data_8FOL # _entry.id 8FOL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8FOL pdb_00008fol 10.2210/pdb8fol/pdb WWPDB D_1000271101 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'alternate crystal form' _pdbx_database_related.db_id 8FO0 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8FOL _pdbx_database_status.recvd_initial_deposition_date 2022-12-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Moody, J.D.' 1 0000-0003-2266-5348 'Saxton, A.J.' 2 0000-0002-9466-7900 'Galambas, A.' 3 ? 'Lawrence, C.M.' 4 0000-0002-5398-466X 'Broderick, J.B.' 5 0000-0001-7057-9124 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 299 _citation.language ? _citation.page_first 104791 _citation.page_last 104791 _citation.title ;Computational engineering of previously crystallized pyruvate formate-lyase activating enzyme reveals insights into SAM binding and reductive cleavage. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jbc.2023.104791 _citation.pdbx_database_id_PubMed 37156396 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Moody, J.D.' 1 ? primary 'Hill, S.' 2 ? primary 'Lundahl, M.N.' 3 ? primary 'Saxton, A.J.' 4 ? primary 'Galambas, A.' 5 ? primary 'Broderick, W.E.' 6 ? primary 'Lawrence, C.M.' 7 ? primary 'Broderick, J.B.' 8 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8FOL _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.653 _cell.length_a_esd ? _cell.length_b 59.011 _cell.length_b_esd ? _cell.length_c 96.792 _cell.length_c_esd ? _cell.volume 283607.644 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8FOL _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Pyruvate formate-lyase 1-activating enzyme' 28237.273 1 1.97.1.4 'S1E, E53K, A93E, R111H, Q139K, E151R, K154Q, N158E, K222E, K225R, K226A, E230R' ? ? 2 non-polymer syn 'IRON/SULFUR CLUSTER' 351.640 1 ? ? ? ? 3 non-polymer syn S-ADENOSYLMETHIONINE 398.437 1 ? ? ? ? 4 non-polymer syn 'POTASSIUM ION' 39.098 1 ? ? ? ? 5 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? 6 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Formate-C-acetyltransferase-activating enzyme 1,PFL-activating enzyme 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVKDLMKEVVTYRHFMNASGGGVTASGGEA ILQAEFVRDWFRECKKEGIHTCLDTNGFVRHYDPVIDELLEVTDLVMLDLKQMNDEIHKNLVGVSNHRTLRFAQYLAEKN VKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVEPPRAETMRRVKGILEQYG HKVMF ; _entity_poly.pdbx_seq_one_letter_code_can ;EVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVKDLMKEVVTYRHFMNASGGGVTASGGEA ILQAEFVRDWFRECKKEGIHTCLDTNGFVRHYDPVIDELLEVTDLVMLDLKQMNDEIHKNLVGVSNHRTLRFAQYLAEKN VKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVEPPRAETMRRVKGILEQYG HKVMF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 VAL n 1 3 ILE n 1 4 GLY n 1 5 ARG n 1 6 ILE n 1 7 HIS n 1 8 SER n 1 9 PHE n 1 10 GLU n 1 11 SER n 1 12 CYS n 1 13 GLY n 1 14 THR n 1 15 VAL n 1 16 ASP n 1 17 GLY n 1 18 PRO n 1 19 GLY n 1 20 ILE n 1 21 ARG n 1 22 PHE n 1 23 ILE n 1 24 THR n 1 25 PHE n 1 26 PHE n 1 27 GLN n 1 28 GLY n 1 29 CYS n 1 30 LEU n 1 31 MET n 1 32 ARG n 1 33 CYS n 1 34 LEU n 1 35 TYR n 1 36 CYS n 1 37 HIS n 1 38 ASN n 1 39 ARG n 1 40 ASP n 1 41 THR n 1 42 TRP n 1 43 ASP n 1 44 THR n 1 45 HIS n 1 46 GLY n 1 47 GLY n 1 48 LYS n 1 49 GLU n 1 50 VAL n 1 51 THR n 1 52 VAL n 1 53 LYS n 1 54 ASP n 1 55 LEU n 1 56 MET n 1 57 LYS n 1 58 GLU n 1 59 VAL n 1 60 VAL n 1 61 THR n 1 62 TYR n 1 63 ARG n 1 64 HIS n 1 65 PHE n 1 66 MET n 1 67 ASN n 1 68 ALA n 1 69 SER n 1 70 GLY n 1 71 GLY n 1 72 GLY n 1 73 VAL n 1 74 THR n 1 75 ALA n 1 76 SER n 1 77 GLY n 1 78 GLY n 1 79 GLU n 1 80 ALA n 1 81 ILE n 1 82 LEU n 1 83 GLN n 1 84 ALA n 1 85 GLU n 1 86 PHE n 1 87 VAL n 1 88 ARG n 1 89 ASP n 1 90 TRP n 1 91 PHE n 1 92 ARG n 1 93 GLU n 1 94 CYS n 1 95 LYS n 1 96 LYS n 1 97 GLU n 1 98 GLY n 1 99 ILE n 1 100 HIS n 1 101 THR n 1 102 CYS n 1 103 LEU n 1 104 ASP n 1 105 THR n 1 106 ASN n 1 107 GLY n 1 108 PHE n 1 109 VAL n 1 110 ARG n 1 111 HIS n 1 112 TYR n 1 113 ASP n 1 114 PRO n 1 115 VAL n 1 116 ILE n 1 117 ASP n 1 118 GLU n 1 119 LEU n 1 120 LEU n 1 121 GLU n 1 122 VAL n 1 123 THR n 1 124 ASP n 1 125 LEU n 1 126 VAL n 1 127 MET n 1 128 LEU n 1 129 ASP n 1 130 LEU n 1 131 LYS n 1 132 GLN n 1 133 MET n 1 134 ASN n 1 135 ASP n 1 136 GLU n 1 137 ILE n 1 138 HIS n 1 139 LYS n 1 140 ASN n 1 141 LEU n 1 142 VAL n 1 143 GLY n 1 144 VAL n 1 145 SER n 1 146 ASN n 1 147 HIS n 1 148 ARG n 1 149 THR n 1 150 LEU n 1 151 ARG n 1 152 PHE n 1 153 ALA n 1 154 GLN n 1 155 TYR n 1 156 LEU n 1 157 ALA n 1 158 GLU n 1 159 LYS n 1 160 ASN n 1 161 VAL n 1 162 LYS n 1 163 VAL n 1 164 TRP n 1 165 ILE n 1 166 ARG n 1 167 TYR n 1 168 VAL n 1 169 VAL n 1 170 VAL n 1 171 PRO n 1 172 GLY n 1 173 TRP n 1 174 SER n 1 175 ASP n 1 176 ASP n 1 177 ASP n 1 178 ASP n 1 179 SER n 1 180 ALA n 1 181 HIS n 1 182 ARG n 1 183 LEU n 1 184 GLY n 1 185 GLU n 1 186 PHE n 1 187 THR n 1 188 ARG n 1 189 ASP n 1 190 MET n 1 191 GLY n 1 192 ASN n 1 193 VAL n 1 194 GLU n 1 195 LYS n 1 196 ILE n 1 197 GLU n 1 198 LEU n 1 199 LEU n 1 200 PRO n 1 201 TYR n 1 202 HIS n 1 203 GLU n 1 204 LEU n 1 205 GLY n 1 206 LYS n 1 207 HIS n 1 208 LYS n 1 209 TRP n 1 210 VAL n 1 211 ALA n 1 212 MET n 1 213 GLY n 1 214 GLU n 1 215 GLU n 1 216 TYR n 1 217 LYS n 1 218 LEU n 1 219 ASP n 1 220 GLY n 1 221 VAL n 1 222 GLU n 1 223 PRO n 1 224 PRO n 1 225 ARG n 1 226 ALA n 1 227 GLU n 1 228 THR n 1 229 MET n 1 230 ARG n 1 231 ARG n 1 232 VAL n 1 233 LYS n 1 234 GLY n 1 235 ILE n 1 236 LEU n 1 237 GLU n 1 238 GLN n 1 239 TYR n 1 240 GLY n 1 241 HIS n 1 242 LYS n 1 243 VAL n 1 244 MET n 1 245 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 245 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pflA, act, b0902, JW0885' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli B' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 37762 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'BL21(DE3)RIL' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details Kanamycin-resistant _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET42_SUMO _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PFLA_ECOLI _struct_ref.pdbx_db_accession P0A9N4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEDLMKEVVTYRHFMNASGGGVTASGGEA ILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANKN VKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETMERVKGILEQYG HKVMF ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8FOL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 245 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A9N4 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 246 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 245 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8FOL GLU A 1 ? UNP P0A9N4 SER 2 'engineered mutation' 1 1 1 8FOL LYS A 53 ? UNP P0A9N4 GLU 54 'engineered mutation' 53 2 1 8FOL GLU A 93 ? UNP P0A9N4 ALA 94 'engineered mutation' 93 3 1 8FOL HIS A 111 ? UNP P0A9N4 ARG 112 'engineered mutation' 111 4 1 8FOL LYS A 139 ? UNP P0A9N4 GLN 140 'engineered mutation' 139 5 1 8FOL ARG A 151 ? UNP P0A9N4 GLU 152 'engineered mutation' 151 6 1 8FOL GLN A 154 ? UNP P0A9N4 LYS 155 'engineered mutation' 154 7 1 8FOL GLU A 158 ? UNP P0A9N4 ASN 159 'engineered mutation' 158 8 1 8FOL GLU A 222 ? UNP P0A9N4 LYS 223 'engineered mutation' 222 9 1 8FOL ARG A 225 ? UNP P0A9N4 LYS 226 'engineered mutation' 225 10 1 8FOL ALA A 226 ? UNP P0A9N4 LYS 227 'engineered mutation' 226 11 1 8FOL ARG A 230 ? UNP P0A9N4 GLU 231 'engineered mutation' 230 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SAM non-polymer . S-ADENOSYLMETHIONINE ? 'C15 H22 N6 O5 S' 398.437 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SF4 non-polymer . 'IRON/SULFUR CLUSTER' ? 'Fe4 S4' 351.640 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8FOL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.51 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.08 _exptl_crystal.description rod-like _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;4 uL of protein (10 mg/mL PFL-AE-CCR8 in 12.5 mM HEPES, 200 mM KCl, with 3.65 mM SAM, 1.2 mM WT 7-mer PFL peptide, 0.13% glycerol, and 1 mM DTT) were combined with 1 uL of crystallization reservoir solution (18% PEG 3350, 100 mM HEPES, pH 7.5) in hanging drop format over 50 uL of crystallization reservoir solution. ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 300 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-08-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.542 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.542 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 55.81 _reflns.entry_id 8FOL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.65 _reflns.d_resolution_low 35.37 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8650 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.67 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.26 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1417 _reflns.pdbx_Rpim_I_all 0.06559 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.1248 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.65 _reflns_shell.d_res_low 2.745 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.29 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 752 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.2 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.9537 _reflns_shell.pdbx_Rpim_I_all 0.4408 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.710 _reflns_shell.pdbx_CC_star 0.911 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 88.01 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.8407 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 54.70 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8FOL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.65 _refine.ls_d_res_low 35.37 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8516 _refine.ls_number_reflns_R_free 426 _refine.ls_number_reflns_R_work 8090 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.67 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1957 _refine.ls_R_factor_R_free 0.2142 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1947 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.0446 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3407 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.65 _refine_hist.d_res_low 35.37 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 2024 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1975 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0061 ? 2069 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7859 ? 2804 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0941 ? 296 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0031 ? 358 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.5804 ? 755 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.65 2.745 . . 136 2572 95.59 . . . . 0.2774 . . . . . . . . . . . 0.3047 'X-RAY DIFFRACTION' 3.03 3.82 . . 143 2721 99.34 . . . . 0.2103 . . . . . . . . . . . 0.2391 'X-RAY DIFFRACTION' 3.82 35.37 . . 147 2797 98.04 . . . . 0.1649 . . . . . . . . . . . 0.1767 # _struct.entry_id 8FOL _struct.title 'The structure of a crystallizable variant of E. coli pyruvate formate-lyase activating enzyme bound to SAM, alternate crystal form' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8FOL _struct_keywords.text 'radical SAM, activase, PFL, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? G N N 5 ? H N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 38 ? TRP A 42 ? ASN A 38 TRP A 42 5 ? 5 HELX_P HELX_P2 AA2 THR A 51 ? VAL A 60 ? THR A 51 VAL A 60 1 ? 10 HELX_P HELX_P3 AA3 TYR A 62 ? ASN A 67 ? TYR A 62 ASN A 67 1 ? 6 HELX_P HELX_P4 AA4 GLU A 79 ? LEU A 82 ? GLU A 79 LEU A 82 5 ? 4 HELX_P HELX_P5 AA5 GLN A 83 ? GLU A 97 ? GLN A 83 GLU A 97 1 ? 15 HELX_P HELX_P6 AA6 ASP A 113 ? VAL A 122 ? ASP A 113 VAL A 122 1 ? 10 HELX_P HELX_P7 AA7 ASN A 134 ? GLY A 143 ? ASN A 134 GLY A 143 1 ? 10 HELX_P HELX_P8 AA8 ASN A 146 ? LYS A 159 ? ASN A 146 LYS A 159 1 ? 14 HELX_P HELX_P9 AA9 ASP A 176 ? THR A 187 ? ASP A 176 THR A 187 1 ? 12 HELX_P HELX_P10 AB1 GLY A 205 ? MET A 212 ? GLY A 205 MET A 212 1 ? 8 HELX_P HELX_P11 AB2 ARG A 225 ? GLN A 238 ? ARG A 225 GLN A 238 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 29 SG ? ? ? 1_555 B SF4 . FE4 ? ? A CYS 29 A SF4 301 1_555 ? ? ? ? ? ? ? 2.286 ? ? metalc2 metalc ? ? A CYS 33 SG ? ? ? 1_555 B SF4 . FE1 ? ? A CYS 33 A SF4 301 1_555 ? ? ? ? ? ? ? 2.274 ? ? metalc3 metalc ? ? A CYS 36 SG ? ? ? 1_555 B SF4 . FE3 ? ? A CYS 36 A SF4 301 1_555 ? ? ? ? ? ? ? 2.275 ? ? metalc4 metalc ? ? A ASP 104 OD1 ? ? ? 1_555 D K . K ? ? A ASP 104 A K 303 1_555 ? ? ? ? ? ? ? 2.703 ? ? metalc5 metalc ? ? A THR 105 O ? ? ? 1_555 D K . K ? ? A THR 105 A K 303 1_555 ? ? ? ? ? ? ? 3.378 ? ? metalc6 metalc ? ? A MET 127 O ? ? ? 1_555 D K . K ? ? A MET 127 A K 303 1_555 ? ? ? ? ? ? ? 3.061 ? ? metalc7 metalc ? ? A ASP 129 OD1 ? ? ? 1_555 D K . K ? ? A ASP 129 A K 303 1_555 ? ? ? ? ? ? ? 2.789 ? ? metalc8 metalc ? ? B SF4 . FE2 ? ? ? 1_555 C SAM . N ? ? A SF4 301 A SAM 302 1_555 ? ? ? ? ? ? ? 2.625 ? ? metalc9 metalc ? ? B SF4 . FE2 ? ? ? 1_555 C SAM . O ? ? A SF4 301 A SAM 302 1_555 ? ? ? ? ? ? ? 2.321 ? ? metalc10 metalc ? ? C SAM . OXT ? ? ? 1_555 D K . K ? ? A SAM 302 A K 303 1_555 ? ? ? ? ? ? ? 2.898 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 77 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 77 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLY _struct_mon_prot_cis.pdbx_label_seq_id_2 78 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLY _struct_mon_prot_cis.pdbx_auth_seq_id_2 78 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.48 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 48 ? VAL A 50 ? LYS A 48 VAL A 50 AA1 2 GLY A 4 ? GLY A 13 ? GLY A 4 GLY A 13 AA1 3 ILE A 20 ? PHE A 26 ? ILE A 20 PHE A 26 AA1 4 GLY A 72 ? SER A 76 ? GLY A 72 SER A 76 AA1 5 THR A 101 ? THR A 105 ? THR A 101 THR A 105 AA1 6 LEU A 125 ? ASP A 129 ? LEU A 125 ASP A 129 AA1 7 VAL A 163 ? VAL A 169 ? VAL A 163 VAL A 169 AA1 8 VAL A 193 ? PRO A 200 ? VAL A 193 PRO A 200 AA1 9 VAL A 243 ? MET A 244 ? VAL A 243 MET A 244 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 50 ? O VAL A 50 N GLY A 4 ? N GLY A 4 AA1 2 3 N CYS A 12 ? N CYS A 12 O ARG A 21 ? O ARG A 21 AA1 3 4 N THR A 24 ? N THR A 24 O SER A 76 ? O SER A 76 AA1 4 5 N ALA A 75 ? N ALA A 75 O ASP A 104 ? O ASP A 104 AA1 5 6 N LEU A 103 ? N LEU A 103 O MET A 127 ? O MET A 127 AA1 6 7 N LEU A 128 ? N LEU A 128 O ARG A 166 ? O ARG A 166 AA1 7 8 N ILE A 165 ? N ILE A 165 O GLU A 197 ? O GLU A 197 AA1 8 9 N LEU A 198 ? N LEU A 198 O MET A 244 ? O MET A 244 # _atom_sites.entry_id 8FOL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020140 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016946 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010331 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? FE ? ? 20.90327 4.99816 ? ? 2.55100 38.46870 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? K ? ? 16.37977 2.54835 ? ? 4.54127 84.28225 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 CYS 94 94 94 CYS CYS A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 MET 127 127 127 MET MET A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 GLN 132 132 132 GLN GLN A . n A 1 133 MET 133 133 133 MET MET A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 HIS 138 138 138 HIS HIS A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 GLN 154 154 154 GLN GLN A . n A 1 155 TYR 155 155 155 TYR TYR A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 ASN 160 160 160 ASN ASN A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 TRP 164 164 164 TRP TRP A . n A 1 165 ILE 165 165 165 ILE ILE A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 PRO 171 171 171 PRO PRO A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 TRP 173 173 173 TRP TRP A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 ASP 178 178 178 ASP ASP A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 HIS 181 181 181 HIS HIS A . n A 1 182 ARG 182 182 182 ARG ARG A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 PHE 186 186 186 PHE PHE A . n A 1 187 THR 187 187 187 THR THR A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 ASP 189 189 189 ASP ASP A . n A 1 190 MET 190 190 190 MET MET A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 ASN 192 192 192 ASN ASN A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 TYR 201 201 201 TYR TYR A . n A 1 202 HIS 202 202 202 HIS HIS A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 GLY 205 205 205 GLY GLY A . n A 1 206 LYS 206 206 206 LYS LYS A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 TRP 209 209 209 TRP TRP A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 MET 212 212 212 MET MET A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 GLU 214 214 214 GLU GLU A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 TYR 216 216 216 TYR TYR A . n A 1 217 LYS 217 217 217 LYS LYS A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 ASP 219 219 219 ASP ASP A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 GLU 222 222 222 GLU GLU A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 PRO 224 224 224 PRO PRO A . n A 1 225 ARG 225 225 225 ARG ARG A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 GLU 227 227 227 GLU GLU A . n A 1 228 THR 228 228 228 THR THR A . n A 1 229 MET 229 229 229 MET MET A . n A 1 230 ARG 230 230 230 ARG ARG A . n A 1 231 ARG 231 231 231 ARG ARG A . n A 1 232 VAL 232 232 232 VAL VAL A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 GLY 234 234 234 GLY GLY A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 GLN 238 238 238 GLN GLN A . n A 1 239 TYR 239 239 239 TYR TYR A . n A 1 240 GLY 240 240 240 GLY GLY A . n A 1 241 HIS 241 241 241 HIS HIS A . n A 1 242 LYS 242 242 242 LYS LYS A . n A 1 243 VAL 243 243 243 VAL VAL A . n A 1 244 MET 244 244 244 MET MET A . n A 1 245 PHE 245 245 245 PHE PHE A . n # _pdbx_contact_author.id 3 _pdbx_contact_author.email jbroderick@montana.edu _pdbx_contact_author.name_first Joan _pdbx_contact_author.name_last Broderick _pdbx_contact_author.name_mi B _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7057-9124 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SF4 1 301 500 SF4 SF4 A . C 3 SAM 1 302 501 SAM SAM A . D 4 K 1 303 502 K K A . E 5 CL 1 304 1 CL CL A . F 5 CL 1 305 2 CL CL A . G 5 CL 1 306 3 CL CL A . H 6 HOH 1 401 6 HOH HOH A . H 6 HOH 2 402 2 HOH HOH A . H 6 HOH 3 403 1 HOH HOH A . H 6 HOH 4 404 10 HOH HOH A . H 6 HOH 5 405 3 HOH HOH A . H 6 HOH 6 406 4 HOH HOH A . H 6 HOH 7 407 15 HOH HOH A . H 6 HOH 8 408 13 HOH HOH A . H 6 HOH 9 409 17 HOH HOH A . H 6 HOH 10 410 14 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 29 ? A CYS 29 ? 1_555 FE4 ? B SF4 . ? A SF4 301 ? 1_555 S1 ? B SF4 . ? A SF4 301 ? 1_555 116.2 ? 2 SG ? A CYS 29 ? A CYS 29 ? 1_555 FE4 ? B SF4 . ? A SF4 301 ? 1_555 S2 ? B SF4 . ? A SF4 301 ? 1_555 118.3 ? 3 S1 ? B SF4 . ? A SF4 301 ? 1_555 FE4 ? B SF4 . ? A SF4 301 ? 1_555 S2 ? B SF4 . ? A SF4 301 ? 1_555 103.9 ? 4 SG ? A CYS 29 ? A CYS 29 ? 1_555 FE4 ? B SF4 . ? A SF4 301 ? 1_555 S3 ? B SF4 . ? A SF4 301 ? 1_555 108.7 ? 5 S1 ? B SF4 . ? A SF4 301 ? 1_555 FE4 ? B SF4 . ? A SF4 301 ? 1_555 S3 ? B SF4 . ? A SF4 301 ? 1_555 104.4 ? 6 S2 ? B SF4 . ? A SF4 301 ? 1_555 FE4 ? B SF4 . ? A SF4 301 ? 1_555 S3 ? B SF4 . ? A SF4 301 ? 1_555 103.9 ? 7 SG ? A CYS 33 ? A CYS 33 ? 1_555 FE1 ? B SF4 . ? A SF4 301 ? 1_555 S2 ? B SF4 . ? A SF4 301 ? 1_555 111.8 ? 8 SG ? A CYS 33 ? A CYS 33 ? 1_555 FE1 ? B SF4 . ? A SF4 301 ? 1_555 S3 ? B SF4 . ? A SF4 301 ? 1_555 118.6 ? 9 S2 ? B SF4 . ? A SF4 301 ? 1_555 FE1 ? B SF4 . ? A SF4 301 ? 1_555 S3 ? B SF4 . ? A SF4 301 ? 1_555 104.3 ? 10 SG ? A CYS 33 ? A CYS 33 ? 1_555 FE1 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 112.6 ? 11 S2 ? B SF4 . ? A SF4 301 ? 1_555 FE1 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 104.1 ? 12 S3 ? B SF4 . ? A SF4 301 ? 1_555 FE1 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 104.0 ? 13 SG ? A CYS 36 ? A CYS 36 ? 1_555 FE3 ? B SF4 . ? A SF4 301 ? 1_555 S1 ? B SF4 . ? A SF4 301 ? 1_555 119.8 ? 14 SG ? A CYS 36 ? A CYS 36 ? 1_555 FE3 ? B SF4 . ? A SF4 301 ? 1_555 S2 ? B SF4 . ? A SF4 301 ? 1_555 111.9 ? 15 S1 ? B SF4 . ? A SF4 301 ? 1_555 FE3 ? B SF4 . ? A SF4 301 ? 1_555 S2 ? B SF4 . ? A SF4 301 ? 1_555 104.0 ? 16 SG ? A CYS 36 ? A CYS 36 ? 1_555 FE3 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 111.3 ? 17 S1 ? B SF4 . ? A SF4 301 ? 1_555 FE3 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 104.3 ? 18 S2 ? B SF4 . ? A SF4 301 ? 1_555 FE3 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 104.2 ? 19 OD1 ? A ASP 104 ? A ASP 104 ? 1_555 K ? D K . ? A K 303 ? 1_555 O ? A THR 105 ? A THR 105 ? 1_555 126.9 ? 20 OD1 ? A ASP 104 ? A ASP 104 ? 1_555 K ? D K . ? A K 303 ? 1_555 O ? A MET 127 ? A MET 127 ? 1_555 79.7 ? 21 O ? A THR 105 ? A THR 105 ? 1_555 K ? D K . ? A K 303 ? 1_555 O ? A MET 127 ? A MET 127 ? 1_555 61.1 ? 22 OD1 ? A ASP 104 ? A ASP 104 ? 1_555 K ? D K . ? A K 303 ? 1_555 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 125.9 ? 23 O ? A THR 105 ? A THR 105 ? 1_555 K ? D K . ? A K 303 ? 1_555 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 103.0 ? 24 O ? A MET 127 ? A MET 127 ? 1_555 K ? D K . ? A K 303 ? 1_555 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 113.3 ? 25 OD1 ? A ASP 104 ? A ASP 104 ? 1_555 K ? D K . ? A K 303 ? 1_555 OXT ? C SAM . ? A SAM 302 ? 1_555 134.9 ? 26 O ? A THR 105 ? A THR 105 ? 1_555 K ? D K . ? A K 303 ? 1_555 OXT ? C SAM . ? A SAM 302 ? 1_555 69.6 ? 27 O ? A MET 127 ? A MET 127 ? 1_555 K ? D K . ? A K 303 ? 1_555 OXT ? C SAM . ? A SAM 302 ? 1_555 130.7 ? 28 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 K ? D K . ? A K 303 ? 1_555 OXT ? C SAM . ? A SAM 302 ? 1_555 77.2 ? 29 N ? C SAM . ? A SAM 302 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 S1 ? B SF4 . ? A SF4 301 ? 1_555 82.3 ? 30 N ? C SAM . ? A SAM 302 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 S3 ? B SF4 . ? A SF4 301 ? 1_555 87.6 ? 31 S1 ? B SF4 . ? A SF4 301 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 S3 ? B SF4 . ? A SF4 301 ? 1_555 104.1 ? 32 N ? C SAM . ? A SAM 302 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 164.9 ? 33 S1 ? B SF4 . ? A SF4 301 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 103.9 ? 34 S3 ? B SF4 . ? A SF4 301 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 103.8 ? 35 N ? C SAM . ? A SAM 302 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 O ? C SAM . ? A SAM 302 ? 1_555 67.3 ? 36 S1 ? B SF4 . ? A SF4 301 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 O ? C SAM . ? A SAM 302 ? 1_555 147.3 ? 37 S3 ? B SF4 . ? A SF4 301 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 O ? C SAM . ? A SAM 302 ? 1_555 86.9 ? 38 S4 ? B SF4 . ? A SF4 301 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 O ? C SAM . ? A SAM 302 ? 1_555 103.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-05-24 2 'Structure model' 1 1 2023-06-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_citation.journal_volume' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 53.6551757386 59.2898837432 32.1008085876 0.416991065442 ? 0.00866364147365 ? -0.0652074479595 ? 0.466730744471 ? 0.0314982316494 ? 0.323179219082 ? 5.84872926578 ? -2.12194379443 ? -1.12675701948 ? 8.04274928122 ? -1.18529938944 ? 2.98565351517 ? 0.30145353505 ? 0.0309984409314 ? -0.124037316212 ? 0.310616106614 ? -0.174185401093 ? -0.11807383658 ? 0.270515363658 ? -0.0630507781904 ? -0.128986376576 ? 2 'X-RAY DIFFRACTION' ? refined 49.9321624265 63.7510403272 31.5476275332 0.322103261096 ? -0.0319119766524 ? 0.0228255615615 ? 0.436207166389 ? 0.00568307085574 ? 0.391548114145 ? 3.04720392495 ? -2.87326428946 ? 4.54051309152 ? 5.20805274315 ? -3.99145298975 ? 6.91791482868 ? -0.239170256468 ? -0.35215427352 ? 0.0285414105884 ? 0.0490840038456 ? 0.307971568069 ? 0.202569145185 ? -0.113722315669 ? -0.486122438365 ? -0.035076663974 ? 3 'X-RAY DIFFRACTION' ? refined 60.3296546668 65.1004899015 31.9850643516 0.420238909337 ? 0.00749137329032 ? -0.0680036539268 ? 0.40971961499 ? -0.0215024869449 ? 0.385933023736 ? 6.35319805091 ? -1.26485845529 ? 0.328737961539 ? 4.6803889752 ? 0.414021208998 ? 5.48378265512 ? 0.196408643125 ? -0.280019367819 ? -0.0328874455443 ? 0.32154373477 ? 0.0160436437898 ? -0.600500930972 ? -0.0582980470045 ? 0.418383170349 ? -0.298064025863 ? 4 'X-RAY DIFFRACTION' ? refined 61.8173880736 71.0380575977 26.0997617092 0.325726746979 ? -0.105043314723 ? 0.0497458118617 ? 0.464122994366 ? 0.00938249086983 ? 0.356397501966 ? 6.25192375895 ? -2.39609526788 ? 3.43722474676 ? 6.73147869586 ? -1.31112282713 ? 5.90081635314 ? -0.0795019712222 ? -0.0784324709641 ? 0.297520412609 ? 0.423977619437 ? 0.111788529055 ? -0.0441424414056 ? -0.693175572334 ? 0.281186272935 ? 0.00124218777023 ? 5 'X-RAY DIFFRACTION' ? refined 52.4439344066 70.2569547484 12.0977014499 0.431841274649 ? -0.0128965911529 ? 0.00260841841133 ? 0.330789340305 ? -0.0295641872211 ? 0.331766615384 ? 4.77597825166 ? -0.875087202551 ? 1.35857404305 ? 2.08423862942 ? 1.13974530719 ? 1.70583966929 ? -0.0986676122835 ? 0.256184620374 ? 0.0104096923961 ? -0.26957233563 ? -0.0711947437369 ? 0.135459510334 ? -0.42237701101 ? -0.0102430388256 ? 0.115995401588 ? 6 'X-RAY DIFFRACTION' ? refined 59.0861193296 66.3582788291 9.88925480503 0.442490339251 ? -0.0573570121038 ? 0.0535437521417 ? 0.481512596489 ? 0.0999377823859 ? 0.341616857803 ? 4.54133035582 ? -0.904400301574 ? 1.32672217619 ? 3.73518922651 ? 1.63413391728 ? 4.9944261046 ? -0.147912711281 ? 0.249531203652 ? 0.204977314084 ? -0.403725540987 ? -0.0211239354607 ? -0.176292864886 ? -0.289259872488 ? 0.37721138472 ? 0.168404338148 ? 7 'X-RAY DIFFRACTION' ? refined 36.9071195874 60.5680837476 15.0860180664 0.600421672142 ? -0.0623993948923 ? -0.0630198982982 ? 0.727163280119 ? -0.0788478468517 ? 0.80665240626 ? 5.30563184347 ? -2.67448534071 ? -6.74827448816 ? 4.62941081516 ? 3.07126202589 ? 8.59033546653 ? -0.215327105232 ? 0.401799013518 ? -0.714992003083 ? 0.402520092149 ? -0.717506370503 ? 0.589396388368 ? 0.290245276338 ? -0.879428016229 ? 1.00055842652 ? 8 'X-RAY DIFFRACTION' ? refined 57.5233677534 55.8578350231 2.58434073199 0.636970965603 ? 0.0266219271304 ? 0.107455629838 ? 0.425162031972 ? -0.111531916284 ? 0.431556760687 ? 5.89875821464 ? 1.98015581377 ? 3.38929761636 ? 6.03998044191 ? -0.0665189527788 ? 5.7261643097 ? 0.187481194369 ? 0.367494291836 ? -0.524949403467 ? -0.0802461062802 ? -0.0266306302636 ? 0.176359964307 ? 0.389121005688 ? 0.568982579084 ? -0.243188752056 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 1 ? A 26 A 26 ? ? ;chain 'A' and (resid 1 through 26 ) ; 2 'X-RAY DIFFRACTION' 2 A 27 A 27 ? A 66 A 66 ? ? ;chain 'A' and (resid 27 through 66 ) ; 3 'X-RAY DIFFRACTION' 3 A 67 A 67 ? A 96 A 96 ? ? ;chain 'A' and (resid 67 through 96 ) ; 4 'X-RAY DIFFRACTION' 4 A 97 A 97 ? A 122 A 122 ? ? ;chain 'A' and (resid 97 through 122 ) ; 5 'X-RAY DIFFRACTION' 5 A 123 A 123 ? A 146 A 146 ? ? ;chain 'A' and (resid 123 through 146 ) ; 6 'X-RAY DIFFRACTION' 6 A 147 A 147 ? A 200 A 200 ? ? ;chain 'A' and (resid 147 through 200 ) ; 7 'X-RAY DIFFRACTION' 7 A 201 A 201 ? A 225 A 225 ? ? ;chain 'A' and (resid 201 through 225 ) ; 8 'X-RAY DIFFRACTION' 8 A 226 A 226 ? A 245 A 245 ? ? ;chain 'A' and (resid 226 through 245 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? CrystalClear ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 # _pdbx_entry_details.entry_id 8FOL _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 76 ? ? -132.25 -154.32 2 1 GLN A 83 ? ? -110.27 53.82 3 1 TYR A 112 ? ? -104.44 72.21 4 1 GLN A 132 ? ? -171.43 122.96 5 1 LEU A 218 ? ? -85.61 37.98 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 217 ? CG ? A LYS 217 CG 2 1 Y 1 A LYS 217 ? CD ? A LYS 217 CD 3 1 Y 1 A LYS 217 ? CE ? A LYS 217 CE 4 1 Y 1 A LYS 217 ? NZ ? A LYS 217 NZ 5 1 Y 1 A MET 244 ? SD ? A MET 244 SD 6 1 Y 1 A MET 244 ? CE ? A MET 244 CE # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'NIH GM 131889, NIH GM 054608' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 SAM ? ? SAM ? ? 'SUBJECT OF INVESTIGATION' ? 2 SF4 ? ? SF4 ? ? 'SUBJECT OF INVESTIGATION' ? 3 K ? ? K ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'IRON/SULFUR CLUSTER' SF4 3 S-ADENOSYLMETHIONINE SAM 4 'POTASSIUM ION' K 5 'CHLORIDE ION' CL 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3C8F _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details 'This enzyme has been observed passing a radical to pyruvate formate-lyase' # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 #