data_8GCL # _entry.id 8GCL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.373 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8GCL pdb_00008gcl 10.2210/pdb8gcl/pdb WWPDB D_1000272597 ? ? EMDB EMD-29934 ? ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'Cryo-EM structure of hAQP2 in DDM' _pdbx_database_related.db_id EMD-29934 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8GCL _pdbx_database_status.recvd_initial_deposition_date 2023-03-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kamegawa, A.' 1 ? 'Suzuki, S.' 2 ? 'Nishikawa, K.' 3 ? 'Numoto, N.' 4 ? 'Suzuki, H.' 5 ? 'Fujiyoshi, Y.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Struct.Biol. _citation.journal_id_ASTM JSBIEM _citation.journal_id_CSD 0803 _citation.journal_id_ISSN 1095-8657 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 215 _citation.language ? _citation.page_first 107984 _citation.page_last 107984 _citation.title 'Structural analysis of the water channel AQP2 by single-particle cryo-EM.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jsb.2023.107984 _citation.pdbx_database_id_PubMed 37315821 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kamegawa, A.' 1 ? primary 'Suzuki, S.' 2 ? primary 'Suzuki, H.' 3 ? primary 'Nishikawa, K.' 4 ? primary 'Numoto, N.' 5 ? primary 'Fujiyoshi, Y.' 6 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8GCL _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8GCL _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Aquaporin-2 _entity.formula_weight 28862.389 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;AQP-2,ADH water channel,Aquaporin-CD,AQP-CD,Collecting duct water channel protein,WCH-CD,Water channel protein for renal collecting duct ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLGIGTLVQALGHISGAHINPAVTVACLVGCH VSVLRAAFYVAAQLLGAVAGAALLHEITPADIRGDLAVNALSNSTTAGQAVTVELFLTLQLVLCIFASTDERRGENPGTP ALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGL EPDTDWEEREVRRRQSVELHSPQSLPRGTKA ; _entity_poly.pdbx_seq_one_letter_code_can ;MWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLGIGTLVQALGHISGAHINPAVTVACLVGCH VSVLRAAFYVAAQLLGAVAGAALLHEITPADIRGDLAVNALSNSTTAGQAVTVELFLTLQLVLCIFASTDERRGENPGTP ALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGL EPDTDWEEREVRRRQSVELHSPQSLPRGTKA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 TRP n 1 3 GLU n 1 4 LEU n 1 5 ARG n 1 6 SER n 1 7 ILE n 1 8 ALA n 1 9 PHE n 1 10 SER n 1 11 ARG n 1 12 ALA n 1 13 VAL n 1 14 PHE n 1 15 ALA n 1 16 GLU n 1 17 PHE n 1 18 LEU n 1 19 ALA n 1 20 THR n 1 21 LEU n 1 22 LEU n 1 23 PHE n 1 24 VAL n 1 25 PHE n 1 26 PHE n 1 27 GLY n 1 28 LEU n 1 29 GLY n 1 30 SER n 1 31 ALA n 1 32 LEU n 1 33 ASN n 1 34 TRP n 1 35 PRO n 1 36 GLN n 1 37 ALA n 1 38 LEU n 1 39 PRO n 1 40 SER n 1 41 VAL n 1 42 LEU n 1 43 GLN n 1 44 ILE n 1 45 ALA n 1 46 MET n 1 47 ALA n 1 48 PHE n 1 49 GLY n 1 50 LEU n 1 51 GLY n 1 52 ILE n 1 53 GLY n 1 54 THR n 1 55 LEU n 1 56 VAL n 1 57 GLN n 1 58 ALA n 1 59 LEU n 1 60 GLY n 1 61 HIS n 1 62 ILE n 1 63 SER n 1 64 GLY n 1 65 ALA n 1 66 HIS n 1 67 ILE n 1 68 ASN n 1 69 PRO n 1 70 ALA n 1 71 VAL n 1 72 THR n 1 73 VAL n 1 74 ALA n 1 75 CYS n 1 76 LEU n 1 77 VAL n 1 78 GLY n 1 79 CYS n 1 80 HIS n 1 81 VAL n 1 82 SER n 1 83 VAL n 1 84 LEU n 1 85 ARG n 1 86 ALA n 1 87 ALA n 1 88 PHE n 1 89 TYR n 1 90 VAL n 1 91 ALA n 1 92 ALA n 1 93 GLN n 1 94 LEU n 1 95 LEU n 1 96 GLY n 1 97 ALA n 1 98 VAL n 1 99 ALA n 1 100 GLY n 1 101 ALA n 1 102 ALA n 1 103 LEU n 1 104 LEU n 1 105 HIS n 1 106 GLU n 1 107 ILE n 1 108 THR n 1 109 PRO n 1 110 ALA n 1 111 ASP n 1 112 ILE n 1 113 ARG n 1 114 GLY n 1 115 ASP n 1 116 LEU n 1 117 ALA n 1 118 VAL n 1 119 ASN n 1 120 ALA n 1 121 LEU n 1 122 SER n 1 123 ASN n 1 124 SER n 1 125 THR n 1 126 THR n 1 127 ALA n 1 128 GLY n 1 129 GLN n 1 130 ALA n 1 131 VAL n 1 132 THR n 1 133 VAL n 1 134 GLU n 1 135 LEU n 1 136 PHE n 1 137 LEU n 1 138 THR n 1 139 LEU n 1 140 GLN n 1 141 LEU n 1 142 VAL n 1 143 LEU n 1 144 CYS n 1 145 ILE n 1 146 PHE n 1 147 ALA n 1 148 SER n 1 149 THR n 1 150 ASP n 1 151 GLU n 1 152 ARG n 1 153 ARG n 1 154 GLY n 1 155 GLU n 1 156 ASN n 1 157 PRO n 1 158 GLY n 1 159 THR n 1 160 PRO n 1 161 ALA n 1 162 LEU n 1 163 SER n 1 164 ILE n 1 165 GLY n 1 166 PHE n 1 167 SER n 1 168 VAL n 1 169 ALA n 1 170 LEU n 1 171 GLY n 1 172 HIS n 1 173 LEU n 1 174 LEU n 1 175 GLY n 1 176 ILE n 1 177 HIS n 1 178 TYR n 1 179 THR n 1 180 GLY n 1 181 CYS n 1 182 SER n 1 183 MET n 1 184 ASN n 1 185 PRO n 1 186 ALA n 1 187 ARG n 1 188 SER n 1 189 LEU n 1 190 ALA n 1 191 PRO n 1 192 ALA n 1 193 VAL n 1 194 VAL n 1 195 THR n 1 196 GLY n 1 197 LYS n 1 198 PHE n 1 199 ASP n 1 200 ASP n 1 201 HIS n 1 202 TRP n 1 203 VAL n 1 204 PHE n 1 205 TRP n 1 206 ILE n 1 207 GLY n 1 208 PRO n 1 209 LEU n 1 210 VAL n 1 211 GLY n 1 212 ALA n 1 213 ILE n 1 214 LEU n 1 215 GLY n 1 216 SER n 1 217 LEU n 1 218 LEU n 1 219 TYR n 1 220 ASN n 1 221 TYR n 1 222 VAL n 1 223 LEU n 1 224 PHE n 1 225 PRO n 1 226 PRO n 1 227 ALA n 1 228 LYS n 1 229 SER n 1 230 LEU n 1 231 SER n 1 232 GLU n 1 233 ARG n 1 234 LEU n 1 235 ALA n 1 236 VAL n 1 237 LEU n 1 238 LYS n 1 239 GLY n 1 240 LEU n 1 241 GLU n 1 242 PRO n 1 243 ASP n 1 244 THR n 1 245 ASP n 1 246 TRP n 1 247 GLU n 1 248 GLU n 1 249 ARG n 1 250 GLU n 1 251 VAL n 1 252 ARG n 1 253 ARG n 1 254 ARG n 1 255 GLN n 1 256 SER n 1 257 VAL n 1 258 GLU n 1 259 LEU n 1 260 HIS n 1 261 SER n 1 262 PRO n 1 263 GLN n 1 264 SER n 1 265 LEU n 1 266 PRO n 1 267 ARG n 1 268 GLY n 1 269 THR n 1 270 LYS n 1 271 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 271 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene AQP2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AQP2_HUMAN _struct_ref.pdbx_db_accession P41181 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLGIGTLVQALGHISGAHINPAVTVACLVGCH VSVLRAAFYVAAQLLGAVAGAALLHEITPADIRGDLAVNALSNSTTAGQAVTVELFLTLQLVLCIFASTDERRGENPGTP ALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGL EPDTDWEEREVRRRQSVELHSPQSLPRGTKA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8GCL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 271 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P41181 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 271 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 271 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8GCL _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 91.506 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.838 _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8GCL _refine.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.90 _refine.ls_d_res_low 94.08 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 56865 _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100.00 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.35629 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.35629 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'PARAMETERS FOR MASK CACLULATION' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.194 _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id ? _refine.overall_SU_B 11.101 _refine.overall_SU_ML 0.207 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high . _refine_hist.d_res_low . _refine_hist.number_atoms_solvent ? _refine_hist.number_atoms_total 1754 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein ? _refine_hist.pdbx_number_atoms_nucleic_acid ? _refine_hist.pdbx_number_atoms_ligand ? _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'ELECTRON MICROSCOPY' ? 0.008 0.011 1795 ? r_bond_refined_d ? ? 'ELECTRON MICROSCOPY' ? 0.000 0.016 1714 ? r_bond_other_d ? ? 'ELECTRON MICROSCOPY' ? 1.242 1.605 2455 ? r_angle_refined_deg ? ? 'ELECTRON MICROSCOPY' ? 0.390 1.535 3948 ? r_angle_other_deg ? ? 'ELECTRON MICROSCOPY' ? 3.540 5.000 238 ? r_dihedral_angle_1_deg ? ? 'ELECTRON MICROSCOPY' ? 6.751 10.000 7 ? r_dihedral_angle_2_deg ? ? 'ELECTRON MICROSCOPY' ? 17.003 10.000 259 ? r_dihedral_angle_3_deg ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_dihedral_angle_4_deg ? ? 'ELECTRON MICROSCOPY' ? 0.061 0.200 300 ? r_chiral_restr ? ? 'ELECTRON MICROSCOPY' ? 0.006 0.020 2042 ? r_gen_planes_refined ? ? 'ELECTRON MICROSCOPY' ? 0.001 0.020 366 ? r_gen_planes_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbd_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbd_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbtor_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbtor_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_metal_ion_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_metal_ion_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_vdw_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_hbond_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'ELECTRON MICROSCOPY' ? 11.471 8.857 955 ? r_mcbond_it ? ? 'ELECTRON MICROSCOPY' ? 11.471 8.857 955 ? r_mcbond_other ? ? 'ELECTRON MICROSCOPY' ? 17.127 13.344 1192 ? r_mcangle_it ? ? 'ELECTRON MICROSCOPY' ? 17.119 13.380 1193 ? r_mcangle_other ? ? 'ELECTRON MICROSCOPY' ? 11.387 9.698 840 ? r_scbond_it ? ? 'ELECTRON MICROSCOPY' ? 11.381 9.730 841 ? r_scbond_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_scangle_it ? ? 'ELECTRON MICROSCOPY' ? 17.098 14.130 1264 ? r_scangle_other ? ? 'ELECTRON MICROSCOPY' ? 25.357 ? 7762 ? r_long_range_B_refined ? ? 'ELECTRON MICROSCOPY' ? 25.355 ? 7763 ? r_long_range_B_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_rigid_bond_restr ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_sphericity_free ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine_ls_shell.d_res_high 2.900 _refine_ls_shell.d_res_low 2.975 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 0 _refine_ls_shell.number_reflns_R_work 4182 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 1.359 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.000 # loop_ _struct_ncs_oper.id _struct_ncs_oper.code _struct_ncs_oper.details _struct_ncs_oper.matrix[1][1] _struct_ncs_oper.matrix[1][2] _struct_ncs_oper.matrix[1][3] _struct_ncs_oper.matrix[2][1] _struct_ncs_oper.matrix[2][2] _struct_ncs_oper.matrix[2][3] _struct_ncs_oper.matrix[3][1] _struct_ncs_oper.matrix[3][2] _struct_ncs_oper.matrix[3][3] _struct_ncs_oper.vector[1] _struct_ncs_oper.vector[2] _struct_ncs_oper.vector[3] 1 given ? 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000 2 generate ? 0.000000 -1.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 1.000000 99.84000 0.00000 0.00000 3 generate ? -1.000000 -0.000000 0.000000 0.000000 -1.000000 0.000000 0.000000 0.000000 1.000000 99.84000 99.84000 0.00000 4 generate ? -0.000000 1.000000 0.000000 -1.000000 -0.000000 0.000000 0.000000 0.000000 1.000000 0.00000 99.84000 0.00000 # _struct.entry_id 8GCL _struct.title 'Cryo-EM structure of hAQP2 in DDM' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8GCL _struct_keywords.text 'channel, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 6 ? ALA A 31 ? SER A 6 ALA A 31 1 ? 26 HELX_P HELX_P2 AA2 SER A 40 ? GLY A 64 ? SER A 40 GLY A 64 1 ? 25 HELX_P HELX_P3 AA3 ASN A 68 ? GLY A 78 ? ASN A 68 GLY A 78 1 ? 11 HELX_P HELX_P4 AA4 SER A 82 ? THR A 108 ? SER A 82 THR A 108 1 ? 27 HELX_P HELX_P5 AA5 PRO A 109 ? GLY A 114 ? PRO A 109 GLY A 114 1 ? 6 HELX_P HELX_P6 AA6 THR A 126 ? THR A 149 ? THR A 126 THR A 149 1 ? 24 HELX_P HELX_P7 AA7 ASP A 150 ? GLY A 154 ? ASP A 150 GLY A 154 5 ? 5 HELX_P HELX_P8 AA8 THR A 159 ? GLY A 180 ? THR A 159 GLY A 180 1 ? 22 HELX_P HELX_P9 AA9 ASN A 184 ? GLY A 196 ? ASN A 184 GLY A 196 1 ? 13 HELX_P HELX_P10 AB1 TRP A 202 ? VAL A 222 ? TRP A 202 VAL A 222 1 ? 21 HELX_P HELX_P11 AB2 SER A 229 ? LYS A 238 ? SER A 229 LYS A 238 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 8GCL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 TRP 2 2 ? ? ? A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 CYS 144 144 144 CYS CYS A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 HIS 177 177 177 HIS HIS A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 CYS 181 181 181 CYS CYS A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 MET 183 183 183 MET MET A . n A 1 184 ASN 184 184 184 ASN ASN A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 ARG 187 187 187 ARG ARG A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 PHE 198 198 198 PHE PHE A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 HIS 201 201 201 HIS HIS A . n A 1 202 TRP 202 202 202 TRP TRP A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 PHE 204 204 204 PHE PHE A . n A 1 205 TRP 205 205 205 TRP TRP A . n A 1 206 ILE 206 206 206 ILE ILE A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 ILE 213 213 213 ILE ILE A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 GLY 215 215 215 GLY GLY A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 TYR 219 219 219 TYR TYR A . n A 1 220 ASN 220 220 220 ASN ASN A . n A 1 221 TYR 221 221 221 TYR TYR A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 PHE 224 224 224 PHE PHE A . n A 1 225 PRO 225 225 225 PRO PRO A . n A 1 226 PRO 226 226 226 PRO PRO A . n A 1 227 ALA 227 227 227 ALA ALA A . n A 1 228 LYS 228 228 228 LYS LYS A . n A 1 229 SER 229 229 229 SER SER A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 SER 231 231 231 SER SER A . n A 1 232 GLU 232 232 232 GLU GLU A . n A 1 233 ARG 233 233 233 ARG ARG A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 ALA 235 235 235 ALA ALA A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 LYS 238 238 238 LYS LYS A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 GLU 241 241 241 GLU GLU A . n A 1 242 PRO 242 242 ? ? ? A . n A 1 243 ASP 243 243 ? ? ? A . n A 1 244 THR 244 244 ? ? ? A . n A 1 245 ASP 245 245 ? ? ? A . n A 1 246 TRP 246 246 ? ? ? A . n A 1 247 GLU 247 247 ? ? ? A . n A 1 248 GLU 248 248 ? ? ? A . n A 1 249 ARG 249 249 ? ? ? A . n A 1 250 GLU 250 250 ? ? ? A . n A 1 251 VAL 251 251 ? ? ? A . n A 1 252 ARG 252 252 ? ? ? A . n A 1 253 ARG 253 253 ? ? ? A . n A 1 254 ARG 254 254 ? ? ? A . n A 1 255 GLN 255 255 ? ? ? A . n A 1 256 SER 256 256 ? ? ? A . n A 1 257 VAL 257 257 ? ? ? A . n A 1 258 GLU 258 258 ? ? ? A . n A 1 259 LEU 259 259 ? ? ? A . n A 1 260 HIS 260 260 ? ? ? A . n A 1 261 SER 261 261 ? ? ? A . n A 1 262 PRO 262 262 ? ? ? A . n A 1 263 GLN 263 263 ? ? ? A . n A 1 264 SER 264 264 ? ? ? A . n A 1 265 LEU 265 265 ? ? ? A . n A 1 266 PRO 266 266 ? ? ? A . n A 1 267 ARG 267 267 ? ? ? A . n A 1 268 GLY 268 268 ? ? ? A . n A 1 269 THR 269 269 ? ? ? A . n A 1 270 LYS 270 270 ? ? ? A . n A 1 271 ALA 271 271 ? ? ? A . n # _pdbx_contact_author.id 3 _pdbx_contact_author.email yoshi.cesp@tmd.ac.jp _pdbx_contact_author.name_first Yoshinori _pdbx_contact_author.name_last Fujiyoshi _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8070-1493 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 'complete point assembly' ? tetrameric 4 2 'point asymmetric unit' ? monomeric 1 3 'point asymmetric unit, std point frame' ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 '(1-4)' A 2 1 A 3 P A # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] P 'transform to point frame' ? ? -0.96431433 -0.26476005 0.00000000 61.35539 0.26476005 -0.96431433 0.00000000 34.92175 0.00000000 0.00000000 1.00000000 -46.22312 1 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 2 'point symmetry operation' ? ? 0.00000000 -1.00000000 0.00000000 99.84000 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 3 'point symmetry operation' ? ? -1.00000000 0.00000000 0.00000000 99.83999 0.00000000 -1.00000000 0.00000000 99.84000 0.00000000 0.00000000 1.00000000 0.00000 4 'point symmetry operation' ? ? 0.00000000 1.00000000 0.00000000 0.00000 -1.00000000 0.00000000 0.00000000 99.84000 0.00000000 0.00000000 1.00000000 0.00000 # _pdbx_point_symmetry.entry_id 8GCL _pdbx_point_symmetry.Schoenflies_symbol C _pdbx_point_symmetry.circular_symmetry 4 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-06-21 2 'Structure model' 1 1 2023-07-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_citation_author.name' # _software.citation_id ? _software.classification refinement _software.compiler_name ? _software.compiler_version ? _software.contact_author ? _software.contact_author_email ? _software.date ? _software.description ? _software.dependencies ? _software.hardware ? _software.language ? _software.location ? _software.mods ? _software.name REFMAC _software.os ? _software.os_version ? _software.type ? _software.version 5.8.0352 _software.pdbx_ordinal 1 # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 8GCL _em_3d_fitting.method ? _em_3d_fitting.target_criteria ? _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_space ? _em_3d_fitting.ref_protocol ? # _em_3d_reconstruction.entry_id 8GCL _em_3d_reconstruction.id 1 _em_3d_reconstruction.method ? _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.details ? _em_3d_reconstruction.resolution 2.89 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.num_particles 236700 _em_3d_reconstruction.euler_angles_details ? _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.symmetry_type POINT # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name ? _em_buffer.details ? _em_buffer.pH 8 # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type COMPLEX _em_entity_assembly.name 'tetrameter of hAQP2' _em_entity_assembly.details ? _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? _em_entity_assembly.entity_id_list 1 # _em_imaging.entry_id 8GCL _em_imaging.id 1 _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.residual_tilt ? _em_imaging.microscope_model 'JEOL CRYO ARM 300' _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model ? _em_imaging.details ? _em_imaging.date ? _em_imaging.accelerating_voltage 300 _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_min 1200 _em_imaging.nominal_defocus_max 2500 _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_defocus_max ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_magnification ? _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.citation_id ? _em_imaging.temperature ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_minimum ? _em_imaging.recording_temperature_maximum ? _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.specimen_id 1 _em_imaging.cryogen ? # _em_sample_support.id 1 _em_sample_support.film_material ? _em_sample_support.method ? _em_sample_support.grid_material MOLYBDENUM _em_sample_support.grid_mesh_size 200 _em_sample_support.grid_type 'Quantifoil R1.2/1.3' _em_sample_support.details ? _em_sample_support.specimen_id 1 _em_sample_support.citation_id ? # _em_vitrification.entry_id 8GCL _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity 100 _em_vitrification.temp ? _em_vitrification.chamber_temperature 295 _em_vitrification.instrument ? _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? _em_vitrification.details ? # _em_experiment.entry_id 8GCL _em_experiment.id 1 _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.aggregation_state PARTICLE _em_experiment.entity_assembly_id 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 181 ? ? 59.05 74.69 2 1 SER A 182 ? ? -58.38 -71.71 3 1 MET A 183 ? ? 58.54 3.42 4 1 VAL A 222 ? ? -124.16 -52.94 5 1 LYS A 238 ? ? -93.79 47.19 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 5 ? CG ? A ARG 5 CG 2 1 Y 1 A ARG 5 ? CD ? A ARG 5 CD 3 1 Y 1 A ARG 5 ? NE ? A ARG 5 NE 4 1 Y 1 A ARG 5 ? CZ ? A ARG 5 CZ 5 1 Y 1 A ARG 5 ? NH1 ? A ARG 5 NH1 6 1 Y 1 A ARG 5 ? NH2 ? A ARG 5 NH2 7 1 Y 1 A GLU 241 ? CG ? A GLU 241 CG 8 1 Y 1 A GLU 241 ? CD ? A GLU 241 CD 9 1 Y 1 A GLU 241 ? OE1 ? A GLU 241 OE1 10 1 Y 1 A GLU 241 ? OE2 ? A GLU 241 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A TRP 2 ? A TRP 2 3 1 Y 1 A PRO 242 ? A PRO 242 4 1 Y 1 A ASP 243 ? A ASP 243 5 1 Y 1 A THR 244 ? A THR 244 6 1 Y 1 A ASP 245 ? A ASP 245 7 1 Y 1 A TRP 246 ? A TRP 246 8 1 Y 1 A GLU 247 ? A GLU 247 9 1 Y 1 A GLU 248 ? A GLU 248 10 1 Y 1 A ARG 249 ? A ARG 249 11 1 Y 1 A GLU 250 ? A GLU 250 12 1 Y 1 A VAL 251 ? A VAL 251 13 1 Y 1 A ARG 252 ? A ARG 252 14 1 Y 1 A ARG 253 ? A ARG 253 15 1 Y 1 A ARG 254 ? A ARG 254 16 1 Y 1 A GLN 255 ? A GLN 255 17 1 Y 1 A SER 256 ? A SER 256 18 1 Y 1 A VAL 257 ? A VAL 257 19 1 Y 1 A GLU 258 ? A GLU 258 20 1 Y 1 A LEU 259 ? A LEU 259 21 1 Y 1 A HIS 260 ? A HIS 260 22 1 Y 1 A SER 261 ? A SER 261 23 1 Y 1 A PRO 262 ? A PRO 262 24 1 Y 1 A GLN 263 ? A GLN 263 25 1 Y 1 A SER 264 ? A SER 264 26 1 Y 1 A LEU 265 ? A LEU 265 27 1 Y 1 A PRO 266 ? A PRO 266 28 1 Y 1 A ARG 267 ? A ARG 267 29 1 Y 1 A GLY 268 ? A GLY 268 30 1 Y 1 A THR 269 ? A THR 269 31 1 Y 1 A LYS 270 ? A LYS 270 32 1 Y 1 A ALA 271 ? A ALA 271 # _em_ctf_correction.details ? _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.units ? _em_entity_assembly_molwt.value ? # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.ncbi_tax_id 9606 _em_entity_assembly_naturalsource.organism 'Homo sapiens' _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.ncbi_tax_id 7108 _em_entity_assembly_recombinant.organism 'Spodoptera frugiperda' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain ? # _em_image_processing.details ? _em_image_processing.id 1 _em_image_processing.image_recording_id 1 # _em_image_recording.average_exposure_time ? _em_image_recording.avg_electron_dose_per_subtomogram ? _em_image_recording.avg_electron_dose_per_image 69.6 _em_image_recording.details ? _em_image_recording.detector_mode COUNTING _em_image_recording.film_or_detector_model 'GATAN K2 SUMMIT (4k x 4k)' _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # loop_ _em_software.category _em_software.details _em_software.id _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id _em_software.name _em_software.version 'PARTICLE SELECTION' ? 1 1 ? ? ? ? 'IMAGE ACQUISITION' ? 2 ? ? 1 ? ? MASKING ? 3 ? ? ? ? ? 'CTF CORRECTION' ? 4 1 ? ? ? ? 'LAYERLINE INDEXING' ? 5 ? ? ? ? ? 'DIFFRACTION INDEXING' ? 6 ? ? ? ? ? 'MODEL FITTING' ? 7 ? ? ? ? ? 'MODEL REFINEMENT' ? 8 ? ? ? ? ? OTHER ? 9 ? ? ? ? ? 'INITIAL EULER ASSIGNMENT' ? 10 1 ? ? ? ? 'FINAL EULER ASSIGNMENT' ? 11 1 ? ? ? ? CLASSIFICATION ? 12 1 ? ? ? ? RECONSTRUCTION ? 13 1 ? ? ? ? 'VOLUME SELECTION' ? 14 1 1 1 ? ? 'SERIES ALIGNMENT' ? 15 1 1 1 ? ? 'MOLECULAR REPLACEMENT' ? 16 1 1 1 ? ? 'LATTICE DISTORTION CORRECTION' ? 17 1 1 1 ? ? 'SYMMETRY DETERMINATION' ? 18 1 1 1 ? ? 'CRYSTALLOGRAPHY MERGING' ? 19 1 1 1 ? ? # _em_specimen.concentration 7.2 _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 20H00451 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #