data_8GU3 # _entry.id 8GU3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8GU3 pdb_00008gu3 10.2210/pdb8gu3/pdb WWPDB D_1300031492 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8GU3 _pdbx_database_status.recvd_initial_deposition_date 2022-09-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ju, J.' 1 0000-0003-3660-3375 'Tomita, K.' 2 0000-0002-7374-3898 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 51 _citation.language ? _citation.page_first 2434 _citation.page_last 2446 _citation.title 'Structure of the Caenorhabditis elegans m6A methyltransferase METT10 that regulates SAM homeostasis.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkad081 _citation.pdbx_database_id_PubMed 36794723 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ju, J.' 1 ? primary 'Aoyama, T.' 2 ? primary 'Yashiro, Y.' 3 ? primary 'Yamashita, S.' 4 ? primary 'Kuroyanagi, H.' 5 ? primary 'Tomita, K.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8GU3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.210 _cell.length_a_esd ? _cell.length_b 70.080 _cell.length_b_esd ? _cell.length_c 94.230 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8GU3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase' _entity.formula_weight 36504.770 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.1.1.346 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'N6-adenosine-methyltransferase mett-10' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSQNNEMHPRNPYRNKPPDFKALAVEYPEFRKFCQYVSNGKVTFDFKKDAAVRCLTQTLLKKDFNLDVEIPPGHLVPRVP QKLNYCLLIDDLLKANKLTKNVIGIDIGTGTSCIHALIGARQFNWKFIATDGDEKSVRVAHENVAKNGLSSSICVVHVNP DVKTVLMDVVNTIPDTDYAFCMCNPPFFEKGNGDDKFCEDISSSTETYSNRVASEFRTAPHSATFASSAELFVDGGEVAF VNRIIDDSVLLRDRIKIYTTMIGRKSSLKPLQNRLQRFGDDVKIMISVLNQGKTKRWMLAWTFSKSVSLTTIDRLEHHHH HH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSQNNEMHPRNPYRNKPPDFKALAVEYPEFRKFCQYVSNGKVTFDFKKDAAVRCLTQTLLKKDFNLDVEIPPGHLVPRVP QKLNYCLLIDDLLKANKLTKNVIGIDIGTGTSCIHALIGARQFNWKFIATDGDEKSVRVAHENVAKNGLSSSICVVHVNP DVKTVLMDVVNTIPDTDYAFCMCNPPFFEKGNGDDKFCEDISSSTETYSNRVASEFRTAPHSATFASSAELFVDGGEVAF VNRIIDDSVLLRDRIKIYTTMIGRKSSLKPLQNRLQRFGDDVKIMISVLNQGKTKRWMLAWTFSKSVSLTTIDRLEHHHH HH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLN n 1 4 ASN n 1 5 ASN n 1 6 GLU n 1 7 MET n 1 8 HIS n 1 9 PRO n 1 10 ARG n 1 11 ASN n 1 12 PRO n 1 13 TYR n 1 14 ARG n 1 15 ASN n 1 16 LYS n 1 17 PRO n 1 18 PRO n 1 19 ASP n 1 20 PHE n 1 21 LYS n 1 22 ALA n 1 23 LEU n 1 24 ALA n 1 25 VAL n 1 26 GLU n 1 27 TYR n 1 28 PRO n 1 29 GLU n 1 30 PHE n 1 31 ARG n 1 32 LYS n 1 33 PHE n 1 34 CYS n 1 35 GLN n 1 36 TYR n 1 37 VAL n 1 38 SER n 1 39 ASN n 1 40 GLY n 1 41 LYS n 1 42 VAL n 1 43 THR n 1 44 PHE n 1 45 ASP n 1 46 PHE n 1 47 LYS n 1 48 LYS n 1 49 ASP n 1 50 ALA n 1 51 ALA n 1 52 VAL n 1 53 ARG n 1 54 CYS n 1 55 LEU n 1 56 THR n 1 57 GLN n 1 58 THR n 1 59 LEU n 1 60 LEU n 1 61 LYS n 1 62 LYS n 1 63 ASP n 1 64 PHE n 1 65 ASN n 1 66 LEU n 1 67 ASP n 1 68 VAL n 1 69 GLU n 1 70 ILE n 1 71 PRO n 1 72 PRO n 1 73 GLY n 1 74 HIS n 1 75 LEU n 1 76 VAL n 1 77 PRO n 1 78 ARG n 1 79 VAL n 1 80 PRO n 1 81 GLN n 1 82 LYS n 1 83 LEU n 1 84 ASN n 1 85 TYR n 1 86 CYS n 1 87 LEU n 1 88 LEU n 1 89 ILE n 1 90 ASP n 1 91 ASP n 1 92 LEU n 1 93 LEU n 1 94 LYS n 1 95 ALA n 1 96 ASN n 1 97 LYS n 1 98 LEU n 1 99 THR n 1 100 LYS n 1 101 ASN n 1 102 VAL n 1 103 ILE n 1 104 GLY n 1 105 ILE n 1 106 ASP n 1 107 ILE n 1 108 GLY n 1 109 THR n 1 110 GLY n 1 111 THR n 1 112 SER n 1 113 CYS n 1 114 ILE n 1 115 HIS n 1 116 ALA n 1 117 LEU n 1 118 ILE n 1 119 GLY n 1 120 ALA n 1 121 ARG n 1 122 GLN n 1 123 PHE n 1 124 ASN n 1 125 TRP n 1 126 LYS n 1 127 PHE n 1 128 ILE n 1 129 ALA n 1 130 THR n 1 131 ASP n 1 132 GLY n 1 133 ASP n 1 134 GLU n 1 135 LYS n 1 136 SER n 1 137 VAL n 1 138 ARG n 1 139 VAL n 1 140 ALA n 1 141 HIS n 1 142 GLU n 1 143 ASN n 1 144 VAL n 1 145 ALA n 1 146 LYS n 1 147 ASN n 1 148 GLY n 1 149 LEU n 1 150 SER n 1 151 SER n 1 152 SER n 1 153 ILE n 1 154 CYS n 1 155 VAL n 1 156 VAL n 1 157 HIS n 1 158 VAL n 1 159 ASN n 1 160 PRO n 1 161 ASP n 1 162 VAL n 1 163 LYS n 1 164 THR n 1 165 VAL n 1 166 LEU n 1 167 MET n 1 168 ASP n 1 169 VAL n 1 170 VAL n 1 171 ASN n 1 172 THR n 1 173 ILE n 1 174 PRO n 1 175 ASP n 1 176 THR n 1 177 ASP n 1 178 TYR n 1 179 ALA n 1 180 PHE n 1 181 CYS n 1 182 MET n 1 183 CYS n 1 184 ASN n 1 185 PRO n 1 186 PRO n 1 187 PHE n 1 188 PHE n 1 189 GLU n 1 190 LYS n 1 191 GLY n 1 192 ASN n 1 193 GLY n 1 194 ASP n 1 195 ASP n 1 196 LYS n 1 197 PHE n 1 198 CYS n 1 199 GLU n 1 200 ASP n 1 201 ILE n 1 202 SER n 1 203 SER n 1 204 SER n 1 205 THR n 1 206 GLU n 1 207 THR n 1 208 TYR n 1 209 SER n 1 210 ASN n 1 211 ARG n 1 212 VAL n 1 213 ALA n 1 214 SER n 1 215 GLU n 1 216 PHE n 1 217 ARG n 1 218 THR n 1 219 ALA n 1 220 PRO n 1 221 HIS n 1 222 SER n 1 223 ALA n 1 224 THR n 1 225 PHE n 1 226 ALA n 1 227 SER n 1 228 SER n 1 229 ALA n 1 230 GLU n 1 231 LEU n 1 232 PHE n 1 233 VAL n 1 234 ASP n 1 235 GLY n 1 236 GLY n 1 237 GLU n 1 238 VAL n 1 239 ALA n 1 240 PHE n 1 241 VAL n 1 242 ASN n 1 243 ARG n 1 244 ILE n 1 245 ILE n 1 246 ASP n 1 247 ASP n 1 248 SER n 1 249 VAL n 1 250 LEU n 1 251 LEU n 1 252 ARG n 1 253 ASP n 1 254 ARG n 1 255 ILE n 1 256 LYS n 1 257 ILE n 1 258 TYR n 1 259 THR n 1 260 THR n 1 261 MET n 1 262 ILE n 1 263 GLY n 1 264 ARG n 1 265 LYS n 1 266 SER n 1 267 SER n 1 268 LEU n 1 269 LYS n 1 270 PRO n 1 271 LEU n 1 272 GLN n 1 273 ASN n 1 274 ARG n 1 275 LEU n 1 276 GLN n 1 277 ARG n 1 278 PHE n 1 279 GLY n 1 280 ASP n 1 281 ASP n 1 282 VAL n 1 283 LYS n 1 284 ILE n 1 285 MET n 1 286 ILE n 1 287 SER n 1 288 VAL n 1 289 LEU n 1 290 ASN n 1 291 GLN n 1 292 GLY n 1 293 LYS n 1 294 THR n 1 295 LYS n 1 296 ARG n 1 297 TRP n 1 298 MET n 1 299 LEU n 1 300 ALA n 1 301 TRP n 1 302 THR n 1 303 PHE n 1 304 SER n 1 305 LYS n 1 306 SER n 1 307 VAL n 1 308 SER n 1 309 LEU n 1 310 THR n 1 311 THR n 1 312 ILE n 1 313 ASP n 1 314 ARG n 1 315 LEU n 1 316 GLU n 1 317 HIS n 1 318 HIS n 1 319 HIS n 1 320 HIS n 1 321 HIS n 1 322 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 322 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene mett-10 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Caenorhabditis elegans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6239 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MET16_CAEEL _struct_ref.pdbx_db_accession Q09357 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSQNNEMHPRNPYRNKPPDFKALAVEYPEFRKFCQYVSNGKVTFDFKKDAAVRCLTQTLLKKDFNLDVEIPPGHLVPRVP QKLNYCLLIDDLLKANKLTKNVIGIDIGTGTSCIHALIGARQFNWKFIATDGDEKSVRVAHENVAKNGLSSSICVVHVNP DVKTVLMDVVNTIPDTDYAFCMCNPPFFEKGNGDDKFCEDISSSTETYSNRVASEFRTAPHSATFASSAELFVDGGEVAF VNRIIDDSVLLRDRIKIYTTMIGRKSSLKPLQNRLQRFGDDVKIMISVLNQGKTKRWMLAWTFSKSVSLTTIDR ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8GU3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 314 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q09357 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 314 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 314 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8GU3 LEU A 315 ? UNP Q09357 ? ? 'expression tag' 315 1 1 8GU3 GLU A 316 ? UNP Q09357 ? ? 'expression tag' 316 2 1 8GU3 HIS A 317 ? UNP Q09357 ? ? 'expression tag' 317 3 1 8GU3 HIS A 318 ? UNP Q09357 ? ? 'expression tag' 318 4 1 8GU3 HIS A 319 ? UNP Q09357 ? ? 'expression tag' 319 5 1 8GU3 HIS A 320 ? UNP Q09357 ? ? 'expression tag' 320 6 1 8GU3 HIS A 321 ? UNP Q09357 ? ? 'expression tag' 321 7 1 8GU3 HIS A 322 ? UNP Q09357 ? ? 'expression tag' 322 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8GU3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.95 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'ammonium acetate, Tris-HCl pH8.5, PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-12-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-1A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-1A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate 83.350 _reflns.entry_id 8GU3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.010 _reflns.d_resolution_low 47.120 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6086 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.545 _reflns.pdbx_Rmerge_I_obs 0.113 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.920 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.899 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.117 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 76348 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 3.010 3.080 ? 1.590 ? 5545 452 ? 448 99.100 ? ? ? ? 1.341 ? ? ? ? ? ? ? ? 12.377 ? ? ? ? 1.398 ? ? 1 1 0.691 ? ? ? ? ? ? ? ? ? ? 3.080 3.170 ? 2.260 ? 5867 425 ? 425 100.000 ? ? ? ? 1.077 ? ? ? ? ? ? ? ? 13.805 ? ? ? ? 1.119 ? ? 2 1 0.814 ? ? ? ? ? ? ? ? ? ? 3.170 3.260 ? 3.310 ? 5562 413 ? 413 100.000 ? ? ? ? 0.763 ? ? ? ? ? ? ? ? 13.467 ? ? ? ? 0.793 ? ? 3 1 0.912 ? ? ? ? ? ? ? ? ? ? 3.260 3.360 ? 3.840 ? 5557 416 ? 416 100.000 ? ? ? ? 0.693 ? ? ? ? ? ? ? ? 13.358 ? ? ? ? 0.720 ? ? 4 1 0.921 ? ? ? ? ? ? ? ? ? ? 3.360 3.470 ? 6.110 ? 5076 385 ? 385 100.000 ? ? ? ? 0.467 ? ? ? ? ? ? ? ? 13.184 ? ? ? ? 0.486 ? ? 5 1 0.966 ? ? ? ? ? ? ? ? ? ? 3.470 3.590 ? 6.820 ? 4997 383 ? 383 100.000 ? ? ? ? 0.403 ? ? ? ? ? ? ? ? 13.047 ? ? ? ? 0.420 ? ? 6 1 0.977 ? ? ? ? ? ? ? ? ? ? 3.590 3.730 ? 9.490 ? 4658 369 ? 369 100.000 ? ? ? ? 0.303 ? ? ? ? ? ? ? ? 12.623 ? ? ? ? 0.316 ? ? 7 1 0.987 ? ? ? ? ? ? ? ? ? ? 3.730 3.880 ? 13.130 ? 4374 350 ? 350 100.000 ? ? ? ? 0.211 ? ? ? ? ? ? ? ? 12.497 ? ? ? ? 0.221 ? ? 8 1 0.991 ? ? ? ? ? ? ? ? ? ? 3.880 4.050 ? 17.070 ? 3837 343 ? 342 99.700 ? ? ? ? 0.157 ? ? ? ? ? ? ? ? 11.219 ? ? ? ? 0.165 ? ? 9 1 0.993 ? ? ? ? ? ? ? ? ? ? 4.050 4.250 ? 21.170 ? 3435 322 ? 322 100.000 ? ? ? ? 0.124 ? ? ? ? ? ? ? ? 10.668 ? ? ? ? 0.130 ? ? 10 1 0.994 ? ? ? ? ? ? ? ? ? ? 4.250 4.480 ? 24.460 ? 3525 321 ? 321 100.000 ? ? ? ? 0.096 ? ? ? ? ? ? ? ? 10.981 ? ? ? ? 0.101 ? ? 11 1 0.997 ? ? ? ? ? ? ? ? ? ? 4.480 4.750 ? 32.000 ? 3710 300 ? 300 100.000 ? ? ? ? 0.086 ? ? ? ? ? ? ? ? 12.367 ? ? ? ? 0.090 ? ? 12 1 0.998 ? ? ? ? ? ? ? ? ? ? 4.750 5.080 ? 34.560 ? 3650 273 ? 273 100.000 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 13.370 ? ? ? ? 0.082 ? ? 13 1 0.997 ? ? ? ? ? ? ? ? ? ? 5.080 5.490 ? 29.470 ? 3624 276 ? 276 100.000 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 13.130 ? ? ? ? 0.088 ? ? 14 1 0.999 ? ? ? ? ? ? ? ? ? ? 5.490 6.010 ? 32.580 ? 3148 238 ? 238 100.000 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 13.227 ? ? ? ? 0.076 ? ? 15 1 0.998 ? ? ? ? ? ? ? ? ? ? 6.010 6.720 ? 35.550 ? 2842 222 ? 222 100.000 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 12.802 ? ? ? ? 0.073 ? ? 16 1 0.998 ? ? ? ? ? ? ? ? ? ? 6.720 7.760 ? 42.680 ? 2537 203 ? 203 100.000 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 12.498 ? ? ? ? 0.054 ? ? 17 1 0.999 ? ? ? ? ? ? ? ? ? ? 7.760 9.500 ? 48.610 ? 2069 174 ? 174 100.000 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 11.891 ? ? ? ? 0.042 ? ? 18 1 0.999 ? ? ? ? ? ? ? ? ? ? 9.500 13.440 ? 50.620 ? 1602 144 ? 144 100.000 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 11.125 ? ? ? ? 0.036 ? ? 19 1 0.999 ? ? ? ? ? ? ? ? ? ? 13.440 47.120 ? 44.170 ? 733 85 ? 82 96.500 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? 8.939 ? ? ? ? 0.036 ? ? 20 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 256.440 _refine.B_iso_mean 103.7401 _refine.B_iso_min 47.100 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8GU3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.0100 _refine.ls_d_res_low 47.1200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6085 _refine.ls_number_reflns_R_free 305 _refine.ls_number_reflns_R_work 5780 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8700 _refine.ls_percent_reflns_R_free 5.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2438 _refine.ls_R_factor_R_free 0.2975 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2414 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6B91 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.0700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.0100 _refine_hist.d_res_low 47.1200 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2039 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 256 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2039 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.0100 3.7900 2980 . 149 2831 100.0000 . . . 0.3405 0.0000 0.2688 . . . . . . . 2 . . . 'X-RAY DIFFRACTION' 3.7900 47.1200 3105 . 156 2949 100.0000 . . . 0.2856 0.0000 0.2332 . . . . . . . 2 . . . # _struct.entry_id 8GU3 _struct.title 'Crystal structure of Caenorhabditis elegans METT-10 methyltransferase domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8GU3 _struct_keywords.text 'SAM homeostasis, U6 snRNA, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 19 ? TYR A 27 ? ASP A 19 TYR A 27 1 ? 9 HELX_P HELX_P2 AA2 TYR A 27 ? LYS A 32 ? TYR A 27 LYS A 32 1 ? 6 HELX_P HELX_P3 AA3 LYS A 48 ? ASN A 65 ? LYS A 48 ASN A 65 1 ? 18 HELX_P HELX_P4 AA4 ARG A 78 ? ASN A 96 ? ARG A 78 ASN A 96 1 ? 19 HELX_P HELX_P5 AA5 CYS A 113 ? PHE A 123 ? CYS A 113 PHE A 123 1 ? 11 HELX_P HELX_P6 AA6 ASP A 133 ? GLY A 148 ? ASP A 133 GLY A 148 1 ? 16 HELX_P HELX_P7 AA7 LEU A 166 ? ASN A 171 ? LEU A 166 ASN A 171 1 ? 6 HELX_P HELX_P8 AA8 GLU A 237 ? LEU A 250 ? GLU A 237 LEU A 250 1 ? 14 HELX_P HELX_P9 AA9 ARG A 264 ? SER A 266 ? ARG A 264 SER A 266 5 ? 3 HELX_P HELX_P10 AB1 SER A 267 ? ARG A 277 ? SER A 267 ARG A 277 1 ? 11 HELX_P HELX_P11 AB2 PHE A 278 ? VAL A 282 ? PHE A 278 VAL A 282 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 153 ? HIS A 157 ? ILE A 153 HIS A 157 AA1 2 LYS A 126 ? ASP A 131 ? LYS A 126 ASP A 131 AA1 3 ILE A 103 ? ILE A 107 ? ILE A 103 ILE A 107 AA1 4 PHE A 180 ? CYS A 183 ? PHE A 180 CYS A 183 AA1 5 ILE A 257 ? ILE A 262 ? ILE A 257 ILE A 262 AA1 6 TRP A 297 ? THR A 302 ? TRP A 297 THR A 302 AA1 7 LYS A 283 ? VAL A 288 ? LYS A 283 VAL A 288 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 156 ? O VAL A 156 N ALA A 129 ? N ALA A 129 AA1 2 3 O LYS A 126 ? O LYS A 126 N GLY A 104 ? N GLY A 104 AA1 3 4 N ILE A 105 ? N ILE A 105 O MET A 182 ? O MET A 182 AA1 4 5 N CYS A 183 ? N CYS A 183 O MET A 261 ? O MET A 261 AA1 5 6 N THR A 260 ? N THR A 260 O LEU A 299 ? O LEU A 299 AA1 6 7 O ALA A 300 ? O ALA A 300 N MET A 285 ? N MET A 285 # _atom_sites.entry_id 8GU3 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.023143 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014269 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010612 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 ASN 4 4 ? ? ? A . n A 1 5 ASN 5 5 ? ? ? A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 CYS 113 113 113 CYS CYS A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 TRP 125 125 125 TRP TRP A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 CYS 154 154 154 CYS CYS A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 HIS 157 157 157 HIS HIS A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 MET 167 167 167 MET MET A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 THR 172 172 172 THR THR A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 PRO 174 174 174 PRO PRO A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 PHE 180 180 180 PHE PHE A . n A 1 181 CYS 181 181 181 CYS CYS A . n A 1 182 MET 182 182 182 MET MET A . n A 1 183 CYS 183 183 183 CYS CYS A . n A 1 184 ASN 184 184 184 ASN ASN A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 PRO 186 186 186 PRO PRO A . n A 1 187 PHE 187 187 187 PHE PHE A . n A 1 188 PHE 188 188 ? ? ? A . n A 1 189 GLU 189 189 ? ? ? A . n A 1 190 LYS 190 190 ? ? ? A . n A 1 191 GLY 191 191 ? ? ? A . n A 1 192 ASN 192 192 ? ? ? A . n A 1 193 GLY 193 193 ? ? ? A . n A 1 194 ASP 194 194 ? ? ? A . n A 1 195 ASP 195 195 ? ? ? A . n A 1 196 LYS 196 196 ? ? ? A . n A 1 197 PHE 197 197 ? ? ? A . n A 1 198 CYS 198 198 ? ? ? A . n A 1 199 GLU 199 199 ? ? ? A . n A 1 200 ASP 200 200 ? ? ? A . n A 1 201 ILE 201 201 ? ? ? A . n A 1 202 SER 202 202 ? ? ? A . n A 1 203 SER 203 203 ? ? ? A . n A 1 204 SER 204 204 ? ? ? A . n A 1 205 THR 205 205 ? ? ? A . n A 1 206 GLU 206 206 ? ? ? A . n A 1 207 THR 207 207 ? ? ? A . n A 1 208 TYR 208 208 ? ? ? A . n A 1 209 SER 209 209 ? ? ? A . n A 1 210 ASN 210 210 ? ? ? A . n A 1 211 ARG 211 211 ? ? ? A . n A 1 212 VAL 212 212 ? ? ? A . n A 1 213 ALA 213 213 ? ? ? A . n A 1 214 SER 214 214 ? ? ? A . n A 1 215 GLU 215 215 ? ? ? A . n A 1 216 PHE 216 216 ? ? ? A . n A 1 217 ARG 217 217 ? ? ? A . n A 1 218 THR 218 218 ? ? ? A . n A 1 219 ALA 219 219 ? ? ? A . n A 1 220 PRO 220 220 ? ? ? A . n A 1 221 HIS 221 221 ? ? ? A . n A 1 222 SER 222 222 ? ? ? A . n A 1 223 ALA 223 223 ? ? ? A . n A 1 224 THR 224 224 ? ? ? A . n A 1 225 PHE 225 225 ? ? ? A . n A 1 226 ALA 226 226 ? ? ? A . n A 1 227 SER 227 227 ? ? ? A . n A 1 228 SER 228 228 ? ? ? A . n A 1 229 ALA 229 229 ? ? ? A . n A 1 230 GLU 230 230 ? ? ? A . n A 1 231 LEU 231 231 ? ? ? A . n A 1 232 PHE 232 232 ? ? ? A . n A 1 233 VAL 233 233 ? ? ? A . n A 1 234 ASP 234 234 ? ? ? A . n A 1 235 GLY 235 235 ? ? ? A . n A 1 236 GLY 236 236 236 GLY GLY A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 VAL 238 238 238 VAL VAL A . n A 1 239 ALA 239 239 239 ALA ALA A . n A 1 240 PHE 240 240 240 PHE PHE A . n A 1 241 VAL 241 241 241 VAL VAL A . n A 1 242 ASN 242 242 242 ASN ASN A . n A 1 243 ARG 243 243 243 ARG ARG A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 ILE 245 245 245 ILE ILE A . n A 1 246 ASP 246 246 246 ASP ASP A . n A 1 247 ASP 247 247 247 ASP ASP A . n A 1 248 SER 248 248 248 SER SER A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 ARG 252 252 252 ARG ARG A . n A 1 253 ASP 253 253 253 ASP ASP A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 ILE 255 255 255 ILE ILE A . n A 1 256 LYS 256 256 256 LYS LYS A . n A 1 257 ILE 257 257 257 ILE ILE A . n A 1 258 TYR 258 258 258 TYR TYR A . n A 1 259 THR 259 259 259 THR THR A . n A 1 260 THR 260 260 260 THR THR A . n A 1 261 MET 261 261 261 MET MET A . n A 1 262 ILE 262 262 262 ILE ILE A . n A 1 263 GLY 263 263 263 GLY GLY A . n A 1 264 ARG 264 264 264 ARG ARG A . n A 1 265 LYS 265 265 265 LYS LYS A . n A 1 266 SER 266 266 266 SER SER A . n A 1 267 SER 267 267 267 SER SER A . n A 1 268 LEU 268 268 268 LEU LEU A . n A 1 269 LYS 269 269 269 LYS LYS A . n A 1 270 PRO 270 270 270 PRO PRO A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 GLN 272 272 272 GLN GLN A . n A 1 273 ASN 273 273 273 ASN ASN A . n A 1 274 ARG 274 274 274 ARG ARG A . n A 1 275 LEU 275 275 275 LEU LEU A . n A 1 276 GLN 276 276 276 GLN GLN A . n A 1 277 ARG 277 277 277 ARG ARG A . n A 1 278 PHE 278 278 278 PHE PHE A . n A 1 279 GLY 279 279 279 GLY GLY A . n A 1 280 ASP 280 280 280 ASP ASP A . n A 1 281 ASP 281 281 281 ASP ASP A . n A 1 282 VAL 282 282 282 VAL VAL A . n A 1 283 LYS 283 283 283 LYS LYS A . n A 1 284 ILE 284 284 284 ILE ILE A . n A 1 285 MET 285 285 285 MET MET A . n A 1 286 ILE 286 286 286 ILE ILE A . n A 1 287 SER 287 287 287 SER SER A . n A 1 288 VAL 288 288 288 VAL VAL A . n A 1 289 LEU 289 289 289 LEU LEU A . n A 1 290 ASN 290 290 290 ASN ASN A . n A 1 291 GLN 291 291 291 GLN GLN A . n A 1 292 GLY 292 292 292 GLY GLY A . n A 1 293 LYS 293 293 293 LYS LYS A . n A 1 294 THR 294 294 294 THR THR A . n A 1 295 LYS 295 295 295 LYS LYS A . n A 1 296 ARG 296 296 296 ARG ARG A . n A 1 297 TRP 297 297 297 TRP TRP A . n A 1 298 MET 298 298 298 MET MET A . n A 1 299 LEU 299 299 299 LEU LEU A . n A 1 300 ALA 300 300 300 ALA ALA A . n A 1 301 TRP 301 301 301 TRP TRP A . n A 1 302 THR 302 302 302 THR THR A . n A 1 303 PHE 303 303 303 PHE PHE A . n A 1 304 SER 304 304 304 SER SER A . n A 1 305 LYS 305 305 305 LYS LYS A . n A 1 306 SER 306 306 306 SER SER A . n A 1 307 VAL 307 307 307 VAL VAL A . n A 1 308 SER 308 308 308 SER SER A . n A 1 309 LEU 309 309 309 LEU LEU A . n A 1 310 THR 310 310 ? ? ? A . n A 1 311 THR 311 311 ? ? ? A . n A 1 312 ILE 312 312 ? ? ? A . n A 1 313 ASP 313 313 ? ? ? A . n A 1 314 ARG 314 314 ? ? ? A . n A 1 315 LEU 315 315 ? ? ? A . n A 1 316 GLU 316 316 ? ? ? A . n A 1 317 HIS 317 317 ? ? ? A . n A 1 318 HIS 318 318 ? ? ? A . n A 1 319 HIS 319 319 ? ? ? A . n A 1 320 HIS 320 320 ? ? ? A . n A 1 321 HIS 321 321 ? ? ? A . n A 1 322 HIS 322 322 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email kozo-tomita@edu.k.u-tokyo.ac.jp _pdbx_contact_author.name_first Kozo _pdbx_contact_author.name_last Tomita _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7374-3898 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12690 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-02-01 2 'Structure model' 1 1 2023-03-01 3 'Structure model' 1 2 2023-03-29 4 'Structure model' 1 3 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_DOI' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -23.7015 _pdbx_refine_tls.origin_y -0.4210 _pdbx_refine_tls.origin_z -9.7799 _pdbx_refine_tls.T[1][1] 0.5512 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.1720 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.1763 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.6411 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0107 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.7041 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.3797 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -1.4799 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 1.9121 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 8.7535 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -4.9607 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 5.3709 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.3086 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.5257 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0505 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.8014 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.8218 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.1623 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -1.1309 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.6587 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.3372 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 6 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 309 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 38 ? ? -69.63 0.97 2 1 GLN A 291 ? ? 74.09 -8.45 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A ASN 4 ? A ASN 4 5 1 Y 1 A ASN 5 ? A ASN 5 6 1 Y 1 A PHE 188 ? A PHE 188 7 1 Y 1 A GLU 189 ? A GLU 189 8 1 Y 1 A LYS 190 ? A LYS 190 9 1 Y 1 A GLY 191 ? A GLY 191 10 1 Y 1 A ASN 192 ? A ASN 192 11 1 Y 1 A GLY 193 ? A GLY 193 12 1 Y 1 A ASP 194 ? A ASP 194 13 1 Y 1 A ASP 195 ? A ASP 195 14 1 Y 1 A LYS 196 ? A LYS 196 15 1 Y 1 A PHE 197 ? A PHE 197 16 1 Y 1 A CYS 198 ? A CYS 198 17 1 Y 1 A GLU 199 ? A GLU 199 18 1 Y 1 A ASP 200 ? A ASP 200 19 1 Y 1 A ILE 201 ? A ILE 201 20 1 Y 1 A SER 202 ? A SER 202 21 1 Y 1 A SER 203 ? A SER 203 22 1 Y 1 A SER 204 ? A SER 204 23 1 Y 1 A THR 205 ? A THR 205 24 1 Y 1 A GLU 206 ? A GLU 206 25 1 Y 1 A THR 207 ? A THR 207 26 1 Y 1 A TYR 208 ? A TYR 208 27 1 Y 1 A SER 209 ? A SER 209 28 1 Y 1 A ASN 210 ? A ASN 210 29 1 Y 1 A ARG 211 ? A ARG 211 30 1 Y 1 A VAL 212 ? A VAL 212 31 1 Y 1 A ALA 213 ? A ALA 213 32 1 Y 1 A SER 214 ? A SER 214 33 1 Y 1 A GLU 215 ? A GLU 215 34 1 Y 1 A PHE 216 ? A PHE 216 35 1 Y 1 A ARG 217 ? A ARG 217 36 1 Y 1 A THR 218 ? A THR 218 37 1 Y 1 A ALA 219 ? A ALA 219 38 1 Y 1 A PRO 220 ? A PRO 220 39 1 Y 1 A HIS 221 ? A HIS 221 40 1 Y 1 A SER 222 ? A SER 222 41 1 Y 1 A ALA 223 ? A ALA 223 42 1 Y 1 A THR 224 ? A THR 224 43 1 Y 1 A PHE 225 ? A PHE 225 44 1 Y 1 A ALA 226 ? A ALA 226 45 1 Y 1 A SER 227 ? A SER 227 46 1 Y 1 A SER 228 ? A SER 228 47 1 Y 1 A ALA 229 ? A ALA 229 48 1 Y 1 A GLU 230 ? A GLU 230 49 1 Y 1 A LEU 231 ? A LEU 231 50 1 Y 1 A PHE 232 ? A PHE 232 51 1 Y 1 A VAL 233 ? A VAL 233 52 1 Y 1 A ASP 234 ? A ASP 234 53 1 Y 1 A GLY 235 ? A GLY 235 54 1 Y 1 A THR 310 ? A THR 310 55 1 Y 1 A THR 311 ? A THR 311 56 1 Y 1 A ILE 312 ? A ILE 312 57 1 Y 1 A ASP 313 ? A ASP 313 58 1 Y 1 A ARG 314 ? A ARG 314 59 1 Y 1 A LEU 315 ? A LEU 315 60 1 Y 1 A GLU 316 ? A GLU 316 61 1 Y 1 A HIS 317 ? A HIS 317 62 1 Y 1 A HIS 318 ? A HIS 318 63 1 Y 1 A HIS 319 ? A HIS 319 64 1 Y 1 A HIS 320 ? A HIS 320 65 1 Y 1 A HIS 321 ? A HIS 321 66 1 Y 1 A HIS 322 ? A HIS 322 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 18H03980 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6B91 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #