU n 1 62 LYS n 1 63 MET n 1 64 GLU n 1 65 GLU n 1 66 LYS n 1 67 ILE n 1 68 LYS n 1 69 GLU n 1 70 GLU n 1 71 PHE n 1 72 GLU n 1 73 LYS n 1 74 LEU n 1 75 LYS n 1 76 LYS n 1 77 ASP n 1 78 PRO n 1 79 SER n 1 80 VAL n 1 81 THR n 1 82 LEU n 1 83 GLU n 1 84 ASP n 1 85 PHE n 1 86 LYS n 1 87 LYS n 1 88 LYS n 1 89 LEU n 1 90 LYS n 1 91 GLU n 1 92 ILE n 1 93 LEU n 1 94 ASP n 1 95 GLU n 1 96 MET n 1 97 LEU n 1 98 GLU n 1 99 ALA n 1 100 ILE n 1 101 LYS n 1 102 LYS n 1 103 SER n 1 104 GLY n 1 105 ILE n 1 106 SER n 1 107 GLY n 1 108 SER n 1 109 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 109 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8FJG _struct_ref.pdbx_db_accession 8FJG _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8FJG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 109 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8FJG _struct_ref_seq.db_align_beg -1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 107 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -1 _struct_ref_seq.pdbx_auth_seq_align_end 107 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8FJG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.03 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.38 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.09 M sodium fluoride, 0.09 M sodium bromide, 0.09 sodium iodide, 0.0499 M HEPES, 0.0501 M MOPS (acid), 12.5% v/v MPD, 12.5% PEG 1000, and 12.5% w/v PEG 3350 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-03-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98197 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98197 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 58.99 _reflns.entry_id 8FJG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.13 _reflns.d_resolution_low 25.49 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11009 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.26 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.03 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.0512 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.992 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.167 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.13 _reflns_shell.d_res_low 2.21 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.92 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 546 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.051 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.992 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.167 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 68.98 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8FJG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.13 _refine.ls_d_res_low 25.49 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11009 _refine.ls_number_reflns_R_free 572 _refine.ls_number_reflns_R_work 10437 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.24 _refine.ls_percent_reflns_R_free 5.20 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2589 _refine.ls_R_factor_R_free 0.2799 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2577 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 40.7819 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3471 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.13 _refine_hist.d_res_low 25.49 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 883 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 878 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0076 ? 889 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9038 ? 1175 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0513 ? 124 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0039 ? 147 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.3566 ? 372 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.13 2.35 . . 144 2469 93.42 . . . . 0.3850 . . . . . . . . . . . 0.3903 'X-RAY DIFFRACTION' 2.35 2.69 . . 144 2633 99.89 . . . . 0.2683 . . . . . . . . . . . 0.3779 'X-RAY DIFFRACTION' 2.69 3.39 . . 132 2692 99.86 . . . . 0.3454 . . . . . . . . . . . 0.3284 'X-RAY DIFFRACTION' 3.39 25.49 . . 152 2643 99.79 . . . . 0.2184 . . . . . . . . . . . 0.2500 # _struct.entry_id 8FJG _struct.title 'The two-repeat design H12' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8FJG _struct_keywords.text 'De novo protein, Hallucination, repeat proteins, central pockets, pseudocyclic proteins' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 3 ? ASP A 25 ? ASP A 1 ASP A 23 1 ? 23 HELX_P HELX_P2 AA2 THR A 29 ? ALA A 51 ? THR A 27 ALA A 49 1 ? 23 HELX_P HELX_P3 AA3 ILE A 56 ? ASP A 77 ? ILE A 54 ASP A 75 1 ? 22 HELX_P HELX_P4 AA4 THR A 81 ? SER A 103 ? THR A 79 SER A 101 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 8FJG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.032834 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021462 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013613 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -1 ? ? ? A . n A 1 2 GLY 2 0 ? ? ? A . n A 1 3 ASP 3 1 1 ASP ASP A . n A 1 4 ILE 4 2 2 ILE ILE A . n A 1 5 GLU 5 3 3 GLU GLU A . n A 1 6 LYS 6 4 4 LYS LYS A . n A 1 7 TYR 7 5 5 TYR TYR A . n A 1 8 PHE 8 6 6 PHE PHE A . n A 1 9 GLU 9 7 7 GLU GLU A . n A 1 10 GLU 10 8 8 GLU GLU A . n A 1 11 ALA 11 9 9 ALA ALA A . n A 1 12 LYS 12 10 10 LYS LYS A . n A 1 13 LYS 13 11 11 LYS LYS A . n A 1 14 LYS 14 12 12 LYS LYS A . n A 1 15 ILE 15 13 13 ILE ILE A . n A 1 16 ASP 16 14 14 ASP ASP A . n A 1 17 GLU 17 15 15 GLU GLU A . n A 1 18 GLU 18 16 16 GLU GLU A . n A 1 19 PHE 19 17 17 PHE PHE A . n A 1 20 GLU 20 18 18 GLU GLU A . n A 1 21 LYS 21 19 19 LYS LYS A . n A 1 22 LEU 22 20 20 LEU LEU A . n A 1 23 GLN 23 21 21 GLN GLN A . n A 1 24 THR 24 22 22 THR THR A . n A 1 25 ASP 25 23 23 ASP ASP A . n A 1 26 PRO 26 24 24 PRO PRO A . n A 1 27 SER 27 25 25 SER SER A . n A 1 28 VAL 28 26 26 VAL VAL A . n A 1 29 THR 29 27 27 THR THR A . n A 1 30 LEU 30 28 28 LEU LEU A . n A 1 31 GLU 31 29 29 GLU GLU A . n A 1 32 GLU 32 30 30 GLU GLU A . n A 1 33 PHE 33 31 31 PHE PHE A . n A 1 34 LYS 34 32 32 LYS LYS A . n A 1 35 GLU 35 33 33 GLU GLU A . n A 1 36 LYS 36 34 34 LYS LYS A . n A 1 37 LEU 37 35 35 LEU LEU A . n A 1 38 LYS 38 36 36 LYS LYS A . n A 1 39 LYS 39 37 37 LYS LYS A . n A 1 40 ILE 40 38 38 ILE ILE A . n A 1 41 LEU 41 39 39 LEU LEU A . n A 1 42 GLU 42 40 40 GLU GLU A . n A 1 43 GLU 43 41 41 GLU GLU A . n A 1 44 ALA 44 42 42 ALA ALA A . n A 1 45 TYR 45 43 43 TYR TYR A . n A 1 46 GLU 46 44 44 GLU GLU A . n A 1 47 LYS 47 45 45 LYS LYS A . n A 1 48 LEU 48 46 46 LEU LEU A . n A 1 49 LYS 49 47 47 LYS LYS A . n A 1 50 GLU 50 48 48 GLU GLU A . n A 1 51 ALA 51 49 49 ALA ALA A . n A 1 52 GLY 52 50 50 GLY GLY A . n A 1 53 TYR 53 51 51 TYR TYR A . n A 1 54 LYS 54 52 52 LYS LYS A . n A 1 55 GLY 55 53 53 GLY GLY A . n A 1 56 ILE 56 54 54 ILE ILE A . n A 1 57 GLU 57 55 55 GLU GLU A . n A 1 58 LYS 58 56 56 LYS LYS A . n A 1 59 TYR 59 57 57 TYR TYR A . n A 1 60 PHE 60 58 58 PHE PHE A . n A 1 61 GLU 61 59 59 GLU GLU A . n A 1 62 LYS 62 60 60 LYS LYS A . n A 1 63 MET 63 61 61 MET MET A . n A 1 64 GLU 64 62 62 GLU GLU A . n A 1 65 GLU 65 63 63 GLU GLU A . n A 1 66 LYS 66 64 64 LYS LYS A . n A 1 67 ILE 67 65 65 ILE ILE A . n A 1 68 LYS 68 66 66 LYS LYS A . n A 1 69 GLU 69 67 67 GLU GLU A . n A 1 70 GLU 70 68 68 GLU GLU A . n A 1 71 PHE 71 69 69 PHE PHE A . n A 1 72 GLU 72 70 70 GLU GLU A . n A 1 73 LYS 73 71 71 LYS LYS A . n A 1 74 LEU 74 72 72 LEU LEU A . n A 1 75 LYS 75 73 73 LYS LYS A . n A 1 76 LYS 76 74 74 LYS LYS A . n A 1 77 ASP 77 75 75 ASP ASP A . n A 1 78 PRO 78 76 76 PRO PRO A . n A 1 79 SER 79 77 77 SER SER A . n A 1 80 VAL 80 78 78 VAL VAL A . n A 1 81 THR 81 79 79 THR THR A . n A 1 82 LEU 82 80 80 LEU LEU A . n A 1 83 GLU 83 81 81 GLU GLU A . n A 1 84 ASP 84 82 82 ASP ASP A . n A 1 85 PHE 85 83 83 PHE PHE A . n A 1 86 LYS 86 84 84 LYS LYS A . n A 1 87 LYS 87 85 85 LYS LYS A . n A 1 88 LYS 88 86 86 LYS LYS A . n A 1 89 LEU 89 87 87 LEU LEU A . n A 1 90 LYS 90 88 88 LYS LYS A . n A 1 91 GLU 91 89 89 GLU GLU A . n A 1 92 ILE 92 90 90 ILE ILE A . n A 1 93 LEU 93 91 91 LEU LEU A . n A 1 94 ASP 94 92 92 ASP ASP A . n A 1 95 GLU 95 93 93 GLU GLU A . n A 1 96 MET 96 94 94 MET MET A . n A 1 97 LEU 97 95 95 LEU LEU A . n A 1 98 GLU 98 96 96 GLU GLU A . n A 1 99 ALA 99 97 97 ALA ALA A . n A 1 100 ILE 100 98 98 ILE ILE A . n A 1 101 LYS 101 99 99 LYS LYS A . n A 1 102 LYS 102 100 100 LYS LYS A . n A 1 103 SER 103 101 101 SER SER A . n A 1 104 GLY 104 102 102 GLY GLY A . n A 1 105 ILE 105 103 103 ILE ILE A . n A 1 106 SER 106 104 104 SER SER A . n A 1 107 GLY 107 105 ? ? ? A . n A 1 108 SER 108 106 ? ? ? A . n A 1 109 GLY 109 107 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email dabaker@uw.edu _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Baker _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7896-6217 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 5 HOH HOH A . B 2 HOH 2 202 1 HOH HOH A . B 2 HOH 3 203 2 HOH HOH A . B 2 HOH 4 204 4 HOH HOH A . B 2 HOH 5 205 3 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-09-27 2 'Structure model' 1 1 2023-10-04 3 'Structure model' 1 2 2023-10-11 4 'Structure model' 1 3 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' struct 4 3 'Structure model' citation 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' citation 7 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.year' 7 2 'Structure model' '_struct.title' 8 3 'Structure model' '_citation.pdbx_database_id_PubMed' 9 3 'Structure model' '_citation.title' 10 3 'Structure model' '_pdbx_initial_refinement_model.type' 11 4 'Structure model' '_citation.journal_volume' 12 4 'Structure model' '_citation.page_first' 13 4 'Structure model' '_citation.page_last' 14 4 'Structure model' '_citation_author.identifier_ORCID' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.1_4122 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -1 ? A SER 1 2 1 Y 1 A GLY 0 ? A GLY 2 3 1 Y 1 A GLY 105 ? A GLY 107 4 1 Y 1 A SER 106 ? A SER 108 5 1 Y 1 A GLY 107 ? A GLY 109 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASP N N N N 14 ASP CA C N S 15 ASP C C N N 16 ASP O O N N 17 ASP CB C N N 18 ASP CG C N N 19 ASP OD1 O N N 20 ASP OD2 O N N 21 ASP OXT O N N 22 ASP H H N N 23 ASP H2 H N N 24 ASP HA H N N 25 ASP HB2 H N N 26 ASP HB3 H N N 27 ASP HD2 H N N 28 ASP HXT H N N 29 GLN N N N N 30 GLN CA C N S 31 GLN C C N N 32 GLN O O N N 33 GLN CB C N N 34 GLN CG C N N 35 GLN CD C N N 36 GLN OE1 O N N 37 GLN NE2 N N N 38 GLN OXT O N N 39 GLN H H N N 40 GLN H2 H N N 41 GLN HA H N N 42 GLN HB2 H N N 43 GLN HB3 H N N 44 GLN HG2 H N N 45 GLN HG3 H N N 46 GLN HE21 H N N 47 GLN HE22 H N N 48 GLN HXT H N N 49 GLU N N N N 50 GLU CA C N S 51 GLU C C N N 52 GLU O O N N 53 GLU CB C N N 54 GLU CG C N N 55 GLU CD C N N 56 GLU OE1 O N N 57 GLU OE2 O N N 58 GLU OXT O N N 59 GLU H H N N 60 GLU H2 H N N 61 GLU HA H N N 62 GLU HB2 H N N 63 GLU HB3 H N N 64 GLU HG2 H N N 65 GLU HG3 H N N 66 GLU HE2 H N N 67 GLU HXT H N N 68 GLY N N N N 69 GLY CA C N N 70 GLY C C N N 71 GLY O O N N 72 GLY OXT O N N 73 GLY H H N N 74 GLY H2 H N N 75 GLY HA2 H N N 76 GLY HA3 H N N 77 GLY HXT H N N 78 HOH O O N N 79 HOH H1 H N N 80 HOH H2 H N N 81 ILE N N N N 82 ILE CA C N S 83 ILE C C N N 84 ILE O O N N 85 ILE CB C N S 86 ILE CG1 C N N 87 ILE CG2 C N N 88 ILE CD1 C N N 89 ILE OXT O N N 90 ILE H H N N 91 ILE H2 H N N 92 ILE HA H N N 93 ILE HB H N N 94 ILE HG12 H N N 95 ILE HG13 H N N 96 ILE HG21 H N N 97 ILE HG22 H N N 98 ILE HG23 H N N 99 ILE HD11 H N N 100 ILE HD12 H N N 101 ILE HD13 H N N 102 ILE HXT H N N 103 LEU N N N N 104 LEU CA C N S 105 LEU C C N N 106 LEU O O N N 107 LEU CB C N N 108 LEU CG C N N 109 LEU CD1 C N N 110 LEU CD2 C N N 111 LEU OXT O N N 112 LEU H H N N 113 LEU H2 H N N 114 LEU HA H N N 115 LEU HB2 H N N 116 LEU HB3 H N N 117 LEU HG H N N 118 LEU HD11 H N N 119 LEU HD12 H N N 120 LEU HD13 H N N 121 LEU HD21 H N N 122 LEU HD22 H N N 123 LEU HD23 H N N 124 LEU HXT H N N 125 LYS N N N N 126 LYS CA C N S 127 LYS C C N N 128 LYS O O N N 129 LYS CB C N N 130 LYS CG C N N 131 LYS CD C N N 132 LYS CE C N N 133 LYS NZ N N N 134 LYS OXT O N N 135 LYS H H N N 136 LYS H2 H N N 137 LYS HA H N N 138 LYS HB2 H N N 139 LYS HB3 H N N 140 LYS HG2 H N N 141 LYS HG3 H N N 142 LYS HD2 H N N 143 LYS HD3 H N N 144 LYS HE2 H N N 145 LYS HE3 H N N 146 LYS HZ1 H N N 147 LYS HZ2 H N N 148 LYS HZ3 H N N 149 LYS HXT H N N 150 MET N N N N 151 MET CA C N S 152 MET C C N N 153 MET O O N N 154 MET CB C N N 155 MET CG C N N 156 MET SD S N N 157 MET CE C N N 158 MET OXT O N N 159 MET H H N N 160 MET H2 H N N 161 MET HA H N N 162 MET HB2 H N N 163 MET HB3 H N N 164 MET HG2 H N N 165 MET HG3 H N N 166 MET HE1 H N N 167 MET HE2 H N N 168 MET HE3 H N N 169 MET HXT H N N 170 PHE N N N N 171 PHE CA C N S 172 PHE C C N N 173 PHE O O N N 174 PHE CB C N N 175 PHE CG C Y N 176 PHE CD1 C Y N 177 PHE CD2 C Y N 178 PHE CE1 C Y N 179 PHE CE2 C Y N 180 PHE CZ C Y N 181 PHE OXT O N N 182 PHE H H N N 183 PHE H2 H N N 184 PHE HA H N N 185 PHE HB2 H N N 186 PHE HB3 H N N 187 PHE HD1 H N N 188 PHE HD2 H N N 189 PHE HE1 H N N 190 PHE HE2 H N N 191 PHE HZ H N N 192 PHE HXT H N N 193 PRO N N N N 194 PRO CA C N S 195 PRO C C N N 196 PRO O O N N 197 PRO CB C N N 198 PRO CG C N N 199 PRO CD C N N 200 PRO OXT O N N 201 PRO H H N N 202 PRO HA H N N 203 PRO HB2 H N N 204 PRO HB3 H N N 205 PRO HG2 H N N 206 PRO HG3 H N N 207 PRO HD2 H N N 208 PRO HD3 H N N 209 PRO HXT H N N 210 SER N N N N 211 SER CA C N S 212 SER C C N N 213 SER O O N N 214 SER CB C N N 215 SER OG O N N 216 SER OXT O N N 217 SER H H N N 218 SER H2 H N N 219 SER HA H N N 220 SER HB2 H N N 221 SER HB3 H N N 222 SER HG H N N 223 SER HXT H N N 224 THR N N N N 225 THR CA C N S 226 THR C C N N 227 THR O O N N 228 THR CB C N R 229 THR OG1 O N N 230 THR CG2 C N N 231 THR OXT O N N 232 THR H H N N 233 THR H2 H N N 234 THR HA H N N 235 THR HB H N N 236 THR HG1 H N N 237 THR HG21 H N N 238 THR HG22 H N N 239 THR HG23 H N N 240 THR HXT H N N 241 TYR N N N N 242 TYR CA C N S 243 TYR C C N N 244 TYR O O N N 245 TYR CB C N N 246 TYR CG C Y N 247 TYR CD1 C Y N 248 TYR CD2 C Y N 249 TYR CE1 C Y N 250 TYR CE2 C Y N 251 TYR CZ C Y N 252 TYR OH O N N 253 TYR OXT O N N 254 TYR H H N N 255 TYR H2 H N N 256 TYR HA H N N 257 TYR HB2 H N N 258 TYR HB3 H N N 259 TYR HD1 H N N 260 TYR HD2 H N N 261 TYR HE1 H N N 262 TYR HE2 H N N 263 TYR HH H N N 264 TYR HXT H N N 265 VAL N N N N 266 VAL CA C N S 267 VAL C C N N 268 VAL O O N N 269 VAL CB C N N 270 VAL CG1 C N N 271 VAL CG2 C N N 272 VAL OXT O N N 273 VAL H H N N 274 VAL H2 H N N 275 VAL HA H N N 276 VAL HB H N N 277 VAL HG11 H N N 278 VAL HG12 H N N 279 VAL HG13 H N N 280 VAL HG21 H N N 281 VAL HG22 H N N 282 VAL HG23 H N N 283 VAL HXT H N N 284 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASP N CA sing N N 13 ASP N H sing N N 14 ASP N H2 sing N N 15 ASP CA C sing N N 16 ASP CA CB sing N N 17 ASP CA HA sing N N 18 ASP C O doub N N 19 ASP C OXT sing N N 20 ASP CB CG sing N N 21 ASP CB HB2 sing N N 22 ASP CB HB3 sing N N 23 ASP CG OD1 doub N N 24 ASP CG OD2 sing N N 25 ASP OD2 HD2 sing N N 26 ASP OXT HXT sing N N 27 GLN N CA sing N N 28 GLN N H sing N N 29 GLN N H2 sing N N 30 GLN CA C sing N N 31 GLN CA CB sing N N 32 GLN CA HA sing N N 33 GLN C O doub N N 34 GLN C OXT sing N N 35 GLN CB CG sing N N 36 GLN CB HB2 sing N N 37 GLN CB HB3 sing N N 38 GLN CG CD sing N N 39 GLN CG HG2 sing N N 40 GLN CG HG3 sing N N 41 GLN CD OE1 doub N N 42 GLN CD NE2 sing N N 43 GLN NE2 HE21 sing N N 44 GLN NE2 HE22 sing N N 45 GLN OXT HXT sing N N 46 GLU N CA sing N N 47 GLU N H sing N N 48 GLU N H2 sing N N 49 GLU CA C sing N N 50 GLU CA CB sing N N 51 GLU CA HA sing N N 52 GLU C O doub N N 53 GLU C OXT sing N N 54 GLU CB CG sing N N 55 GLU CB HB2 sing N N 56 GLU CB HB3 sing N N 57 GLU CG CD sing N N 58 GLU CG HG2 sing N N 59 GLU CG HG3 sing N N 60 GLU CD OE1 doub N N 61 GLU CD OE2 sing N N 62 GLU OE2 HE2 sing N N 63 GLU OXT HXT sing N N 64 GLY N CA sing N N 65 GLY N H sing N N 66 GLY N H2 sing N N 67 GLY CA C sing N N 68 GLY CA HA2 sing N N 69 GLY CA HA3 sing N N 70 GLY C O doub N N 71 GLY C OXT sing N N 72 GLY OXT HXT sing N N 73 HOH O H1 sing N N 74 HOH O H2 sing N N 75 ILE N CA sing N N 76 ILE N H sing N N 77 ILE N H2 sing N N 78 ILE CA C sing N N 79 ILE CA CB sing N N 80 ILE CA HA sing N N 81 ILE C O doub N N 82 ILE C OXT sing N N 83 ILE CB CG1 sing N N 84 ILE CB CG2 sing N N 85 ILE CB HB sing N N 86 ILE CG1 CD1 sing N N 87 ILE CG1 HG12 sing N N 88 ILE CG1 HG13 sing N N 89 ILE CG2 HG21 sing N N 90 ILE CG2 HG22 sing N N 91 ILE CG2 HG23 sing N N 92 ILE CD1 HD11 sing N N 93 ILE CD1 HD12 sing N N 94 ILE CD1 HD13 sing N N 95 ILE OXT HXT sing N N 96 LEU N CA sing N N 97 LEU N H sing N N 98 LEU N H2 sing N N 99 LEU CA C sing N N 100 LEU CA CB sing N N 101 LEU CA HA sing N N 102 LEU C O doub N N 103 LEU C OXT sing N N 104 LEU CB CG sing N N 105 LEU CB HB2 sing N N 106 LEU CB HB3 sing N N 107 LEU CG CD1 sing N N 108 LEU CG CD2 sing N N 109 LEU CG HG sing N N 110 LEU CD1 HD11 sing N N 111 LEU CD1 HD12 sing N N 112 LEU CD1 HD13 sing N N 113 LEU CD2 HD21 sing N N 114 LEU CD2 HD22 sing N N 115 LEU CD2 HD23 sing N N 116 LEU OXT HXT sing N N 117 LYS N CA sing N N 118 LYS N H sing N N 119 LYS N H2 sing N N 120 LYS CA C sing N N 121 LYS CA CB sing N N 122 LYS CA HA sing N N 123 LYS C O doub N N 124 LYS C OXT sing N N 125 LYS CB CG sing N N 126 LYS CB HB2 sing N N 127 LYS CB HB3 sing N N 128 LYS CG CD sing N N 129 LYS CG HG2 sing N N 130 LYS CG HG3 sing N N 131 LYS CD CE sing N N 132 LYS CD HD2 sing N N 133 LYS CD HD3 sing N N 134 LYS CE NZ sing N N 135 LYS CE HE2 sing N N 136 LYS CE HE3 sing N N 137 LYS NZ HZ1 sing N N 138 LYS NZ HZ2 sing N N 139 LYS NZ HZ3 sing N N 140 LYS OXT HXT sing N N 141 MET N CA sing N N 142 MET N H sing N N 143 MET N H2 sing N N 144 MET CA C sing N N 145 MET CA CB sing N N 146 MET CA HA sing N N 147 MET C O doub N N 148 MET C OXT sing N N 149 MET CB CG sing N N 150 MET CB HB2 sing N N 151 MET CB HB3 sing N N 152 MET CG SD sing N N 153 MET CG HG2 sing N N 154 MET CG HG3 sing N N 155 MET SD CE sing N N 156 MET CE HE1 sing N N 157 MET CE HE2 sing N N 158 MET CE HE3 sing N N 159 MET OXT HXT sing N N 160 PHE N CA sing N N 161 PHE N H sing N N 162 PHE N H2 sing N N 163 PHE CA C sing N N 164 PHE CA CB sing N N 165 PHE CA HA sing N N 166 PHE C O doub N N 167 PHE C OXT sing N N 168 PHE CB CG sing N N 169 PHE CB HB2 sing N N 170 PHE CB HB3 sing N N 171 PHE CG CD1 doub Y N 172 PHE CG CD2 sing Y N 173 PHE CD1 CE1 sing Y N 174 PHE CD1 HD1 sing N N 175 PHE CD2 CE2 doub Y N 176 PHE CD2 HD2 sing N N 177 PHE CE1 CZ doub Y N 178 PHE CE1 HE1 sing N N 179 PHE CE2 CZ sing Y N 180 PHE CE2 HE2 sing N N 181 PHE CZ HZ sing N N 182 PHE OXT HXT sing N N 183 PRO N CA sing N N 184 PRO N CD sing N N 185 PRO N H sing N N 186 PRO CA C sing N N 187 PRO CA CB sing N N 188 PRO CA HA sing N N 189 PRO C O doub N N 190 PRO C OXT sing N N 191 PRO CB CG sing N N 192 PRO CB HB2 sing N N 193 PRO CB HB3 sing N N 194 PRO CG CD sing N N 195 PRO CG HG2 sing N N 196 PRO CG HG3 sing N N 197 PRO CD HD2 sing N N 198 PRO CD HD3 sing N N 199 PRO OXT HXT sing N N 200 SER N CA sing N N 201 SER N H sing N N 202 SER N H2 sing N N 203 SER CA C sing N N 204 SER CA CB sing N N 205 SER CA HA sing N N 206 SER C O doub N N 207 SER C OXT sing N N 208 SER CB OG sing N N 209 SER CB HB2 sing N N 210 SER CB HB3 sing N N 211 SER OG HG sing N N 212 SER OXT HXT sing N N 213 THR N CA sing N N 214 THR N H sing N N 215 THR N H2 sing N N 216 THR CA C sing N N 217 THR CA CB sing N N 218 THR CA HA sing N N 219 THR C O doub N N 220 THR C OXT sing N N 221 THR CB OG1 sing N N 222 THR CB CG2 sing N N 223 THR CB HB sing N N 224 THR OG1 HG1 sing N N 225 THR CG2 HG21 sing N N 226 THR CG2 HG22 sing N N 227 THR CG2 HG23 sing N N 228 THR OXT HXT sing N N 229 TYR N CA sing N N 230 TYR N H sing N N 231 TYR N H2 sing N N 232 TYR CA C sing N N 233 TYR CA CB sing N N 234 TYR CA HA sing N N 235 TYR C O doub N N 236 TYR C OXT sing N N 237 TYR CB CG sing N N 238 TYR CB HB2 sing N N 239 TYR CB HB3 sing N N 240 TYR CG CD1 doub Y N 241 TYR CG CD2 sing Y N 242 TYR CD1 CE1 sing Y N 243 TYR CD1 HD1 sing N N 244 TYR CD2 CE2 doub Y N 245 TYR CD2 HD2 sing N N 246 TYR CE1 CZ doub Y N 247 TYR CE1 HE1 sing N N 248 TYR CE2 CZ sing Y N 249 TYR CE2 HE2 sing N N 250 TYR CZ OH sing N N 251 TYR OH HH sing N N 252 TYR OXT HXT sing N N 253 VAL N CA sing N N 254 VAL N H sing N N 255 VAL N H2 sing N N 256 VAL CA C sing N N 257 VAL CA CB sing N N 258 VAL CA HA sing N N 259 VAL C O doub N N 260 VAL C OXT sing N N 261 VAL CB CG1 sing N N 262 VAL CB CG2 sing N N 263 VAL CB HB sing N N 264 VAL CG1 HG11 sing N N 265 VAL CG1 HG12 sing N N 266 VAL CG1 HG13 sing N N 267 VAL CG2 HG21 sing N N 268 VAL CG2 HG22 sing N N 269 VAL CG2 HG23 sing N N 270 VAL OXT HXT sing N N 271 # _pdbx_audit_support.funding_organization 'Howard Hughes Medical Institute (HHMI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'In-House de novo designed model' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 #