data_8GL3 # _entry.id 8GL3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8GL3 pdb_00008gl3 10.2210/pdb8gl3/pdb WWPDB D_1000273112 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8GL3 _pdbx_database_status.recvd_initial_deposition_date 2023-03-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Goldbach, N.' 1 ? 'Bera, A.K.' 2 ? 'Baker, D.' 3 ? 'Kang, A.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 32 _citation.language ? _citation.page_first e4769 _citation.page_last e4769 _citation.title 'De novo design of monomeric helical bundles for pH-controlled membrane lysis.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.4769 _citation.pdbx_database_id_PubMed 37632837 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Goldbach, N.' 1 0000-0001-5401-3892 primary 'Benna, I.' 2 ? primary 'Wicky, B.I.M.' 3 ? primary 'Croft, J.T.' 4 ? primary 'Carter, L.' 5 ? primary 'Bera, A.K.' 6 ? primary 'Nguyen, H.' 7 ? primary 'Kang, A.' 8 ? primary 'Sankaran, B.' 9 ? primary 'Yang, E.C.' 10 ? primary 'Lee, K.K.' 11 ? primary 'Baker, D.' 12 0000-0001-7896-6217 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.430 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8GL3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 32.120 _cell.length_a_esd ? _cell.length_b 44.703 _cell.length_b_esd ? _cell.length_c 182.579 _cell.length_c_esd ? _cell.volume 262150.566 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8GL3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y (x,y,-x+z)' _symmetry.space_group_name_H-M 'I 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man pRLB-519 27599.225 1 ? ? ? ? 2 water nat water 18.015 31 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ENLYFQGSEEAREVAEEILRLLREHEELLREHERLLKEARELAERLEELARRLEELARRGEKDEEAVRQVEEAAREAERV ARELEKSARRLQESIRELRRLLKELRELLRELKKKASEEERKIAEELERIAEEAQRILEETERILRETVRIAQEAVRLLQ EARRRAKKGGSGSGENLYFQGGSGSEEIEKLAREIKRAVEELQKALEENERAIRLNKEAARKFEEAVEKFRK ; _entity_poly.pdbx_seq_one_letter_code_can ;ENLYFQGSEEAREVAEEILRLLREHEELLREHERLLKEARELAERLEELARRLEELARRGEKDEEAVRQVEEAAREAERV ARELEKSARRLQESIRELRRLLKELRELLRELKKKASEEERKIAEELERIAEEAQRILEETERILRETVRIAQEAVRLLQ EARRRAKKGGSGSGENLYFQGGSGSEEIEKLAREIKRAVEELQKALEENERAIRLNKEAARKFEEAVEKFRK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ASN n 1 3 LEU n 1 4 TYR n 1 5 PHE n 1 6 GLN n 1 7 GLY n 1 8 SER n 1 9 GLU n 1 10 GLU n 1 11 ALA n 1 12 ARG n 1 13 GLU n 1 14 VAL n 1 15 ALA n 1 16 GLU n 1 17 GLU n 1 18 ILE n 1 19 LEU n 1 20 ARG n 1 21 LEU n 1 22 LEU n 1 23 ARG n 1 24 GLU n 1 25 HIS n 1 26 GLU n 1 27 GLU n 1 28 LEU n 1 29 LEU n 1 30 ARG n 1 31 GLU n 1 32 HIS n 1 33 GLU n 1 34 ARG n 1 35 LEU n 1 36 LEU n 1 37 LYS n 1 38 GLU n 1 39 ALA n 1 40 ARG n 1 41 GLU n 1 42 LEU n 1 43 ALA n 1 44 GLU n 1 45 ARG n 1 46 LEU n 1 47 GLU n 1 48 GLU n 1 49 LEU n 1 50 ALA n 1 51 ARG n 1 52 ARG n 1 53 LEU n 1 54 GLU n 1 55 GLU n 1 56 LEU n 1 57 ALA n 1 58 ARG n 1 59 ARG n 1 60 GLY n 1 61 GLU n 1 62 LYS n 1 63 ASP n 1 64 GLU n 1 65 GLU n 1 66 ALA n 1 67 VAL n 1 68 ARG n 1 69 GLN n 1 70 VAL n 1 71 GLU n 1 72 GLU n 1 73 ALA n 1 74 ALA n 1 75 ARG n 1 76 GLU n 1 77 ALA n 1 78 GLU n 1 79 ARG n 1 80 VAL n 1 81 ALA n 1 82 ARG n 1 83 GLU n 1 84 LEU n 1 85 GLU n 1 86 LYS n 1 87 SER n 1 88 ALA n 1 89 ARG n 1 90 ARG n 1 91 LEU n 1 92 GLN n 1 93 GLU n 1 94 SER n 1 95 ILE n 1 96 ARG n 1 97 GLU n 1 98 LEU n 1 99 ARG n 1 100 ARG n 1 101 LEU n 1 102 LEU n 1 103 LYS n 1 104 GLU n 1 105 LEU n 1 106 ARG n 1 107 GLU n 1 108 LEU n 1 109 LEU n 1 110 ARG n 1 111 GLU n 1 112 LEU n 1 113 LYS n 1 114 LYS n 1 115 LYS n 1 116 ALA n 1 117 SER n 1 118 GLU n 1 119 GLU n 1 120 GLU n 1 121 ARG n 1 122 LYS n 1 123 ILE n 1 124 ALA n 1 125 GLU n 1 126 GLU n 1 127 LEU n 1 128 GLU n 1 129 ARG n 1 130 ILE n 1 131 ALA n 1 132 GLU n 1 133 GLU n 1 134 ALA n 1 135 GLN n 1 136 ARG n 1 137 ILE n 1 138 LEU n 1 139 GLU n 1 140 GLU n 1 141 THR n 1 142 GLU n 1 143 ARG n 1 144 ILE n 1 145 LEU n 1 146 ARG n 1 147 GLU n 1 148 THR n 1 149 VAL n 1 150 ARG n 1 151 ILE n 1 152 ALA n 1 153 GLN n 1 154 GLU n 1 155 ALA n 1 156 VAL n 1 157 ARG n 1 158 LEU n 1 159 LEU n 1 160 GLN n 1 161 GLU n 1 162 ALA n 1 163 ARG n 1 164 ARG n 1 165 ARG n 1 166 ALA n 1 167 LYS n 1 168 LYS n 1 169 GLY n 1 170 GLY n 1 171 SER n 1 172 GLY n 1 173 SER n 1 174 GLY n 1 175 GLU n 1 176 ASN n 1 177 LEU n 1 178 TYR n 1 179 PHE n 1 180 GLN n 1 181 GLY n 1 182 GLY n 1 183 SER n 1 184 GLY n 1 185 SER n 1 186 GLU n 1 187 GLU n 1 188 ILE n 1 189 GLU n 1 190 LYS n 1 191 LEU n 1 192 ALA n 1 193 ARG n 1 194 GLU n 1 195 ILE n 1 196 LYS n 1 197 ARG n 1 198 ALA n 1 199 VAL n 1 200 GLU n 1 201 GLU n 1 202 LEU n 1 203 GLN n 1 204 LYS n 1 205 ALA n 1 206 LEU n 1 207 GLU n 1 208 GLU n 1 209 ASN n 1 210 GLU n 1 211 ARG n 1 212 ALA n 1 213 ILE n 1 214 ARG n 1 215 LEU n 1 216 ASN n 1 217 LYS n 1 218 GLU n 1 219 ALA n 1 220 ALA n 1 221 ARG n 1 222 LYS n 1 223 PHE n 1 224 GLU n 1 225 GLU n 1 226 ALA n 1 227 VAL n 1 228 GLU n 1 229 LYS n 1 230 PHE n 1 231 ARG n 1 232 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 232 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8GL3 _struct_ref.pdbx_db_accession 8GL3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8GL3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 232 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8GL3 _struct_ref_seq.db_align_beg -6 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 225 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -6 _struct_ref_seq.pdbx_auth_seq_align_end 225 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8GL3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.4 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.20 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Sodium fluoride and 20% (w/v) PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-11-04 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.99998 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.99998 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 23.78 _reflns.entry_id 8GL3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.3 _reflns.d_resolution_low 45.64 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11502 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.36 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.50 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.052 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.082 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.53 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 7.39 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2812 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.4 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.091 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.976 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.13 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.144 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 46.04 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8GL3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 45.64 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11502 _refine.ls_number_reflns_R_free 622 _refine.ls_number_reflns_R_work 10880 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.37 _refine.ls_percent_reflns_R_free 5.41 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2404 _refine.ls_R_factor_R_free 0.2836 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2380 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.42 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.0929 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2172 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 45.64 _refine_hist.number_atoms_solvent 31 _refine_hist.number_atoms_total 1631 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1600 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0016 ? 1599 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.3368 ? 2121 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0264 ? 238 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0031 ? 285 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.1537 ? 684 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.30 2.53 . . 155 2658 98.22 . . . . 0.2378 . . . . . . . . . . . 0.3089 'X-RAY DIFFRACTION' 2.53 2.90 . . 167 2676 97.20 . . . . 0.2432 . . . . . . . . . . . 0.2635 'X-RAY DIFFRACTION' 2.90 3.65 . . 142 2768 99.76 . . . . 0.2257 . . . . . . . . . . . 0.2858 'X-RAY DIFFRACTION' 3.65 45.64 . . 158 2778 98.29 . . . . 0.2453 . . . . . . . . . . . 0.2834 # _struct.entry_id 8GL3 _struct.title 'De novo design of monomeric helical bundles for pH-controlled membrane lysis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8GL3 _struct_keywords.text 'protein design, pH-responsive, membrane lysis, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 13 ? ARG A 59 ? GLU A 6 ARG A 52 1 ? 47 HELX_P HELX_P2 AA2 GLU A 64 ? GLU A 111 ? GLU A 57 GLU A 104 1 ? 48 HELX_P HELX_P3 AA3 LYS A 122 ? LYS A 167 ? LYS A 115 LYS A 160 1 ? 46 HELX_P HELX_P4 AA4 SER A 185 ? GLU A 228 ? SER A 178 GLU A 221 1 ? 44 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 8GL3 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.031133 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000234 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022370 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005477 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 -6 ? ? ? A . n A 1 2 ASN 2 -5 ? ? ? A . n A 1 3 LEU 3 -4 ? ? ? A . n A 1 4 TYR 4 -3 ? ? ? A . n A 1 5 PHE 5 -2 ? ? ? A . n A 1 6 GLN 6 -1 ? ? ? A . n A 1 7 GLY 7 0 ? ? ? A . n A 1 8 SER 8 1 ? ? ? A . n A 1 9 GLU 9 2 ? ? ? A . n A 1 10 GLU 10 3 ? ? ? A . n A 1 11 ALA 11 4 ? ? ? A . n A 1 12 ARG 12 5 ? ? ? A . n A 1 13 GLU 13 6 6 GLU GLU A . n A 1 14 VAL 14 7 7 VAL VAL A . n A 1 15 ALA 15 8 8 ALA ALA A . n A 1 16 GLU 16 9 9 GLU GLU A . n A 1 17 GLU 17 10 10 GLU GLU A . n A 1 18 ILE 18 11 11 ILE ILE A . n A 1 19 LEU 19 12 12 LEU LEU A . n A 1 20 ARG 20 13 13 ARG ARG A . n A 1 21 LEU 21 14 14 LEU LEU A . n A 1 22 LEU 22 15 15 LEU LEU A . n A 1 23 ARG 23 16 16 ARG ARG A . n A 1 24 GLU 24 17 17 GLU GLU A . n A 1 25 HIS 25 18 18 HIS HIS A . n A 1 26 GLU 26 19 19 GLU GLU A . n A 1 27 GLU 27 20 20 GLU GLU A . n A 1 28 LEU 28 21 21 LEU LEU A . n A 1 29 LEU 29 22 22 LEU LEU A . n A 1 30 ARG 30 23 23 ARG ARG A . n A 1 31 GLU 31 24 24 GLU GLU A . n A 1 32 HIS 32 25 25 HIS HIS A . n A 1 33 GLU 33 26 26 GLU GLU A . n A 1 34 ARG 34 27 27 ARG ARG A . n A 1 35 LEU 35 28 28 LEU LEU A . n A 1 36 LEU 36 29 29 LEU LEU A . n A 1 37 LYS 37 30 30 LYS LYS A . n A 1 38 GLU 38 31 31 GLU GLU A . n A 1 39 ALA 39 32 32 ALA ALA A . n A 1 40 ARG 40 33 33 ARG ARG A . n A 1 41 GLU 41 34 34 GLU GLU A . n A 1 42 LEU 42 35 35 LEU LEU A . n A 1 43 ALA 43 36 36 ALA ALA A . n A 1 44 GLU 44 37 37 GLU GLU A . n A 1 45 ARG 45 38 38 ARG ARG A . n A 1 46 LEU 46 39 39 LEU LEU A . n A 1 47 GLU 47 40 40 GLU GLU A . n A 1 48 GLU 48 41 41 GLU GLU A . n A 1 49 LEU 49 42 42 LEU LEU A . n A 1 50 ALA 50 43 43 ALA ALA A . n A 1 51 ARG 51 44 44 ARG ARG A . n A 1 52 ARG 52 45 45 ARG ARG A . n A 1 53 LEU 53 46 46 LEU LEU A . n A 1 54 GLU 54 47 47 GLU GLU A . n A 1 55 GLU 55 48 48 GLU GLU A . n A 1 56 LEU 56 49 49 LEU LEU A . n A 1 57 ALA 57 50 50 ALA ALA A . n A 1 58 ARG 58 51 51 ARG ARG A . n A 1 59 ARG 59 52 52 ARG ARG A . n A 1 60 GLY 60 53 ? ? ? A . n A 1 61 GLU 61 54 ? ? ? A . n A 1 62 LYS 62 55 ? ? ? A . n A 1 63 ASP 63 56 56 ASP ASP A . n A 1 64 GLU 64 57 57 GLU GLU A . n A 1 65 GLU 65 58 58 GLU GLU A . n A 1 66 ALA 66 59 59 ALA ALA A . n A 1 67 VAL 67 60 60 VAL VAL A . n A 1 68 ARG 68 61 61 ARG ARG A . n A 1 69 GLN 69 62 62 GLN GLN A . n A 1 70 VAL 70 63 63 VAL VAL A . n A 1 71 GLU 71 64 64 GLU GLU A . n A 1 72 GLU 72 65 65 GLU GLU A . n A 1 73 ALA 73 66 66 ALA ALA A . n A 1 74 ALA 74 67 67 ALA ALA A . n A 1 75 ARG 75 68 68 ARG ARG A . n A 1 76 GLU 76 69 69 GLU GLU A . n A 1 77 ALA 77 70 70 ALA ALA A . n A 1 78 GLU 78 71 71 GLU GLU A . n A 1 79 ARG 79 72 72 ARG ARG A . n A 1 80 VAL 80 73 73 VAL VAL A . n A 1 81 ALA 81 74 74 ALA ALA A . n A 1 82 ARG 82 75 75 ARG ARG A . n A 1 83 GLU 83 76 76 GLU GLU A . n A 1 84 LEU 84 77 77 LEU LEU A . n A 1 85 GLU 85 78 78 GLU GLU A . n A 1 86 LYS 86 79 79 LYS LYS A . n A 1 87 SER 87 80 80 SER SER A . n A 1 88 ALA 88 81 81 ALA ALA A . n A 1 89 ARG 89 82 82 ARG ARG A . n A 1 90 ARG 90 83 83 ARG ARG A . n A 1 91 LEU 91 84 84 LEU LEU A . n A 1 92 GLN 92 85 85 GLN GLN A . n A 1 93 GLU 93 86 86 GLU GLU A . n A 1 94 SER 94 87 87 SER SER A . n A 1 95 ILE 95 88 88 ILE ILE A . n A 1 96 ARG 96 89 89 ARG ARG A . n A 1 97 GLU 97 90 90 GLU GLU A . n A 1 98 LEU 98 91 91 LEU LEU A . n A 1 99 ARG 99 92 92 ARG ARG A . n A 1 100 ARG 100 93 93 ARG ARG A . n A 1 101 LEU 101 94 94 LEU LEU A . n A 1 102 LEU 102 95 95 LEU LEU A . n A 1 103 LYS 103 96 96 LYS LYS A . n A 1 104 GLU 104 97 97 GLU GLU A . n A 1 105 LEU 105 98 98 LEU LEU A . n A 1 106 ARG 106 99 99 ARG ARG A . n A 1 107 GLU 107 100 100 GLU GLU A . n A 1 108 LEU 108 101 101 LEU LEU A . n A 1 109 LEU 109 102 102 LEU LEU A . n A 1 110 ARG 110 103 103 ARG ARG A . n A 1 111 GLU 111 104 104 GLU GLU A . n A 1 112 LEU 112 105 105 LEU LEU A . n A 1 113 LYS 113 106 ? ? ? A . n A 1 114 LYS 114 107 ? ? ? A . n A 1 115 LYS 115 108 ? ? ? A . n A 1 116 ALA 116 109 ? ? ? A . n A 1 117 SER 117 110 ? ? ? A . n A 1 118 GLU 118 111 ? ? ? A . n A 1 119 GLU 119 112 ? ? ? A . n A 1 120 GLU 120 113 ? ? ? A . n A 1 121 ARG 121 114 114 ARG ARG A . n A 1 122 LYS 122 115 115 LYS LYS A . n A 1 123 ILE 123 116 116 ILE ILE A . n A 1 124 ALA 124 117 117 ALA ALA A . n A 1 125 GLU 125 118 118 GLU GLU A . n A 1 126 GLU 126 119 119 GLU GLU A . n A 1 127 LEU 127 120 120 LEU LEU A . n A 1 128 GLU 128 121 121 GLU GLU A . n A 1 129 ARG 129 122 122 ARG ARG A . n A 1 130 ILE 130 123 123 ILE ILE A . n A 1 131 ALA 131 124 124 ALA ALA A . n A 1 132 GLU 132 125 125 GLU GLU A . n A 1 133 GLU 133 126 126 GLU GLU A . n A 1 134 ALA 134 127 127 ALA ALA A . n A 1 135 GLN 135 128 128 GLN GLN A . n A 1 136 ARG 136 129 129 ARG ARG A . n A 1 137 ILE 137 130 130 ILE ILE A . n A 1 138 LEU 138 131 131 LEU LEU A . n A 1 139 GLU 139 132 132 GLU GLU A . n A 1 140 GLU 140 133 133 GLU GLU A . n A 1 141 THR 141 134 134 THR THR A . n A 1 142 GLU 142 135 135 GLU GLU A . n A 1 143 ARG 143 136 136 ARG ARG A . n A 1 144 ILE 144 137 137 ILE ILE A . n A 1 145 LEU 145 138 138 LEU LEU A . n A 1 146 ARG 146 139 139 ARG ARG A . n A 1 147 GLU 147 140 140 GLU GLU A . n A 1 148 THR 148 141 141 THR THR A . n A 1 149 VAL 149 142 142 VAL VAL A . n A 1 150 ARG 150 143 143 ARG ARG A . n A 1 151 ILE 151 144 144 ILE ILE A . n A 1 152 ALA 152 145 145 ALA ALA A . n A 1 153 GLN 153 146 146 GLN GLN A . n A 1 154 GLU 154 147 147 GLU GLU A . n A 1 155 ALA 155 148 148 ALA ALA A . n A 1 156 VAL 156 149 149 VAL VAL A . n A 1 157 ARG 157 150 150 ARG ARG A . n A 1 158 LEU 158 151 151 LEU LEU A . n A 1 159 LEU 159 152 152 LEU LEU A . n A 1 160 GLN 160 153 153 GLN GLN A . n A 1 161 GLU 161 154 154 GLU GLU A . n A 1 162 ALA 162 155 155 ALA ALA A . n A 1 163 ARG 163 156 156 ARG ARG A . n A 1 164 ARG 164 157 157 ARG ARG A . n A 1 165 ARG 165 158 158 ARG ARG A . n A 1 166 ALA 166 159 159 ALA ALA A . n A 1 167 LYS 167 160 160 LYS LYS A . n A 1 168 LYS 168 161 ? ? ? A . n A 1 169 GLY 169 162 ? ? ? A . n A 1 170 GLY 170 163 ? ? ? A . n A 1 171 SER 171 164 ? ? ? A . n A 1 172 GLY 172 165 ? ? ? A . n A 1 173 SER 173 166 ? ? ? A . n A 1 174 GLY 174 167 ? ? ? A . n A 1 175 GLU 175 168 ? ? ? A . n A 1 176 ASN 176 169 ? ? ? A . n A 1 177 LEU 177 170 ? ? ? A . n A 1 178 TYR 178 171 ? ? ? A . n A 1 179 PHE 179 172 ? ? ? A . n A 1 180 GLN 180 173 ? ? ? A . n A 1 181 GLY 181 174 ? ? ? A . n A 1 182 GLY 182 175 ? ? ? A . n A 1 183 SER 183 176 ? ? ? A . n A 1 184 GLY 184 177 177 GLY GLY A . n A 1 185 SER 185 178 178 SER SER A . n A 1 186 GLU 186 179 179 GLU GLU A . n A 1 187 GLU 187 180 180 GLU GLU A . n A 1 188 ILE 188 181 181 ILE ILE A . n A 1 189 GLU 189 182 182 GLU GLU A . n A 1 190 LYS 190 183 183 LYS LYS A . n A 1 191 LEU 191 184 184 LEU LEU A . n A 1 192 ALA 192 185 185 ALA ALA A . n A 1 193 ARG 193 186 186 ARG ARG A . n A 1 194 GLU 194 187 187 GLU GLU A . n A 1 195 ILE 195 188 188 ILE ILE A . n A 1 196 LYS 196 189 189 LYS LYS A . n A 1 197 ARG 197 190 190 ARG ARG A . n A 1 198 ALA 198 191 191 ALA ALA A . n A 1 199 VAL 199 192 192 VAL VAL A . n A 1 200 GLU 200 193 193 GLU GLU A . n A 1 201 GLU 201 194 194 GLU GLU A . n A 1 202 LEU 202 195 195 LEU LEU A . n A 1 203 GLN 203 196 196 GLN GLN A . n A 1 204 LYS 204 197 197 LYS LYS A . n A 1 205 ALA 205 198 198 ALA ALA A . n A 1 206 LEU 206 199 199 LEU LEU A . n A 1 207 GLU 207 200 200 GLU GLU A . n A 1 208 GLU 208 201 201 GLU GLU A . n A 1 209 ASN 209 202 202 ASN ASN A . n A 1 210 GLU 210 203 203 GLU GLU A . n A 1 211 ARG 211 204 204 ARG ARG A . n A 1 212 ALA 212 205 205 ALA ALA A . n A 1 213 ILE 213 206 206 ILE ILE A . n A 1 214 ARG 214 207 207 ARG ARG A . n A 1 215 LEU 215 208 208 LEU LEU A . n A 1 216 ASN 216 209 209 ASN ASN A . n A 1 217 LYS 217 210 210 LYS LYS A . n A 1 218 GLU 218 211 211 GLU GLU A . n A 1 219 ALA 219 212 212 ALA ALA A . n A 1 220 ALA 220 213 213 ALA ALA A . n A 1 221 ARG 221 214 214 ARG ARG A . n A 1 222 LYS 222 215 215 LYS LYS A . n A 1 223 PHE 223 216 216 PHE PHE A . n A 1 224 GLU 224 217 217 GLU GLU A . n A 1 225 GLU 225 218 218 GLU GLU A . n A 1 226 ALA 226 219 219 ALA ALA A . n A 1 227 VAL 227 220 220 VAL VAL A . n A 1 228 GLU 228 221 221 GLU GLU A . n A 1 229 LYS 229 222 ? ? ? A . n A 1 230 PHE 230 223 ? ? ? A . n A 1 231 ARG 231 224 ? ? ? A . n A 1 232 LYS 232 225 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email dabaker@uw.edu _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Baker _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7896-6217 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 7 HOH HOH A . B 2 HOH 2 302 23 HOH HOH A . B 2 HOH 3 303 25 HOH HOH A . B 2 HOH 4 304 31 HOH HOH A . B 2 HOH 5 305 29 HOH HOH A . B 2 HOH 6 306 11 HOH HOH A . B 2 HOH 7 307 12 HOH HOH A . B 2 HOH 8 308 16 HOH HOH A . B 2 HOH 9 309 6 HOH HOH A . B 2 HOH 10 310 2 HOH HOH A . B 2 HOH 11 311 17 HOH HOH A . B 2 HOH 12 312 18 HOH HOH A . B 2 HOH 13 313 28 HOH HOH A . B 2 HOH 14 314 20 HOH HOH A . B 2 HOH 15 315 10 HOH HOH A . B 2 HOH 16 316 13 HOH HOH A . B 2 HOH 17 317 1 HOH HOH A . B 2 HOH 18 318 26 HOH HOH A . B 2 HOH 19 319 24 HOH HOH A . B 2 HOH 20 320 27 HOH HOH A . B 2 HOH 21 321 21 HOH HOH A . B 2 HOH 22 322 3 HOH HOH A . B 2 HOH 23 323 14 HOH HOH A . B 2 HOH 24 324 5 HOH HOH A . B 2 HOH 25 325 15 HOH HOH A . B 2 HOH 26 326 22 HOH HOH A . B 2 HOH 27 327 9 HOH HOH A . B 2 HOH 28 328 4 HOH HOH A . B 2 HOH 29 329 8 HOH HOH A . B 2 HOH 30 330 30 HOH HOH A . B 2 HOH 31 331 19 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-09-06 2 'Structure model' 1 1 2023-09-20 3 'Structure model' 1 2 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Refinement description' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_initial_refinement_model 2 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_initial_refinement_model.type' 2 3 'Structure model' '_citation.journal_volume' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z+1/2 4 -x+1/2,y+1/2,-z+1/2 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 8.879 _pdbx_refine_tls.origin_y -7.312 _pdbx_refine_tls.origin_z 36.152 _pdbx_refine_tls.T[1][1] 0.130626554671 _pdbx_refine_tls.T[2][2] 0.175752578267 _pdbx_refine_tls.T[3][3] 0.183556758209 _pdbx_refine_tls.T[1][2] -0.00505251078471 _pdbx_refine_tls.T[1][3] 0.0213812019374 _pdbx_refine_tls.T[2][3] -0.0606928837649 _pdbx_refine_tls.L[1][1] 2.45387639114 _pdbx_refine_tls.L[2][2] 2.200495235 _pdbx_refine_tls.L[3][3] 2.72451328743 _pdbx_refine_tls.L[1][2] -0.491229070996 _pdbx_refine_tls.L[1][3] -0.831135296045 _pdbx_refine_tls.L[2][3] -1.34783690293 _pdbx_refine_tls.S[1][1] 0.0750647158982 _pdbx_refine_tls.S[2][2] 0.0472748410748 _pdbx_refine_tls.S[3][3] -0.0401827860087 _pdbx_refine_tls.S[1][2] 0.457226911539 _pdbx_refine_tls.S[1][3] -0.0930397423271 _pdbx_refine_tls.S[2][3] -0.0303733315338 _pdbx_refine_tls.S[2][1] -0.176446076106 _pdbx_refine_tls.S[3][1] 0.0857918009659 _pdbx_refine_tls.S[3][2] -0.593079074475 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 6 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 221 _pdbx_refine_tls_group.selection_details '( CHAIN A AND RESID 6:221 )' _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU -6 ? A GLU 1 2 1 Y 1 A ASN -5 ? A ASN 2 3 1 Y 1 A LEU -4 ? A LEU 3 4 1 Y 1 A TYR -3 ? A TYR 4 5 1 Y 1 A PHE -2 ? A PHE 5 6 1 Y 1 A GLN -1 ? A GLN 6 7 1 Y 1 A GLY 0 ? A GLY 7 8 1 Y 1 A SER 1 ? A SER 8 9 1 Y 1 A GLU 2 ? A GLU 9 10 1 Y 1 A GLU 3 ? A GLU 10 11 1 Y 1 A ALA 4 ? A ALA 11 12 1 Y 1 A ARG 5 ? A ARG 12 13 1 Y 1 A GLY 53 ? A GLY 60 14 1 Y 1 A GLU 54 ? A GLU 61 15 1 Y 1 A LYS 55 ? A LYS 62 16 1 Y 1 A LYS 106 ? A LYS 113 17 1 Y 1 A LYS 107 ? A LYS 114 18 1 Y 1 A LYS 108 ? A LYS 115 19 1 Y 1 A ALA 109 ? A ALA 116 20 1 Y 1 A SER 110 ? A SER 117 21 1 Y 1 A GLU 111 ? A GLU 118 22 1 Y 1 A GLU 112 ? A GLU 119 23 1 Y 1 A GLU 113 ? A GLU 120 24 1 Y 1 A LYS 161 ? A LYS 168 25 1 Y 1 A GLY 162 ? A GLY 169 26 1 Y 1 A GLY 163 ? A GLY 170 27 1 Y 1 A SER 164 ? A SER 171 28 1 Y 1 A GLY 165 ? A GLY 172 29 1 Y 1 A SER 166 ? A SER 173 30 1 Y 1 A GLY 167 ? A GLY 174 31 1 Y 1 A GLU 168 ? A GLU 175 32 1 Y 1 A ASN 169 ? A ASN 176 33 1 Y 1 A LEU 170 ? A LEU 177 34 1 Y 1 A TYR 171 ? A TYR 178 35 1 Y 1 A PHE 172 ? A PHE 179 36 1 Y 1 A GLN 173 ? A GLN 180 37 1 Y 1 A GLY 174 ? A GLY 181 38 1 Y 1 A GLY 175 ? A GLY 182 39 1 Y 1 A SER 176 ? A SER 183 40 1 Y 1 A LYS 222 ? A LYS 229 41 1 Y 1 A PHE 223 ? A PHE 230 42 1 Y 1 A ARG 224 ? A ARG 231 43 1 Y 1 A LYS 225 ? A LYS 232 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 PHE N N N N 216 PHE CA C N S 217 PHE C C N N 218 PHE O O N N 219 PHE CB C N N 220 PHE CG C Y N 221 PHE CD1 C Y N 222 PHE CD2 C Y N 223 PHE CE1 C Y N 224 PHE CE2 C Y N 225 PHE CZ C Y N 226 PHE OXT O N N 227 PHE H H N N 228 PHE H2 H N N 229 PHE HA H N N 230 PHE HB2 H N N 231 PHE HB3 H N N 232 PHE HD1 H N N 233 PHE HD2 H N N 234 PHE HE1 H N N 235 PHE HE2 H N N 236 PHE HZ H N N 237 PHE HXT H N N 238 SER N N N N 239 SER CA C N S 240 SER C C N N 241 SER O O N N 242 SER CB C N N 243 SER OG O N N 244 SER OXT O N N 245 SER H H N N 246 SER H2 H N N 247 SER HA H N N 248 SER HB2 H N N 249 SER HB3 H N N 250 SER HG H N N 251 SER HXT H N N 252 THR N N N N 253 THR CA C N S 254 THR C C N N 255 THR O O N N 256 THR CB C N R 257 THR OG1 O N N 258 THR CG2 C N N 259 THR OXT O N N 260 THR H H N N 261 THR H2 H N N 262 THR HA H N N 263 THR HB H N N 264 THR HG1 H N N 265 THR HG21 H N N 266 THR HG22 H N N 267 THR HG23 H N N 268 THR HXT H N N 269 TYR N N N N 270 TYR CA C N S 271 TYR C C N N 272 TYR O O N N 273 TYR CB C N N 274 TYR CG C Y N 275 TYR CD1 C Y N 276 TYR CD2 C Y N 277 TYR CE1 C Y N 278 TYR CE2 C Y N 279 TYR CZ C Y N 280 TYR OH O N N 281 TYR OXT O N N 282 TYR H H N N 283 TYR H2 H N N 284 TYR HA H N N 285 TYR HB2 H N N 286 TYR HB3 H N N 287 TYR HD1 H N N 288 TYR HD2 H N N 289 TYR HE1 H N N 290 TYR HE2 H N N 291 TYR HH H N N 292 TYR HXT H N N 293 VAL N N N N 294 VAL CA C N S 295 VAL C C N N 296 VAL O O N N 297 VAL CB C N N 298 VAL CG1 C N N 299 VAL CG2 C N N 300 VAL OXT O N N 301 VAL H H N N 302 VAL H2 H N N 303 VAL HA H N N 304 VAL HB H N N 305 VAL HG11 H N N 306 VAL HG12 H N N 307 VAL HG13 H N N 308 VAL HG21 H N N 309 VAL HG22 H N N 310 VAL HG23 H N N 311 VAL HXT H N N 312 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 PHE N CA sing N N 205 PHE N H sing N N 206 PHE N H2 sing N N 207 PHE CA C sing N N 208 PHE CA CB sing N N 209 PHE CA HA sing N N 210 PHE C O doub N N 211 PHE C OXT sing N N 212 PHE CB CG sing N N 213 PHE CB HB2 sing N N 214 PHE CB HB3 sing N N 215 PHE CG CD1 doub Y N 216 PHE CG CD2 sing Y N 217 PHE CD1 CE1 sing Y N 218 PHE CD1 HD1 sing N N 219 PHE CD2 CE2 doub Y N 220 PHE CD2 HD2 sing N N 221 PHE CE1 CZ doub Y N 222 PHE CE1 HE1 sing N N 223 PHE CE2 CZ sing Y N 224 PHE CE2 HE2 sing N N 225 PHE CZ HZ sing N N 226 PHE OXT HXT sing N N 227 SER N CA sing N N 228 SER N H sing N N 229 SER N H2 sing N N 230 SER CA C sing N N 231 SER CA CB sing N N 232 SER CA HA sing N N 233 SER C O doub N N 234 SER C OXT sing N N 235 SER CB OG sing N N 236 SER CB HB2 sing N N 237 SER CB HB3 sing N N 238 SER OG HG sing N N 239 SER OXT HXT sing N N 240 THR N CA sing N N 241 THR N H sing N N 242 THR N H2 sing N N 243 THR CA C sing N N 244 THR CA CB sing N N 245 THR CA HA sing N N 246 THR C O doub N N 247 THR C OXT sing N N 248 THR CB OG1 sing N N 249 THR CB CG2 sing N N 250 THR CB HB sing N N 251 THR OG1 HG1 sing N N 252 THR CG2 HG21 sing N N 253 THR CG2 HG22 sing N N 254 THR CG2 HG23 sing N N 255 THR OXT HXT sing N N 256 TYR N CA sing N N 257 TYR N H sing N N 258 TYR N H2 sing N N 259 TYR CA C sing N N 260 TYR CA CB sing N N 261 TYR CA HA sing N N 262 TYR C O doub N N 263 TYR C OXT sing N N 264 TYR CB CG sing N N 265 TYR CB HB2 sing N N 266 TYR CB HB3 sing N N 267 TYR CG CD1 doub Y N 268 TYR CG CD2 sing Y N 269 TYR CD1 CE1 sing Y N 270 TYR CD1 HD1 sing N N 271 TYR CD2 CE2 doub Y N 272 TYR CD2 HD2 sing N N 273 TYR CE1 CZ doub Y N 274 TYR CE1 HE1 sing N N 275 TYR CE2 CZ sing Y N 276 TYR CE2 HE2 sing N N 277 TYR CZ OH sing N N 278 TYR OH HH sing N N 279 TYR OXT HXT sing N N 280 VAL N CA sing N N 281 VAL N H sing N N 282 VAL N H2 sing N N 283 VAL CA C sing N N 284 VAL CA CB sing N N 285 VAL CA HA sing N N 286 VAL C O doub N N 287 VAL C OXT sing N N 288 VAL CB CG1 sing N N 289 VAL CB CG2 sing N N 290 VAL CB HB sing N N 291 VAL CG1 HG11 sing N N 292 VAL CG1 HG12 sing N N 293 VAL CG1 HG13 sing N N 294 VAL CG2 HG21 sing N N 295 VAL CG2 HG22 sing N N 296 VAL CG2 HG23 sing N N 297 VAL OXT HXT sing N N 298 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' ? 1 'Howard Hughes Medical Institute (HHMI)' 'United States' ? 2 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'De novo designed model' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'I 1 2 1' _space_group.name_Hall 'C 2y (x,y,-x+z)' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 #