data_8G21 # _entry.id 8G21 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8G21 pdb_00008g21 10.2210/pdb8g21/pdb WWPDB D_1000272047 ? ? BMRB 31073 ? 10.13018/BMR31073 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-05-31 2 'Structure model' 1 1 2023-06-07 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation 3 2 'Structure model' citation_author 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8G21 _pdbx_database_status.recvd_initial_deposition_date 2023-02-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Reelin C-Terminal Region' _pdbx_database_related.db_id 31073 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email joseph_arboleda@meei.harvard.edu _pdbx_contact_author.name_first Joseph _pdbx_contact_author.name_last Arboleda-Velasquez _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3192-9117 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chandrahas, A.S.' 1 0000-0002-7226-8976 'Marino, C.' 2 0000-0002-2332-2163 'Arboleda-Velasquez, J.F.' 3 0000-0002-3192-9117 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Med' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1546-170X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 1243 _citation.page_last 1252 _citation.title ;Resilience to autosomal dominant Alzheimer's disease in a Reelin-COLBOS heterozygous man. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41591-023-02318-3 _citation.pdbx_database_id_PubMed 37188781 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lopera, F.' 1 ? primary 'Marino, C.' 2 0000-0002-2332-2163 primary 'Chandrahas, A.S.' 3 ? primary ;O'Hare, M. ; 4 ? primary 'Villalba-Moreno, N.D.' 5 ? primary 'Aguillon, D.' 6 0000-0003-2283-536X primary 'Baena, A.' 7 ? primary 'Sanchez, J.S.' 8 0000-0003-4421-3078 primary 'Vila-Castelar, C.' 9 0000-0002-8779-1487 primary 'Ramirez Gomez, L.' 10 ? primary 'Chmielewska, N.' 11 ? primary 'Oliveira, G.M.' 12 ? primary 'Littau, J.L.' 13 ? primary 'Hartmann, K.' 14 ? primary 'Park, K.' 15 ? primary 'Krasemann, S.' 16 0000-0001-8795-818X primary 'Glatzel, M.' 17 0000-0002-7720-8817 primary 'Schoemaker, D.' 18 ? primary 'Gonzalez-Buendia, L.' 19 ? primary 'Delgado-Tirado, S.' 20 ? primary 'Arevalo-Alquichire, S.' 21 0000-0002-3366-7384 primary 'Saez-Torres, K.L.' 22 ? primary 'Amarnani, D.' 23 ? primary 'Kim, L.A.' 24 0000-0001-9106-6416 primary 'Mazzarino, R.C.' 25 0000-0001-7954-3283 primary 'Gordon, H.' 26 0009-0005-9561-5706 primary 'Bocanegra, Y.' 27 0000-0003-3064-2509 primary 'Villegas, A.' 28 ? primary 'Gai, X.' 29 ? primary 'Bootwalla, M.' 30 ? primary 'Ji, J.' 31 0000-0003-4941-3538 primary 'Shen, L.' 32 ? primary 'Kosik, K.S.' 33 0000-0003-3224-5179 primary 'Su, Y.' 34 0000-0002-1946-8063 primary 'Chen, Y.' 35 ? primary 'Schultz, A.' 36 ? primary 'Sperling, R.A.' 37 0000-0003-1535-6133 primary 'Johnson, K.' 38 ? primary 'Reiman, E.M.' 39 0000-0002-0705-3696 primary 'Sepulveda-Falla, D.' 40 0000-0003-0176-2042 primary 'Arboleda-Velasquez, J.F.' 41 0000-0002-3192-9117 primary 'Quiroz, Y.T.' 42 0000-0001-9714-8244 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Reelin _entity.formula_weight 4225.879 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.4.21.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-terminal residues 3429-3460' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code STRKQNYMMNFSRQHGLRHFYNRRRRSLRRYP _entity_poly.pdbx_seq_one_letter_code_can STRKQNYMMNFSRQHGLRHFYNRRRRSLRRYP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 THR n 1 3 ARG n 1 4 LYS n 1 5 GLN n 1 6 ASN n 1 7 TYR n 1 8 MET n 1 9 MET n 1 10 ASN n 1 11 PHE n 1 12 SER n 1 13 ARG n 1 14 GLN n 1 15 HIS n 1 16 GLY n 1 17 LEU n 1 18 ARG n 1 19 HIS n 1 20 PHE n 1 21 TYR n 1 22 ASN n 1 23 ARG n 1 24 ARG n 1 25 ARG n 1 26 ARG n 1 27 SER n 1 28 LEU n 1 29 ARG n 1 30 ARG n 1 31 TYR n 1 32 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 32 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene RELN _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET28a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 PRO 32 32 32 PRO PRO A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8G21 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8G21 _struct.title 'Reelin C-Terminal Region' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8G21 _struct_keywords.text 'Alzheimers disease, GAG interaction, SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RELN_HUMAN _struct_ref.pdbx_db_accession P78509 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code STRKQNYMMNFSRQHGLRHFYNRRRRSLRRYP _struct_ref.pdbx_align_begin 3429 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8G21 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 32 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P78509 _struct_ref_seq.db_align_beg 3429 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 3460 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 32 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 2 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 30 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 2 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 30 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 1 -1.32 2 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 2 -0.67 3 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 3 -3.11 4 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 4 -2.60 5 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 5 -2.12 6 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 6 -2.30 7 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 7 -2.71 8 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 8 -10.35 9 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 9 -6.09 10 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 10 -1.72 11 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 11 -5.64 12 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 12 0.16 13 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 13 -2.55 14 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 14 -0.06 15 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 15 -1.04 16 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 16 -2.79 17 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 17 -0.73 18 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 18 -0.07 19 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 19 -4.74 20 TYR 31 A . ? TYR 31 A PRO 32 A ? PRO 32 A 20 -1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 30 ? ? -162.03 115.37 2 2 TYR A 31 ? ? 70.57 134.86 3 3 TYR A 31 ? ? 69.89 138.43 4 4 TYR A 31 ? ? 73.63 151.44 5 8 ARG A 30 ? ? -89.17 39.77 6 9 TYR A 31 ? ? 74.15 145.88 7 12 ARG A 30 ? ? -90.35 53.17 8 13 ARG A 30 ? ? 54.41 80.41 9 15 TYR A 31 ? ? 70.53 132.27 10 16 ARG A 30 ? ? 57.27 81.23 11 18 TYR A 31 ? ? 77.98 134.88 12 19 ARG A 30 ? ? -117.11 -155.64 # _pdbx_nmr_ensemble.entry_id 8G21 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8G21 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '3.3 mM [U-98% 15N] Reelin CTR, 50 % v/v THF (CF3-CD2-OH), 0.25 mM DSS (4,4-dimethyl-4-silapentane-1-sulfonic acid), 50% H2O/50% D2O' _pdbx_nmr_sample_details.solvent_system '50% H2O/50% D2O' _pdbx_nmr_sample_details.label 'Reelin CTR' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '50% (V/V) H2O, 50% (V/V) THF (CF3-CD2-OH), 0.25 mM DSS (4,4-dimethyl-4-silapentane-1-sulfonic acid), ~3.3 mM reelin peptide' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Reelin CTR' 3.3 ? mM '[U-98% 15N]' 1 'THF (CF3-CD2-OH)' 50 ? '% v/v' 'natural abundance' 1 'DSS (4,4-dimethyl-4-silapentane-1-sulfonic acid)' 0.25 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.15 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure . _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label 'standard conditions' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '1H TOCSY' 1 isotropic 2 1 1 '1H NOESY' 1 isotropic 3 1 1 '2D 1H-15N' 1 isotropic 4 1 1 '2D 1H-13C' 1 isotropic # _pdbx_nmr_refine.entry_id 8G21 _pdbx_nmr_refine.method na _pdbx_nmr_refine.details '20 best structures superimposed on backbone atoms (N,CA,C,O)' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS 1.2.1 'Brunger A. T. et.al.' 2 'structure calculation' ARIA 2.3.2 ;Linge, O'Donoghue and Nilges ; 3 'data analysis' PSVS ? 'Bhattacharya and Montelione' 4 'data analysis' 'CcpNmr Analysis' 2.4.2 CCPN 5 'data analysis' NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 6 'data analysis' PyMOL 2.5.4 'Schrodinger and DeLano' 7 'structure calculation' CNS 1.2.1 'Brunger A. T. et.al.' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 GLN N N N N 45 GLN CA C N S 46 GLN C C N N 47 GLN O O N N 48 GLN CB C N N 49 GLN CG C N N 50 GLN CD C N N 51 GLN OE1 O N N 52 GLN NE2 N N N 53 GLN OXT O N N 54 GLN H H N N 55 GLN H2 H N N 56 GLN HA H N N 57 GLN HB2 H N N 58 GLN HB3 H N N 59 GLN HG2 H N N 60 GLN HG3 H N N 61 GLN HE21 H N N 62 GLN HE22 H N N 63 GLN HXT H N N 64 GLY N N N N 65 GLY CA C N N 66 GLY C C N N 67 GLY O O N N 68 GLY OXT O N N 69 GLY H H N N 70 GLY H2 H N N 71 GLY HA2 H N N 72 GLY HA3 H N N 73 GLY HXT H N N 74 HIS N N N N 75 HIS CA C N S 76 HIS C C N N 77 HIS O O N N 78 HIS CB C N N 79 HIS CG C Y N 80 HIS ND1 N Y N 81 HIS CD2 C Y N 82 HIS CE1 C Y N 83 HIS NE2 N Y N 84 HIS OXT O N N 85 HIS H H N N 86 HIS H2 H N N 87 HIS HA H N N 88 HIS HB2 H N N 89 HIS HB3 H N N 90 HIS HD1 H N N 91 HIS HD2 H N N 92 HIS HE1 H N N 93 HIS HE2 H N N 94 HIS HXT H N N 95 LEU N N N N 96 LEU CA C N S 97 LEU C C N N 98 LEU O O N N 99 LEU CB C N N 100 LEU CG C N N 101 LEU CD1 C N N 102 LEU CD2 C N N 103 LEU OXT O N N 104 LEU H H N N 105 LEU H2 H N N 106 LEU HA H N N 107 LEU HB2 H N N 108 LEU HB3 H N N 109 LEU HG H N N 110 LEU HD11 H N N 111 LEU HD12 H N N 112 LEU HD13 H N N 113 LEU HD21 H N N 114 LEU HD22 H N N 115 LEU HD23 H N N 116 LEU HXT H N N 117 LYS N N N N 118 LYS CA C N S 119 LYS C C N N 120 LYS O O N N 121 LYS CB C N N 122 LYS CG C N N 123 LYS CD C N N 124 LYS CE C N N 125 LYS NZ N N N 126 LYS OXT O N N 127 LYS H H N N 128 LYS H2 H N N 129 LYS HA H N N 130 LYS HB2 H N N 131 LYS HB3 H N N 132 LYS HG2 H N N 133 LYS HG3 H N N 134 LYS HD2 H N N 135 LYS HD3 H N N 136 LYS HE2 H N N 137 LYS HE3 H N N 138 LYS HZ1 H N N 139 LYS HZ2 H N N 140 LYS HZ3 H N N 141 LYS HXT H N N 142 MET N N N N 143 MET CA C N S 144 MET C C N N 145 MET O O N N 146 MET CB C N N 147 MET CG C N N 148 MET SD S N N 149 MET CE C N N 150 MET OXT O N N 151 MET H H N N 152 MET H2 H N N 153 MET HA H N N 154 MET HB2 H N N 155 MET HB3 H N N 156 MET HG2 H N N 157 MET HG3 H N N 158 MET HE1 H N N 159 MET HE2 H N N 160 MET HE3 H N N 161 MET HXT H N N 162 PHE N N N N 163 PHE CA C N S 164 PHE C C N N 165 PHE O O N N 166 PHE CB C N N 167 PHE CG C Y N 168 PHE CD1 C Y N 169 PHE CD2 C Y N 170 PHE CE1 C Y N 171 PHE CE2 C Y N 172 PHE CZ C Y N 173 PHE OXT O N N 174 PHE H H N N 175 PHE H2 H N N 176 PHE HA H N N 177 PHE HB2 H N N 178 PHE HB3 H N N 179 PHE HD1 H N N 180 PHE HD2 H N N 181 PHE HE1 H N N 182 PHE HE2 H N N 183 PHE HZ H N N 184 PHE HXT H N N 185 PRO N N N N 186 PRO CA C N S 187 PRO C C N N 188 PRO O O N N 189 PRO CB C N N 190 PRO CG C N N 191 PRO CD C N N 192 PRO OXT O N N 193 PRO H H N N 194 PRO HA H N N 195 PRO HB2 H N N 196 PRO HB3 H N N 197 PRO HG2 H N N 198 PRO HG3 H N N 199 PRO HD2 H N N 200 PRO HD3 H N N 201 PRO HXT H N N 202 SER N N N N 203 SER CA C N S 204 SER C C N N 205 SER O O N N 206 SER CB C N N 207 SER OG O N N 208 SER OXT O N N 209 SER H H N N 210 SER H2 H N N 211 SER HA H N N 212 SER HB2 H N N 213 SER HB3 H N N 214 SER HG H N N 215 SER HXT H N N 216 THR N N N N 217 THR CA C N S 218 THR C C N N 219 THR O O N N 220 THR CB C N R 221 THR OG1 O N N 222 THR CG2 C N N 223 THR OXT O N N 224 THR H H N N 225 THR H2 H N N 226 THR HA H N N 227 THR HB H N N 228 THR HG1 H N N 229 THR HG21 H N N 230 THR HG22 H N N 231 THR HG23 H N N 232 THR HXT H N N 233 TYR N N N N 234 TYR CA C N S 235 TYR C C N N 236 TYR O O N N 237 TYR CB C N N 238 TYR CG C Y N 239 TYR CD1 C Y N 240 TYR CD2 C Y N 241 TYR CE1 C Y N 242 TYR CE2 C Y N 243 TYR CZ C Y N 244 TYR OH O N N 245 TYR OXT O N N 246 TYR H H N N 247 TYR H2 H N N 248 TYR HA H N N 249 TYR HB2 H N N 250 TYR HB3 H N N 251 TYR HD1 H N N 252 TYR HD2 H N N 253 TYR HE1 H N N 254 TYR HE2 H N N 255 TYR HH H N N 256 TYR HXT H N N 257 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 GLN N CA sing N N 43 GLN N H sing N N 44 GLN N H2 sing N N 45 GLN CA C sing N N 46 GLN CA CB sing N N 47 GLN CA HA sing N N 48 GLN C O doub N N 49 GLN C OXT sing N N 50 GLN CB CG sing N N 51 GLN CB HB2 sing N N 52 GLN CB HB3 sing N N 53 GLN CG CD sing N N 54 GLN CG HG2 sing N N 55 GLN CG HG3 sing N N 56 GLN CD OE1 doub N N 57 GLN CD NE2 sing N N 58 GLN NE2 HE21 sing N N 59 GLN NE2 HE22 sing N N 60 GLN OXT HXT sing N N 61 GLY N CA sing N N 62 GLY N H sing N N 63 GLY N H2 sing N N 64 GLY CA C sing N N 65 GLY CA HA2 sing N N 66 GLY CA HA3 sing N N 67 GLY C O doub N N 68 GLY C OXT sing N N 69 GLY OXT HXT sing N N 70 HIS N CA sing N N 71 HIS N H sing N N 72 HIS N H2 sing N N 73 HIS CA C sing N N 74 HIS CA CB sing N N 75 HIS CA HA sing N N 76 HIS C O doub N N 77 HIS C OXT sing N N 78 HIS CB CG sing N N 79 HIS CB HB2 sing N N 80 HIS CB HB3 sing N N 81 HIS CG ND1 sing Y N 82 HIS CG CD2 doub Y N 83 HIS ND1 CE1 doub Y N 84 HIS ND1 HD1 sing N N 85 HIS CD2 NE2 sing Y N 86 HIS CD2 HD2 sing N N 87 HIS CE1 NE2 sing Y N 88 HIS CE1 HE1 sing N N 89 HIS NE2 HE2 sing N N 90 HIS OXT HXT sing N N 91 LEU N CA sing N N 92 LEU N H sing N N 93 LEU N H2 sing N N 94 LEU CA C sing N N 95 LEU CA CB sing N N 96 LEU CA HA sing N N 97 LEU C O doub N N 98 LEU C OXT sing N N 99 LEU CB CG sing N N 100 LEU CB HB2 sing N N 101 LEU CB HB3 sing N N 102 LEU CG CD1 sing N N 103 LEU CG CD2 sing N N 104 LEU CG HG sing N N 105 LEU CD1 HD11 sing N N 106 LEU CD1 HD12 sing N N 107 LEU CD1 HD13 sing N N 108 LEU CD2 HD21 sing N N 109 LEU CD2 HD22 sing N N 110 LEU CD2 HD23 sing N N 111 LEU OXT HXT sing N N 112 LYS N CA sing N N 113 LYS N H sing N N 114 LYS N H2 sing N N 115 LYS CA C sing N N 116 LYS CA CB sing N N 117 LYS CA HA sing N N 118 LYS C O doub N N 119 LYS C OXT sing N N 120 LYS CB CG sing N N 121 LYS CB HB2 sing N N 122 LYS CB HB3 sing N N 123 LYS CG CD sing N N 124 LYS CG HG2 sing N N 125 LYS CG HG3 sing N N 126 LYS CD CE sing N N 127 LYS CD HD2 sing N N 128 LYS CD HD3 sing N N 129 LYS CE NZ sing N N 130 LYS CE HE2 sing N N 131 LYS CE HE3 sing N N 132 LYS NZ HZ1 sing N N 133 LYS NZ HZ2 sing N N 134 LYS NZ HZ3 sing N N 135 LYS OXT HXT sing N N 136 MET N CA sing N N 137 MET N H sing N N 138 MET N H2 sing N N 139 MET CA C sing N N 140 MET CA CB sing N N 141 MET CA HA sing N N 142 MET C O doub N N 143 MET C OXT sing N N 144 MET CB CG sing N N 145 MET CB HB2 sing N N 146 MET CB HB3 sing N N 147 MET CG SD sing N N 148 MET CG HG2 sing N N 149 MET CG HG3 sing N N 150 MET SD CE sing N N 151 MET CE HE1 sing N N 152 MET CE HE2 sing N N 153 MET CE HE3 sing N N 154 MET OXT HXT sing N N 155 PHE N CA sing N N 156 PHE N H sing N N 157 PHE N H2 sing N N 158 PHE CA C sing N N 159 PHE CA CB sing N N 160 PHE CA HA sing N N 161 PHE C O doub N N 162 PHE C OXT sing N N 163 PHE CB CG sing N N 164 PHE CB HB2 sing N N 165 PHE CB HB3 sing N N 166 PHE CG CD1 doub Y N 167 PHE CG CD2 sing Y N 168 PHE CD1 CE1 sing Y N 169 PHE CD1 HD1 sing N N 170 PHE CD2 CE2 doub Y N 171 PHE CD2 HD2 sing N N 172 PHE CE1 CZ doub Y N 173 PHE CE1 HE1 sing N N 174 PHE CE2 CZ sing Y N 175 PHE CE2 HE2 sing N N 176 PHE CZ HZ sing N N 177 PHE OXT HXT sing N N 178 PRO N CA sing N N 179 PRO N CD sing N N 180 PRO N H sing N N 181 PRO CA C sing N N 182 PRO CA CB sing N N 183 PRO CA HA sing N N 184 PRO C O doub N N 185 PRO C OXT sing N N 186 PRO CB CG sing N N 187 PRO CB HB2 sing N N 188 PRO CB HB3 sing N N 189 PRO CG CD sing N N 190 PRO CG HG2 sing N N 191 PRO CG HG3 sing N N 192 PRO CD HD2 sing N N 193 PRO CD HD3 sing N N 194 PRO OXT HXT sing N N 195 SER N CA sing N N 196 SER N H sing N N 197 SER N H2 sing N N 198 SER CA C sing N N 199 SER CA CB sing N N 200 SER CA HA sing N N 201 SER C O doub N N 202 SER C OXT sing N N 203 SER CB OG sing N N 204 SER CB HB2 sing N N 205 SER CB HB3 sing N N 206 SER OG HG sing N N 207 SER OXT HXT sing N N 208 THR N CA sing N N 209 THR N H sing N N 210 THR N H2 sing N N 211 THR CA C sing N N 212 THR CA CB sing N N 213 THR CA HA sing N N 214 THR C O doub N N 215 THR C OXT sing N N 216 THR CB OG1 sing N N 217 THR CB CG2 sing N N 218 THR CB HB sing N N 219 THR OG1 HG1 sing N N 220 THR CG2 HG21 sing N N 221 THR CG2 HG22 sing N N 222 THR CG2 HG23 sing N N 223 THR OXT HXT sing N N 224 TYR N CA sing N N 225 TYR N H sing N N 226 TYR N H2 sing N N 227 TYR CA C sing N N 228 TYR CA CB sing N N 229 TYR CA HA sing N N 230 TYR C O doub N N 231 TYR C OXT sing N N 232 TYR CB CG sing N N 233 TYR CB HB2 sing N N 234 TYR CB HB3 sing N N 235 TYR CG CD1 doub Y N 236 TYR CG CD2 sing Y N 237 TYR CD1 CE1 sing Y N 238 TYR CD1 HD1 sing N N 239 TYR CD2 CE2 doub Y N 240 TYR CD2 HD2 sing N N 241 TYR CE1 CZ doub Y N 242 TYR CE1 HE1 sing N N 243 TYR CE2 CZ sing Y N 244 TYR CE2 HE2 sing N N 245 TYR CZ OH sing N N 246 TYR OH HH sing N N 247 TYR OXT HXT sing N N 248 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 'United States' 'UH3 NS100121' 1 'National Institutes of Health/National Institute on Aging (NIH/NIA)' 'United States' 'RF1 NS110048' 2 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'Direct Drive' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Agilent _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 8G21 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_