data_8G1H # _entry.id 8G1H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8G1H pdb_00008g1h 10.2210/pdb8g1h/pdb WWPDB D_1000269634 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-02-07 2 'Structure model' 1 1 2024-08-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8G1H _pdbx_database_status.recvd_initial_deposition_date 2023-02-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 7R8Z unspecified PDB . 7R8Y unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email vcasfe@uchile.cl _pdbx_contact_author.name_first Victor _pdbx_contact_author.name_last Castro-Fernandez _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4309-6415 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Perez, M.' 1 ? 'Munoz, S.' 2 ? 'Cea, P.' 3 ? 'Castro-Fernandez, V.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mol.Biol.Evol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1537-1719 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 41 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Deciphering Structural Traits for Thermal and Kinetic Stability across Protein Family Evolution through Ancestral Sequence Reconstruction. ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/molbev/msae127 _citation.pdbx_database_id_PubMed 38913681 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cea, P.A.' 1 0000-0002-2265-3980 primary 'Perez, M.' 2 0000-0002-3918-5749 primary 'Herrera, S.M.' 3 0000-0001-8494-7303 primary 'Munoz, S.M.' 4 0000-0002-3077-9794 primary 'Fuentes-Ugarte, N.' 5 0000-0002-5395-9237 primary 'Coche-Miranda, J.' 6 0009-0006-6955-357X primary 'Maturana, P.' 7 0000-0003-0686-1605 primary 'Guixe, V.' 8 0000-0001-9643-1339 primary 'Castro-Fernandez, V.' 9 0000-0002-4309-6415 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Phosphomethylpyrimidine Kinase' 26798.918 1 2.7.4.7 ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 2 ? ? ? ? 4 water nat water 18.015 27 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MRVALTIAGSDSGGGAGVQADLKTFSRFGVYGMSALTLVTAQNTLGVQRVHLLPPELVYAQIQAVAEDLPIHAAKTGALG NAAIVEAVAEAVRRFGIRPLVVDPVMVAKSGDPLLAPEAVAALKERLFPLATLITPNRLEAEALLGRPIRTLEEAEEAAK ALLALGPKAVLLKGGHLEGEEAVDLLATGEGIRRFSAPRVQTRNTHGTG(CSO)TLSAAIAALLALGRPLEEAVAEAKAY LTRALETAPSLGHGHGPLNHFA ; _entity_poly.pdbx_seq_one_letter_code_can ;MRVALTIAGSDSGGGAGVQADLKTFSRFGVYGMSALTLVTAQNTLGVQRVHLLPPELVYAQIQAVAEDLPIHAAKTGALG NAAIVEAVAEAVRRFGIRPLVVDPVMVAKSGDPLLAPEAVAALKERLFPLATLITPNRLEAEALLGRPIRTLEEAEEAAK ALLALGPKAVLLKGGHLEGEEAVDLLATGEGIRRFSAPRVQTRNTHGTGCTLSAAIAALLALGRPLEEAVAEAKAYLTRA LETAPSLGHGHGPLNHFA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 'PHOSPHATE ION' PO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 VAL n 1 4 ALA n 1 5 LEU n 1 6 THR n 1 7 ILE n 1 8 ALA n 1 9 GLY n 1 10 SER n 1 11 ASP n 1 12 SER n 1 13 GLY n 1 14 GLY n 1 15 GLY n 1 16 ALA n 1 17 GLY n 1 18 VAL n 1 19 GLN n 1 20 ALA n 1 21 ASP n 1 22 LEU n 1 23 LYS n 1 24 THR n 1 25 PHE n 1 26 SER n 1 27 ARG n 1 28 PHE n 1 29 GLY n 1 30 VAL n 1 31 TYR n 1 32 GLY n 1 33 MET n 1 34 SER n 1 35 ALA n 1 36 LEU n 1 37 THR n 1 38 LEU n 1 39 VAL n 1 40 THR n 1 41 ALA n 1 42 GLN n 1 43 ASN n 1 44 THR n 1 45 LEU n 1 46 GLY n 1 47 VAL n 1 48 GLN n 1 49 ARG n 1 50 VAL n 1 51 HIS n 1 52 LEU n 1 53 LEU n 1 54 PRO n 1 55 PRO n 1 56 GLU n 1 57 LEU n 1 58 VAL n 1 59 TYR n 1 60 ALA n 1 61 GLN n 1 62 ILE n 1 63 GLN n 1 64 ALA n 1 65 VAL n 1 66 ALA n 1 67 GLU n 1 68 ASP n 1 69 LEU n 1 70 PRO n 1 71 ILE n 1 72 HIS n 1 73 ALA n 1 74 ALA n 1 75 LYS n 1 76 THR n 1 77 GLY n 1 78 ALA n 1 79 LEU n 1 80 GLY n 1 81 ASN n 1 82 ALA n 1 83 ALA n 1 84 ILE n 1 85 VAL n 1 86 GLU n 1 87 ALA n 1 88 VAL n 1 89 ALA n 1 90 GLU n 1 91 ALA n 1 92 VAL n 1 93 ARG n 1 94 ARG n 1 95 PHE n 1 96 GLY n 1 97 ILE n 1 98 ARG n 1 99 PRO n 1 100 LEU n 1 101 VAL n 1 102 VAL n 1 103 ASP n 1 104 PRO n 1 105 VAL n 1 106 MET n 1 107 VAL n 1 108 ALA n 1 109 LYS n 1 110 SER n 1 111 GLY n 1 112 ASP n 1 113 PRO n 1 114 LEU n 1 115 LEU n 1 116 ALA n 1 117 PRO n 1 118 GLU n 1 119 ALA n 1 120 VAL n 1 121 ALA n 1 122 ALA n 1 123 LEU n 1 124 LYS n 1 125 GLU n 1 126 ARG n 1 127 LEU n 1 128 PHE n 1 129 PRO n 1 130 LEU n 1 131 ALA n 1 132 THR n 1 133 LEU n 1 134 ILE n 1 135 THR n 1 136 PRO n 1 137 ASN n 1 138 ARG n 1 139 LEU n 1 140 GLU n 1 141 ALA n 1 142 GLU n 1 143 ALA n 1 144 LEU n 1 145 LEU n 1 146 GLY n 1 147 ARG n 1 148 PRO n 1 149 ILE n 1 150 ARG n 1 151 THR n 1 152 LEU n 1 153 GLU n 1 154 GLU n 1 155 ALA n 1 156 GLU n 1 157 GLU n 1 158 ALA n 1 159 ALA n 1 160 LYS n 1 161 ALA n 1 162 LEU n 1 163 LEU n 1 164 ALA n 1 165 LEU n 1 166 GLY n 1 167 PRO n 1 168 LYS n 1 169 ALA n 1 170 VAL n 1 171 LEU n 1 172 LEU n 1 173 LYS n 1 174 GLY n 1 175 GLY n 1 176 HIS n 1 177 LEU n 1 178 GLU n 1 179 GLY n 1 180 GLU n 1 181 GLU n 1 182 ALA n 1 183 VAL n 1 184 ASP n 1 185 LEU n 1 186 LEU n 1 187 ALA n 1 188 THR n 1 189 GLY n 1 190 GLU n 1 191 GLY n 1 192 ILE n 1 193 ARG n 1 194 ARG n 1 195 PHE n 1 196 SER n 1 197 ALA n 1 198 PRO n 1 199 ARG n 1 200 VAL n 1 201 GLN n 1 202 THR n 1 203 ARG n 1 204 ASN n 1 205 THR n 1 206 HIS n 1 207 GLY n 1 208 THR n 1 209 GLY n 1 210 CSO n 1 211 THR n 1 212 LEU n 1 213 SER n 1 214 ALA n 1 215 ALA n 1 216 ILE n 1 217 ALA n 1 218 ALA n 1 219 LEU n 1 220 LEU n 1 221 ALA n 1 222 LEU n 1 223 GLY n 1 224 ARG n 1 225 PRO n 1 226 LEU n 1 227 GLU n 1 228 GLU n 1 229 ALA n 1 230 VAL n 1 231 ALA n 1 232 GLU n 1 233 ALA n 1 234 LYS n 1 235 ALA n 1 236 TYR n 1 237 LEU n 1 238 THR n 1 239 ARG n 1 240 ALA n 1 241 LEU n 1 242 GLU n 1 243 THR n 1 244 ALA n 1 245 PRO n 1 246 SER n 1 247 LEU n 1 248 GLY n 1 249 HIS n 1 250 GLY n 1 251 HIS n 1 252 GLY n 1 253 PRO n 1 254 LEU n 1 255 ASN n 1 256 HIS n 1 257 PHE n 1 258 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 258 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S' 137.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 PRO 167 167 167 PRO PRO A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 HIS 176 176 176 HIS HIS A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 ASP 184 184 184 ASP ASP A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 ILE 192 192 192 ILE ILE A . n A 1 193 ARG 193 193 193 ARG ARG A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 PHE 195 195 195 PHE PHE A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 PRO 198 198 198 PRO PRO A . n A 1 199 ARG 199 199 199 ARG ARG A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 GLN 201 201 201 GLN GLN A . n A 1 202 THR 202 202 202 THR THR A . n A 1 203 ARG 203 203 203 ARG ARG A . n A 1 204 ASN 204 204 204 ASN ASN A . n A 1 205 THR 205 205 205 THR THR A . n A 1 206 HIS 206 206 206 HIS HIS A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 THR 208 208 208 THR THR A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 CSO 210 210 210 CSO CSO A . n A 1 211 THR 211 211 211 THR THR A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 SER 213 213 213 SER SER A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 ILE 216 216 216 ILE ILE A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 ALA 221 221 221 ALA ALA A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 GLY 223 223 223 GLY GLY A . n A 1 224 ARG 224 224 224 ARG ARG A . n A 1 225 PRO 225 225 225 PRO PRO A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 GLU 227 227 227 GLU GLU A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 VAL 230 230 230 VAL VAL A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 GLU 232 232 232 GLU GLU A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 LYS 234 234 234 LYS LYS A . n A 1 235 ALA 235 235 235 ALA ALA A . n A 1 236 TYR 236 236 236 TYR TYR A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 THR 238 238 238 THR THR A . n A 1 239 ARG 239 239 239 ARG ARG A . n A 1 240 ALA 240 240 240 ALA ALA A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 GLU 242 242 242 GLU GLU A . n A 1 243 THR 243 243 243 THR THR A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 PRO 245 245 245 PRO PRO A . n A 1 246 SER 246 246 246 SER SER A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 GLY 248 248 248 GLY GLY A . n A 1 249 HIS 249 249 249 HIS HIS A . n A 1 250 GLY 250 250 250 GLY GLY A . n A 1 251 HIS 251 251 251 HIS HIS A . n A 1 252 GLY 252 252 252 GLY GLY A . n A 1 253 PRO 253 253 253 PRO PRO A . n A 1 254 LEU 254 254 254 LEU LEU A . n A 1 255 ASN 255 255 255 ASN ASN A . n A 1 256 HIS 256 256 256 HIS HIS A . n A 1 257 PHE 257 257 257 PHE PHE A . n A 1 258 ALA 258 258 258 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 301 259 EDO EDO A . C 3 PO4 1 302 260 PO4 PO4 A . D 3 PO4 1 303 261 PO4 PO4 A . E 2 EDO 1 304 262 EDO EDO A . F 4 HOH 1 401 11 HOH HOH A . F 4 HOH 2 402 3 HOH HOH A . F 4 HOH 3 403 14 HOH HOH A . F 4 HOH 4 404 39 HOH HOH A . F 4 HOH 5 405 8 HOH HOH A . F 4 HOH 6 406 17 HOH HOH A . F 4 HOH 7 407 16 HOH HOH A . F 4 HOH 8 408 15 HOH HOH A . F 4 HOH 9 409 25 HOH HOH A . F 4 HOH 10 410 7 HOH HOH A . F 4 HOH 11 411 6 HOH HOH A . F 4 HOH 12 412 24 HOH HOH A . F 4 HOH 13 413 37 HOH HOH A . F 4 HOH 14 414 19 HOH HOH A . F 4 HOH 15 415 10 HOH HOH A . F 4 HOH 16 416 18 HOH HOH A . F 4 HOH 17 417 32 HOH HOH A . F 4 HOH 18 418 12 HOH HOH A . F 4 HOH 19 419 5 HOH HOH A . F 4 HOH 20 420 21 HOH HOH A . F 4 HOH 21 421 1 HOH HOH A . F 4 HOH 22 422 33 HOH HOH A . F 4 HOH 23 423 13 HOH HOH A . F 4 HOH 24 424 9 HOH HOH A . F 4 HOH 25 425 22 HOH HOH A . F 4 HOH 26 426 35 HOH HOH A . F 4 HOH 27 427 26 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8G1H _cell.details ? _cell.formula_units_Z ? _cell.length_a 59.410 _cell.length_a_esd ? _cell.length_b 59.410 _cell.length_b_esd ? _cell.length_c 254.936 _cell.length_c_esd ? _cell.volume 779257.344 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8G1H _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall 'P 61 2 (x,y,z+5/12)' _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8G1H _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.45 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Protein conditions: Protein 26 mg/ml, Tris-HCl 25 mM, NaCl 0.3 M, b-Mercaptoethanol 5 mM, ATP 1 mM, MgCl2 5 mM. Reservoir condition: Ethylene glycols 0.12 M (0.3M Diethylene glycol; 0.3M Triethylene glycol; 0.3M Tetraethylene glycol; 0.3M Pentaethylene glycol), Sodium HEPES/ MOPS pH 7.5, 37.5% precipitants (MPD, PEG 1000, PEG 3350) ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 292 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-10-07 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double crystal Monochromator - water- cooled Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.977180 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'LNLS SIRIUS BEAMLINE MANACA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.977180 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MANACA _diffrn_source.pdbx_synchrotron_site 'LNLS SIRIUS' # _reflns.B_iso_Wilson_estimate 54.50 _reflns.entry_id 8G1H _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 44.01 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8030 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.84 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 34.1 _reflns.pdbx_netI_over_av_sigmaI 21.62 _reflns.pdbx_netI_over_sigmaI 21.62 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1956 _reflns.pdbx_Rpim_I_all 0.033 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.1926 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.797 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.05 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 753 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.293 _reflns_shell.pdbx_Rpim_I_all 0.2123 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.94 _reflns_shell.pdbx_CC_star 0.984 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.87 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.275 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 48.01 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8G1H _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.70 _refine.ls_d_res_low 44.01 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8023 _refine.ls_number_reflns_R_free 461 _refine.ls_number_reflns_R_work 7562 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.88 _refine.ls_percent_reflns_R_free 5.75 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2035 _refine.ls_R_factor_R_free 0.2285 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2019 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1UB0 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.0250 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3315 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 44.01 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 1930 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1885 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0046 ? 1929 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7314 ? 2622 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0495 ? 316 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0063 ? 342 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 11.9686 ? 701 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.70 3.09 . . 155 2409 99.92 . . . . 0.2326 . . . . . . . . . . . 0.2995 'X-RAY DIFFRACTION' 3.09 3.89 . . 142 2479 99.85 . . . . 0.2134 . . . . . . . . . . . 0.2780 'X-RAY DIFFRACTION' 3.89 44.01 . . 164 2674 99.86 . . . . 0.1883 . . . . . . . . . . . 0.1874 # _struct.entry_id 8G1H _struct.title 'Ancestral protein AncTh of Phosphomethylpirimidine kinases family' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8G1H _struct_keywords.text ;Ancestral protein reconstruction, 5-phosphohydroxymethyl-2-methylpirimidine kinase, phosphomethylpirimidine kinases family, enzyme evolution, transferase ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 2 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8G1H _struct_ref.pdbx_db_accession 8G1H _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8G1H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 258 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8G1H _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 258 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 258 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5030 ? 1 MORE -50 ? 1 'SSA (A^2)' 18770 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details 'SAXS of a homologous protein' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_555 x,x-y,-z+1/6 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 42.4893333333 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 16 ? PHE A 28 ? ALA A 16 PHE A 28 1 ? 13 HELX_P HELX_P2 AA2 PRO A 54 ? GLU A 67 ? PRO A 54 GLU A 67 1 ? 14 HELX_P HELX_P3 AA3 ASN A 81 ? GLY A 96 ? ASN A 81 GLY A 96 1 ? 16 HELX_P HELX_P4 AA4 ALA A 116 ? ARG A 126 ? ALA A 116 ARG A 126 1 ? 11 HELX_P HELX_P5 AA5 LEU A 127 ? ALA A 131 ? LEU A 127 ALA A 131 5 ? 5 HELX_P HELX_P6 AA6 ASN A 137 ? GLY A 146 ? ASN A 137 GLY A 146 1 ? 10 HELX_P HELX_P7 AA7 THR A 151 ? LEU A 163 ? THR A 151 LEU A 163 1 ? 13 HELX_P HELX_P8 AA8 ALA A 164 ? GLY A 166 ? ALA A 164 GLY A 166 5 ? 3 HELX_P HELX_P9 AA9 GLY A 207 ? LEU A 222 ? GLY A 207 LEU A 222 1 ? 16 HELX_P HELX_P10 AB1 PRO A 225 ? THR A 243 ? PRO A 225 THR A 243 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLY 209 C ? ? ? 1_555 A CSO 210 N ? ? A GLY 209 A CSO 210 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? A CSO 210 C ? ? ? 1_555 A THR 211 N ? ? A CSO 210 A THR 211 1_555 ? ? ? ? ? ? ? 1.326 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 98 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 98 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 99 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 99 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -20.51 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 46 ? LEU A 52 ? GLY A 46 LEU A 52 AA1 2 TYR A 31 ? ASN A 43 ? TYR A 31 ASN A 43 AA1 3 VAL A 3 ? ASP A 11 ? VAL A 3 ASP A 11 AA1 4 ALA A 73 ? THR A 76 ? ALA A 73 THR A 76 AA1 5 LEU A 100 ? VAL A 102 ? LEU A 100 VAL A 102 AA1 6 LEU A 133 ? ILE A 134 ? LEU A 133 ILE A 134 AA2 1 VAL A 170 ? GLU A 178 ? VAL A 170 GLU A 178 AA2 2 GLU A 181 ? ALA A 187 ? GLU A 181 ALA A 187 AA2 3 ILE A 192 ? PRO A 198 ? ILE A 192 PRO A 198 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O HIS A 51 ? O HIS A 51 N VAL A 39 ? N VAL A 39 AA1 2 3 O ALA A 35 ? O ALA A 35 N THR A 6 ? N THR A 6 AA1 3 4 N LEU A 5 ? N LEU A 5 O LYS A 75 ? O LYS A 75 AA1 4 5 N ALA A 74 ? N ALA A 74 O VAL A 101 ? O VAL A 101 AA1 5 6 N VAL A 102 ? N VAL A 102 O LEU A 133 ? O LEU A 133 AA2 1 2 N LEU A 172 ? N LEU A 172 O LEU A 185 ? O LEU A 185 AA2 2 3 N ALA A 182 ? N ALA A 182 O ALA A 197 ? O ALA A 197 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/6 3 y,-x+y,z+5/6 4 -y,x-y,z+1/3 5 -x+y,-x,z+2/3 6 x-y,-y,-z 7 -x,-x+y,-z+2/3 8 -x,-y,z+1/2 9 y,x,-z+1/3 10 -y,-x,-z+5/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+1/6 # _pdbx_entry_details.entry_id 8G1H _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CSO N N N N 74 CSO CA C N R 75 CSO CB C N N 76 CSO SG S N N 77 CSO C C N N 78 CSO O O N N 79 CSO OXT O N N 80 CSO OD O N N 81 CSO H H N N 82 CSO H2 H N N 83 CSO HA H N N 84 CSO HB2 H N N 85 CSO HB3 H N N 86 CSO HXT H N N 87 CSO HD H N N 88 EDO C1 C N N 89 EDO O1 O N N 90 EDO C2 C N N 91 EDO O2 O N N 92 EDO H11 H N N 93 EDO H12 H N N 94 EDO HO1 H N N 95 EDO H21 H N N 96 EDO H22 H N N 97 EDO HO2 H N N 98 GLN N N N N 99 GLN CA C N S 100 GLN C C N N 101 GLN O O N N 102 GLN CB C N N 103 GLN CG C N N 104 GLN CD C N N 105 GLN OE1 O N N 106 GLN NE2 N N N 107 GLN OXT O N N 108 GLN H H N N 109 GLN H2 H N N 110 GLN HA H N N 111 GLN HB2 H N N 112 GLN HB3 H N N 113 GLN HG2 H N N 114 GLN HG3 H N N 115 GLN HE21 H N N 116 GLN HE22 H N N 117 GLN HXT H N N 118 GLU N N N N 119 GLU CA C N S 120 GLU C C N N 121 GLU O O N N 122 GLU CB C N N 123 GLU CG C N N 124 GLU CD C N N 125 GLU OE1 O N N 126 GLU OE2 O N N 127 GLU OXT O N N 128 GLU H H N N 129 GLU H2 H N N 130 GLU HA H N N 131 GLU HB2 H N N 132 GLU HB3 H N N 133 GLU HG2 H N N 134 GLU HG3 H N N 135 GLU HE2 H N N 136 GLU HXT H N N 137 GLY N N N N 138 GLY CA C N N 139 GLY C C N N 140 GLY O O N N 141 GLY OXT O N N 142 GLY H H N N 143 GLY H2 H N N 144 GLY HA2 H N N 145 GLY HA3 H N N 146 GLY HXT H N N 147 HIS N N N N 148 HIS CA C N S 149 HIS C C N N 150 HIS O O N N 151 HIS CB C N N 152 HIS CG C Y N 153 HIS ND1 N Y N 154 HIS CD2 C Y N 155 HIS CE1 C Y N 156 HIS NE2 N Y N 157 HIS OXT O N N 158 HIS H H N N 159 HIS H2 H N N 160 HIS HA H N N 161 HIS HB2 H N N 162 HIS HB3 H N N 163 HIS HD1 H N N 164 HIS HD2 H N N 165 HIS HE1 H N N 166 HIS HE2 H N N 167 HIS HXT H N N 168 HOH O O N N 169 HOH H1 H N N 170 HOH H2 H N N 171 ILE N N N N 172 ILE CA C N S 173 ILE C C N N 174 ILE O O N N 175 ILE CB C N S 176 ILE CG1 C N N 177 ILE CG2 C N N 178 ILE CD1 C N N 179 ILE OXT O N N 180 ILE H H N N 181 ILE H2 H N N 182 ILE HA H N N 183 ILE HB H N N 184 ILE HG12 H N N 185 ILE HG13 H N N 186 ILE HG21 H N N 187 ILE HG22 H N N 188 ILE HG23 H N N 189 ILE HD11 H N N 190 ILE HD12 H N N 191 ILE HD13 H N N 192 ILE HXT H N N 193 LEU N N N N 194 LEU CA C N S 195 LEU C C N N 196 LEU O O N N 197 LEU CB C N N 198 LEU CG C N N 199 LEU CD1 C N N 200 LEU CD2 C N N 201 LEU OXT O N N 202 LEU H H N N 203 LEU H2 H N N 204 LEU HA H N N 205 LEU HB2 H N N 206 LEU HB3 H N N 207 LEU HG H N N 208 LEU HD11 H N N 209 LEU HD12 H N N 210 LEU HD13 H N N 211 LEU HD21 H N N 212 LEU HD22 H N N 213 LEU HD23 H N N 214 LEU HXT H N N 215 LYS N N N N 216 LYS CA C N S 217 LYS C C N N 218 LYS O O N N 219 LYS CB C N N 220 LYS CG C N N 221 LYS CD C N N 222 LYS CE C N N 223 LYS NZ N N N 224 LYS OXT O N N 225 LYS H H N N 226 LYS H2 H N N 227 LYS HA H N N 228 LYS HB2 H N N 229 LYS HB3 H N N 230 LYS HG2 H N N 231 LYS HG3 H N N 232 LYS HD2 H N N 233 LYS HD3 H N N 234 LYS HE2 H N N 235 LYS HE3 H N N 236 LYS HZ1 H N N 237 LYS HZ2 H N N 238 LYS HZ3 H N N 239 LYS HXT H N N 240 MET N N N N 241 MET CA C N S 242 MET C C N N 243 MET O O N N 244 MET CB C N N 245 MET CG C N N 246 MET SD S N N 247 MET CE C N N 248 MET OXT O N N 249 MET H H N N 250 MET H2 H N N 251 MET HA H N N 252 MET HB2 H N N 253 MET HB3 H N N 254 MET HG2 H N N 255 MET HG3 H N N 256 MET HE1 H N N 257 MET HE2 H N N 258 MET HE3 H N N 259 MET HXT H N N 260 PHE N N N N 261 PHE CA C N S 262 PHE C C N N 263 PHE O O N N 264 PHE CB C N N 265 PHE CG C Y N 266 PHE CD1 C Y N 267 PHE CD2 C Y N 268 PHE CE1 C Y N 269 PHE CE2 C Y N 270 PHE CZ C Y N 271 PHE OXT O N N 272 PHE H H N N 273 PHE H2 H N N 274 PHE HA H N N 275 PHE HB2 H N N 276 PHE HB3 H N N 277 PHE HD1 H N N 278 PHE HD2 H N N 279 PHE HE1 H N N 280 PHE HE2 H N N 281 PHE HZ H N N 282 PHE HXT H N N 283 PO4 P P N N 284 PO4 O1 O N N 285 PO4 O2 O N N 286 PO4 O3 O N N 287 PO4 O4 O N N 288 PRO N N N N 289 PRO CA C N S 290 PRO C C N N 291 PRO O O N N 292 PRO CB C N N 293 PRO CG C N N 294 PRO CD C N N 295 PRO OXT O N N 296 PRO H H N N 297 PRO HA H N N 298 PRO HB2 H N N 299 PRO HB3 H N N 300 PRO HG2 H N N 301 PRO HG3 H N N 302 PRO HD2 H N N 303 PRO HD3 H N N 304 PRO HXT H N N 305 SER N N N N 306 SER CA C N S 307 SER C C N N 308 SER O O N N 309 SER CB C N N 310 SER OG O N N 311 SER OXT O N N 312 SER H H N N 313 SER H2 H N N 314 SER HA H N N 315 SER HB2 H N N 316 SER HB3 H N N 317 SER HG H N N 318 SER HXT H N N 319 THR N N N N 320 THR CA C N S 321 THR C C N N 322 THR O O N N 323 THR CB C N R 324 THR OG1 O N N 325 THR CG2 C N N 326 THR OXT O N N 327 THR H H N N 328 THR H2 H N N 329 THR HA H N N 330 THR HB H N N 331 THR HG1 H N N 332 THR HG21 H N N 333 THR HG22 H N N 334 THR HG23 H N N 335 THR HXT H N N 336 TYR N N N N 337 TYR CA C N S 338 TYR C C N N 339 TYR O O N N 340 TYR CB C N N 341 TYR CG C Y N 342 TYR CD1 C Y N 343 TYR CD2 C Y N 344 TYR CE1 C Y N 345 TYR CE2 C Y N 346 TYR CZ C Y N 347 TYR OH O N N 348 TYR OXT O N N 349 TYR H H N N 350 TYR H2 H N N 351 TYR HA H N N 352 TYR HB2 H N N 353 TYR HB3 H N N 354 TYR HD1 H N N 355 TYR HD2 H N N 356 TYR HE1 H N N 357 TYR HE2 H N N 358 TYR HH H N N 359 TYR HXT H N N 360 VAL N N N N 361 VAL CA C N S 362 VAL C C N N 363 VAL O O N N 364 VAL CB C N N 365 VAL CG1 C N N 366 VAL CG2 C N N 367 VAL OXT O N N 368 VAL H H N N 369 VAL H2 H N N 370 VAL HA H N N 371 VAL HB H N N 372 VAL HG11 H N N 373 VAL HG12 H N N 374 VAL HG13 H N N 375 VAL HG21 H N N 376 VAL HG22 H N N 377 VAL HG23 H N N 378 VAL HXT H N N 379 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CSO N CA sing N N 70 CSO N H sing N N 71 CSO N H2 sing N N 72 CSO CA CB sing N N 73 CSO CA C sing N N 74 CSO CA HA sing N N 75 CSO CB SG sing N N 76 CSO CB HB2 sing N N 77 CSO CB HB3 sing N N 78 CSO SG OD sing N N 79 CSO C O doub N N 80 CSO C OXT sing N N 81 CSO OXT HXT sing N N 82 CSO OD HD sing N N 83 EDO C1 O1 sing N N 84 EDO C1 C2 sing N N 85 EDO C1 H11 sing N N 86 EDO C1 H12 sing N N 87 EDO O1 HO1 sing N N 88 EDO C2 O2 sing N N 89 EDO C2 H21 sing N N 90 EDO C2 H22 sing N N 91 EDO O2 HO2 sing N N 92 GLN N CA sing N N 93 GLN N H sing N N 94 GLN N H2 sing N N 95 GLN CA C sing N N 96 GLN CA CB sing N N 97 GLN CA HA sing N N 98 GLN C O doub N N 99 GLN C OXT sing N N 100 GLN CB CG sing N N 101 GLN CB HB2 sing N N 102 GLN CB HB3 sing N N 103 GLN CG CD sing N N 104 GLN CG HG2 sing N N 105 GLN CG HG3 sing N N 106 GLN CD OE1 doub N N 107 GLN CD NE2 sing N N 108 GLN NE2 HE21 sing N N 109 GLN NE2 HE22 sing N N 110 GLN OXT HXT sing N N 111 GLU N CA sing N N 112 GLU N H sing N N 113 GLU N H2 sing N N 114 GLU CA C sing N N 115 GLU CA CB sing N N 116 GLU CA HA sing N N 117 GLU C O doub N N 118 GLU C OXT sing N N 119 GLU CB CG sing N N 120 GLU CB HB2 sing N N 121 GLU CB HB3 sing N N 122 GLU CG CD sing N N 123 GLU CG HG2 sing N N 124 GLU CG HG3 sing N N 125 GLU CD OE1 doub N N 126 GLU CD OE2 sing N N 127 GLU OE2 HE2 sing N N 128 GLU OXT HXT sing N N 129 GLY N CA sing N N 130 GLY N H sing N N 131 GLY N H2 sing N N 132 GLY CA C sing N N 133 GLY CA HA2 sing N N 134 GLY CA HA3 sing N N 135 GLY C O doub N N 136 GLY C OXT sing N N 137 GLY OXT HXT sing N N 138 HIS N CA sing N N 139 HIS N H sing N N 140 HIS N H2 sing N N 141 HIS CA C sing N N 142 HIS CA CB sing N N 143 HIS CA HA sing N N 144 HIS C O doub N N 145 HIS C OXT sing N N 146 HIS CB CG sing N N 147 HIS CB HB2 sing N N 148 HIS CB HB3 sing N N 149 HIS CG ND1 sing Y N 150 HIS CG CD2 doub Y N 151 HIS ND1 CE1 doub Y N 152 HIS ND1 HD1 sing N N 153 HIS CD2 NE2 sing Y N 154 HIS CD2 HD2 sing N N 155 HIS CE1 NE2 sing Y N 156 HIS CE1 HE1 sing N N 157 HIS NE2 HE2 sing N N 158 HIS OXT HXT sing N N 159 HOH O H1 sing N N 160 HOH O H2 sing N N 161 ILE N CA sing N N 162 ILE N H sing N N 163 ILE N H2 sing N N 164 ILE CA C sing N N 165 ILE CA CB sing N N 166 ILE CA HA sing N N 167 ILE C O doub N N 168 ILE C OXT sing N N 169 ILE CB CG1 sing N N 170 ILE CB CG2 sing N N 171 ILE CB HB sing N N 172 ILE CG1 CD1 sing N N 173 ILE CG1 HG12 sing N N 174 ILE CG1 HG13 sing N N 175 ILE CG2 HG21 sing N N 176 ILE CG2 HG22 sing N N 177 ILE CG2 HG23 sing N N 178 ILE CD1 HD11 sing N N 179 ILE CD1 HD12 sing N N 180 ILE CD1 HD13 sing N N 181 ILE OXT HXT sing N N 182 LEU N CA sing N N 183 LEU N H sing N N 184 LEU N H2 sing N N 185 LEU CA C sing N N 186 LEU CA CB sing N N 187 LEU CA HA sing N N 188 LEU C O doub N N 189 LEU C OXT sing N N 190 LEU CB CG sing N N 191 LEU CB HB2 sing N N 192 LEU CB HB3 sing N N 193 LEU CG CD1 sing N N 194 LEU CG CD2 sing N N 195 LEU CG HG sing N N 196 LEU CD1 HD11 sing N N 197 LEU CD1 HD12 sing N N 198 LEU CD1 HD13 sing N N 199 LEU CD2 HD21 sing N N 200 LEU CD2 HD22 sing N N 201 LEU CD2 HD23 sing N N 202 LEU OXT HXT sing N N 203 LYS N CA sing N N 204 LYS N H sing N N 205 LYS N H2 sing N N 206 LYS CA C sing N N 207 LYS CA CB sing N N 208 LYS CA HA sing N N 209 LYS C O doub N N 210 LYS C OXT sing N N 211 LYS CB CG sing N N 212 LYS CB HB2 sing N N 213 LYS CB HB3 sing N N 214 LYS CG CD sing N N 215 LYS CG HG2 sing N N 216 LYS CG HG3 sing N N 217 LYS CD CE sing N N 218 LYS CD HD2 sing N N 219 LYS CD HD3 sing N N 220 LYS CE NZ sing N N 221 LYS CE HE2 sing N N 222 LYS CE HE3 sing N N 223 LYS NZ HZ1 sing N N 224 LYS NZ HZ2 sing N N 225 LYS NZ HZ3 sing N N 226 LYS OXT HXT sing N N 227 MET N CA sing N N 228 MET N H sing N N 229 MET N H2 sing N N 230 MET CA C sing N N 231 MET CA CB sing N N 232 MET CA HA sing N N 233 MET C O doub N N 234 MET C OXT sing N N 235 MET CB CG sing N N 236 MET CB HB2 sing N N 237 MET CB HB3 sing N N 238 MET CG SD sing N N 239 MET CG HG2 sing N N 240 MET CG HG3 sing N N 241 MET SD CE sing N N 242 MET CE HE1 sing N N 243 MET CE HE2 sing N N 244 MET CE HE3 sing N N 245 MET OXT HXT sing N N 246 PHE N CA sing N N 247 PHE N H sing N N 248 PHE N H2 sing N N 249 PHE CA C sing N N 250 PHE CA CB sing N N 251 PHE CA HA sing N N 252 PHE C O doub N N 253 PHE C OXT sing N N 254 PHE CB CG sing N N 255 PHE CB HB2 sing N N 256 PHE CB HB3 sing N N 257 PHE CG CD1 doub Y N 258 PHE CG CD2 sing Y N 259 PHE CD1 CE1 sing Y N 260 PHE CD1 HD1 sing N N 261 PHE CD2 CE2 doub Y N 262 PHE CD2 HD2 sing N N 263 PHE CE1 CZ doub Y N 264 PHE CE1 HE1 sing N N 265 PHE CE2 CZ sing Y N 266 PHE CE2 HE2 sing N N 267 PHE CZ HZ sing N N 268 PHE OXT HXT sing N N 269 PO4 P O1 doub N N 270 PO4 P O2 sing N N 271 PO4 P O3 sing N N 272 PO4 P O4 sing N N 273 PRO N CA sing N N 274 PRO N CD sing N N 275 PRO N H sing N N 276 PRO CA C sing N N 277 PRO CA CB sing N N 278 PRO CA HA sing N N 279 PRO C O doub N N 280 PRO C OXT sing N N 281 PRO CB CG sing N N 282 PRO CB HB2 sing N N 283 PRO CB HB3 sing N N 284 PRO CG CD sing N N 285 PRO CG HG2 sing N N 286 PRO CG HG3 sing N N 287 PRO CD HD2 sing N N 288 PRO CD HD3 sing N N 289 PRO OXT HXT sing N N 290 SER N CA sing N N 291 SER N H sing N N 292 SER N H2 sing N N 293 SER CA C sing N N 294 SER CA CB sing N N 295 SER CA HA sing N N 296 SER C O doub N N 297 SER C OXT sing N N 298 SER CB OG sing N N 299 SER CB HB2 sing N N 300 SER CB HB3 sing N N 301 SER OG HG sing N N 302 SER OXT HXT sing N N 303 THR N CA sing N N 304 THR N H sing N N 305 THR N H2 sing N N 306 THR CA C sing N N 307 THR CA CB sing N N 308 THR CA HA sing N N 309 THR C O doub N N 310 THR C OXT sing N N 311 THR CB OG1 sing N N 312 THR CB CG2 sing N N 313 THR CB HB sing N N 314 THR OG1 HG1 sing N N 315 THR CG2 HG21 sing N N 316 THR CG2 HG22 sing N N 317 THR CG2 HG23 sing N N 318 THR OXT HXT sing N N 319 TYR N CA sing N N 320 TYR N H sing N N 321 TYR N H2 sing N N 322 TYR CA C sing N N 323 TYR CA CB sing N N 324 TYR CA HA sing N N 325 TYR C O doub N N 326 TYR C OXT sing N N 327 TYR CB CG sing N N 328 TYR CB HB2 sing N N 329 TYR CB HB3 sing N N 330 TYR CG CD1 doub Y N 331 TYR CG CD2 sing Y N 332 TYR CD1 CE1 sing Y N 333 TYR CD1 HD1 sing N N 334 TYR CD2 CE2 doub Y N 335 TYR CD2 HD2 sing N N 336 TYR CE1 CZ doub Y N 337 TYR CE1 HE1 sing N N 338 TYR CE2 CZ sing Y N 339 TYR CE2 HE2 sing N N 340 TYR CZ OH sing N N 341 TYR OH HH sing N N 342 TYR OXT HXT sing N N 343 VAL N CA sing N N 344 VAL N H sing N N 345 VAL N H2 sing N N 346 VAL CA C sing N N 347 VAL CA CB sing N N 348 VAL CA HA sing N N 349 VAL C O doub N N 350 VAL C OXT sing N N 351 VAL CB CG1 sing N N 352 VAL CB CG2 sing N N 353 VAL CB HB sing N N 354 VAL CG1 HG11 sing N N 355 VAL CG1 HG12 sing N N 356 VAL CG1 HG13 sing N N 357 VAL CG2 HG21 sing N N 358 VAL CG2 HG22 sing N N 359 VAL CG2 HG23 sing N N 360 VAL OXT HXT sing N N 361 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Comision Nacional Cientifica y Technologica (CONICYT)' Chile 1221667 1 'Comision Nacional Cientifica y Technologica (CONICYT)' Chile 'EQM 120208' 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7R8Y _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 61 2 2' _space_group.name_Hall 'P 61 2 (x,y,z+5/12)' _space_group.IT_number 178 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 8G1H _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016832 _atom_sites.fract_transf_matrix[1][2] 0.009718 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019436 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003923 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_