data_8HEW # _entry.id 8HEW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8HEW pdb_00008hew 10.2210/pdb8hew/pdb WWPDB D_1300033483 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-09-20 2 'Structure model' 1 1 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_entry_details 2 2 'Structure model' pdbx_modification_feature # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8HEW _pdbx_database_status.recvd_initial_deposition_date 2022-11-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email kojima-chojiro-xk@ynu.ac.jp _pdbx_contact_author.name_first Chojiro _pdbx_contact_author.name_last Kojima _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2723-8249 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Taoka, K.' 1 ? 'Kawahara, I.' 2 ? 'Shinya, S.' 3 ? 'Harada, K.' 4 ? 'Muranaka, T.' 5 ? 'Furuita, K.' 6 ? 'Nakagawa, A.' 7 ? 'Fujiwara, T.' 8 ? 'Tsuji, H.' 9 ? 'Kojima, C.' 10 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plant J.' _citation.journal_id_ASTM PLJUED _citation.journal_id_CSD 2117 _citation.journal_id_ISSN 1365-313X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 112 _citation.language ? _citation.page_first 1337 _citation.page_last 1349 _citation.title 'Multifunctional chemical inhibitors of the florigen activation complex discovered by structure-based high-throughput screening.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/tpj.16008 _citation.pdbx_database_id_PubMed 36288411 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Taoka, K.I.' 1 ? primary 'Kawahara, I.' 2 ? primary 'Shinya, S.' 3 ? primary 'Harada, K.I.' 4 ? primary 'Yamashita, E.' 5 ? primary 'Shimatani, Z.' 6 ? primary 'Furuita, K.' 7 ? primary 'Muranaka, T.' 8 ? primary 'Oyama, T.' 9 ? primary 'Terada, R.' 10 ? primary 'Nakagawa, A.' 11 ? primary 'Fujiwara, T.' 12 ? primary 'Tsuji, H.' 13 0000-0002-6444-559X primary 'Kojima, C.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '14-3-3 protein' 26517.928 1 ? ? ? ? 2 polymer syn 'StFDL1 peptide' 859.841 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '14f protein' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MAREENVYMAKLAEQAERYEEMVQFMEKVSTSLGSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEEHV KCIKEYRSKIESELSNICDGILKLLDSNLIPSASNGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQDIA NTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWT ; ;MAREENVYMAKLAEQAERYEEMVQFMEKVSTSLGSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEEHV KCIKEYRSKIESELSNICDGILKLLDSNLIPSASNGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQDIA NTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWT ; A ? 2 'polypeptide(L)' no yes 'RTS(TPO)APF' RTSTAPF B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ARG n 1 4 GLU n 1 5 GLU n 1 6 ASN n 1 7 VAL n 1 8 TYR n 1 9 MET n 1 10 ALA n 1 11 LYS n 1 12 LEU n 1 13 ALA n 1 14 GLU n 1 15 GLN n 1 16 ALA n 1 17 GLU n 1 18 ARG n 1 19 TYR n 1 20 GLU n 1 21 GLU n 1 22 MET n 1 23 VAL n 1 24 GLN n 1 25 PHE n 1 26 MET n 1 27 GLU n 1 28 LYS n 1 29 VAL n 1 30 SER n 1 31 THR n 1 32 SER n 1 33 LEU n 1 34 GLY n 1 35 SER n 1 36 GLU n 1 37 GLU n 1 38 LEU n 1 39 THR n 1 40 VAL n 1 41 GLU n 1 42 GLU n 1 43 ARG n 1 44 ASN n 1 45 LEU n 1 46 LEU n 1 47 SER n 1 48 VAL n 1 49 ALA n 1 50 TYR n 1 51 LYS n 1 52 ASN n 1 53 VAL n 1 54 ILE n 1 55 GLY n 1 56 ALA n 1 57 ARG n 1 58 ARG n 1 59 ALA n 1 60 SER n 1 61 TRP n 1 62 ARG n 1 63 ILE n 1 64 ILE n 1 65 SER n 1 66 SER n 1 67 ILE n 1 68 GLU n 1 69 GLN n 1 70 LYS n 1 71 GLU n 1 72 GLU n 1 73 SER n 1 74 ARG n 1 75 GLY n 1 76 ASN n 1 77 GLU n 1 78 GLU n 1 79 HIS n 1 80 VAL n 1 81 LYS n 1 82 CYS n 1 83 ILE n 1 84 LYS n 1 85 GLU n 1 86 TYR n 1 87 ARG n 1 88 SER n 1 89 LYS n 1 90 ILE n 1 91 GLU n 1 92 SER n 1 93 GLU n 1 94 LEU n 1 95 SER n 1 96 ASN n 1 97 ILE n 1 98 CYS n 1 99 ASP n 1 100 GLY n 1 101 ILE n 1 102 LEU n 1 103 LYS n 1 104 LEU n 1 105 LEU n 1 106 ASP n 1 107 SER n 1 108 ASN n 1 109 LEU n 1 110 ILE n 1 111 PRO n 1 112 SER n 1 113 ALA n 1 114 SER n 1 115 ASN n 1 116 GLY n 1 117 ASP n 1 118 SER n 1 119 LYS n 1 120 VAL n 1 121 PHE n 1 122 TYR n 1 123 LEU n 1 124 LYS n 1 125 MET n 1 126 LYS n 1 127 GLY n 1 128 ASP n 1 129 TYR n 1 130 HIS n 1 131 ARG n 1 132 TYR n 1 133 LEU n 1 134 ALA n 1 135 GLU n 1 136 PHE n 1 137 LYS n 1 138 THR n 1 139 GLY n 1 140 ALA n 1 141 GLU n 1 142 ARG n 1 143 LYS n 1 144 GLU n 1 145 ALA n 1 146 ALA n 1 147 GLU n 1 148 SER n 1 149 THR n 1 150 LEU n 1 151 SER n 1 152 ALA n 1 153 TYR n 1 154 LYS n 1 155 ALA n 1 156 ALA n 1 157 GLN n 1 158 ASP n 1 159 ILE n 1 160 ALA n 1 161 ASN n 1 162 THR n 1 163 GLU n 1 164 LEU n 1 165 ALA n 1 166 PRO n 1 167 THR n 1 168 HIS n 1 169 PRO n 1 170 ILE n 1 171 ARG n 1 172 LEU n 1 173 GLY n 1 174 LEU n 1 175 ALA n 1 176 LEU n 1 177 ASN n 1 178 PHE n 1 179 SER n 1 180 VAL n 1 181 PHE n 1 182 TYR n 1 183 TYR n 1 184 GLU n 1 185 ILE n 1 186 LEU n 1 187 ASN n 1 188 SER n 1 189 PRO n 1 190 ASP n 1 191 ARG n 1 192 ALA n 1 193 CYS n 1 194 ASN n 1 195 LEU n 1 196 ALA n 1 197 LYS n 1 198 GLN n 1 199 ALA n 1 200 PHE n 1 201 ASP n 1 202 GLU n 1 203 ALA n 1 204 ILE n 1 205 ALA n 1 206 GLU n 1 207 LEU n 1 208 ASP n 1 209 THR n 1 210 LEU n 1 211 GLY n 1 212 GLU n 1 213 GLU n 1 214 SER n 1 215 TYR n 1 216 LYS n 1 217 ASP n 1 218 SER n 1 219 THR n 1 220 LEU n 1 221 ILE n 1 222 MET n 1 223 GLN n 1 224 LEU n 1 225 LEU n 1 226 ARG n 1 227 ASP n 1 228 ASN n 1 229 LEU n 1 230 THR n 1 231 LEU n 1 232 TRP n 1 233 THR n 2 1 ARG n 2 2 THR n 2 3 SER n 2 4 TPO n 2 5 ALA n 2 6 PRO n 2 7 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 233 _entity_src_gen.gene_src_common_name potato _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 30G _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Solanum tuberosum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4113 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 7 _pdbx_entity_src_syn.organism_scientific 'Solanum tuberosum' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 4113 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 MET 125 125 125 MET MET A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 PRO 166 166 166 PRO PRO A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 HIS 168 168 168 HIS HIS A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 ARG 171 171 171 ARG ARG A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ASN 177 177 177 ASN ASN A . n A 1 178 PHE 178 178 178 PHE PHE A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 PHE 181 181 181 PHE PHE A . n A 1 182 TYR 182 182 182 TYR TYR A . n A 1 183 TYR 183 183 183 TYR TYR A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 ILE 185 185 185 ILE ILE A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 ASN 187 187 187 ASN ASN A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 PRO 189 189 189 PRO PRO A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 ARG 191 191 191 ARG ARG A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 CYS 193 193 193 CYS CYS A . n A 1 194 ASN 194 194 194 ASN ASN A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 GLN 198 198 198 GLN GLN A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 PHE 200 200 200 PHE PHE A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 ILE 204 204 204 ILE ILE A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 ASP 208 208 208 ASP ASP A . n A 1 209 THR 209 209 209 THR THR A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 TYR 215 215 215 TYR TYR A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 ASP 217 217 217 ASP ASP A . n A 1 218 SER 218 218 218 SER SER A . n A 1 219 THR 219 219 219 THR THR A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 ILE 221 221 221 ILE ILE A . n A 1 222 MET 222 222 222 MET MET A . n A 1 223 GLN 223 223 223 GLN GLN A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 ARG 226 226 226 ARG ARG A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 ASN 228 228 228 ASN ASN A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 THR 230 230 230 THR THR A . n A 1 231 LEU 231 231 231 LEU LEU A . n A 1 232 TRP 232 232 232 TRP TRP A . n A 1 233 THR 233 233 233 THR THR A . n B 2 1 ARG 1 3 3 ARG ARG B . n B 2 2 THR 2 4 4 THR THR B . n B 2 3 SER 3 5 5 SER SER B . n B 2 4 TPO 4 6 6 TPO TPO B . n B 2 5 ALA 5 7 7 ALA ALA B . n B 2 6 PRO 6 8 8 PRO PRO B . n B 2 7 PHE 7 9 9 PHE PHE B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id TPO _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id TPO _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 1 ? CG ? A MET 1 CG 2 1 Y 1 A MET 1 ? SD ? A MET 1 SD 3 1 Y 1 A MET 1 ? CE ? A MET 1 CE 4 1 Y 1 A ARG 3 ? CG ? A ARG 3 CG 5 1 Y 1 A ARG 3 ? CD ? A ARG 3 CD 6 1 Y 1 A ARG 3 ? NE ? A ARG 3 NE 7 1 Y 1 A ARG 3 ? CZ ? A ARG 3 CZ 8 1 Y 1 A ARG 3 ? NH1 ? A ARG 3 NH1 9 1 Y 1 A ARG 3 ? NH2 ? A ARG 3 NH2 10 1 Y 1 A LEU 207 ? CG ? A LEU 207 CG 11 1 Y 1 A LEU 207 ? CD1 ? A LEU 207 CD1 12 1 Y 1 A LEU 207 ? CD2 ? A LEU 207 CD2 13 1 Y 1 A ASP 208 ? CG ? A ASP 208 CG 14 1 Y 1 A ASP 208 ? OD1 ? A ASP 208 OD1 15 1 Y 1 A ASP 208 ? OD2 ? A ASP 208 OD2 16 1 Y 1 A LEU 210 ? CG ? A LEU 210 CG 17 1 Y 1 A LEU 210 ? CD1 ? A LEU 210 CD1 18 1 Y 1 A LEU 210 ? CD2 ? A LEU 210 CD2 19 1 Y 1 A GLU 212 ? CG ? A GLU 212 CG 20 1 Y 1 A GLU 212 ? CD ? A GLU 212 CD 21 1 Y 1 A GLU 212 ? OE1 ? A GLU 212 OE1 22 1 Y 1 A GLU 212 ? OE2 ? A GLU 212 OE2 23 1 Y 1 A GLU 213 ? CG ? A GLU 213 CG 24 1 Y 1 A GLU 213 ? CD ? A GLU 213 CD 25 1 Y 1 A GLU 213 ? OE1 ? A GLU 213 OE1 26 1 Y 1 A GLU 213 ? OE2 ? A GLU 213 OE2 27 1 Y 1 A LYS 216 ? CG ? A LYS 216 CG 28 1 Y 1 A LYS 216 ? CD ? A LYS 216 CD 29 1 Y 1 A LYS 216 ? CE ? A LYS 216 CE 30 1 Y 1 A LYS 216 ? NZ ? A LYS 216 NZ 31 1 Y 1 A ARG 226 ? CG ? A ARG 226 CG 32 1 Y 1 A ARG 226 ? CD ? A ARG 226 CD 33 1 Y 1 A ARG 226 ? NE ? A ARG 226 NE 34 1 Y 1 A ARG 226 ? CZ ? A ARG 226 CZ 35 1 Y 1 A ARG 226 ? NH1 ? A ARG 226 NH1 36 1 Y 1 A ARG 226 ? NH2 ? A ARG 226 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 8HEW _cell.details ? _cell.formula_units_Z ? _cell.length_a 121.628 _cell.length_a_esd ? _cell.length_b 121.628 _cell.length_b_esd ? _cell.length_c 69.648 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8HEW _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8HEW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 5.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 77.36 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '12% (w/ v) polyethylene glycol (PEG) 8000, 0.2M ammonium tartrate, pH 7' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS VII' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-02-21 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8HEW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.590 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18669 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.000 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.620 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.111 _reflns.pdbx_Rpim_I_all 0.041 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 131010 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.103 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.590 2.630 ? ? ? ? ? ? 887 ? ? ? ? ? ? ? ? ? ? ? 5.900 0.969 ? ? 0.615 0.245 ? 1 1 0.867 ? ? 96.400 ? 0.561 ? ? ? ? ? ? ? ? ? 2.630 2.680 ? ? ? ? ? ? 918 ? ? ? ? ? ? ? ? ? ? ? 6.600 0.960 ? ? 0.528 0.200 ? 2 1 0.895 ? ? 99.400 ? 0.486 ? ? ? ? ? ? ? ? ? 2.680 2.730 ? ? ? ? ? ? 899 ? ? ? ? ? ? ? ? ? ? ? 6.600 0.929 ? ? 0.483 0.183 ? 3 1 0.914 ? ? 100.000 ? 0.445 ? ? ? ? ? ? ? ? ? 2.730 2.790 ? ? ? ? ? ? 948 ? ? ? ? ? ? ? ? ? ? ? 6.700 0.967 ? ? 0.405 0.152 ? 4 1 0.929 ? ? 100.000 ? 0.374 ? ? ? ? ? ? ? ? ? 2.790 2.850 ? ? ? ? ? ? 921 ? ? ? ? ? ? ? ? ? ? ? 6.800 0.941 ? ? 0.358 0.134 ? 5 1 0.941 ? ? 100.000 ? 0.331 ? ? ? ? ? ? ? ? ? 2.850 2.920 ? ? ? ? ? ? 938 ? ? ? ? ? ? ? ? ? ? ? 6.900 0.979 ? ? 0.331 0.124 ? 6 1 0.960 ? ? 99.800 ? 0.306 ? ? ? ? ? ? ? ? ? 2.920 2.990 ? ? ? ? ? ? 906 ? ? ? ? ? ? ? ? ? ? ? 7.100 0.979 ? ? 0.289 0.106 ? 7 1 0.960 ? ? 100.000 ? 0.268 ? ? ? ? ? ? ? ? ? 2.990 3.070 ? ? ? ? ? ? 936 ? ? ? ? ? ? ? ? ? ? ? 7.200 1.145 ? ? 0.248 0.091 ? 8 1 0.973 ? ? 100.000 ? 0.230 ? ? ? ? ? ? ? ? ? 3.070 3.160 ? ? ? ? ? ? 939 ? ? ? ? ? ? ? ? ? ? ? 7.200 1.206 ? ? 0.232 0.085 ? 9 1 0.975 ? ? 100.000 ? 0.215 ? ? ? ? ? ? ? ? ? 3.160 3.260 ? ? ? ? ? ? 923 ? ? ? ? ? ? ? ? ? ? ? 7.300 1.217 ? ? 0.196 0.071 ? 10 1 0.980 ? ? 100.000 ? 0.182 ? ? ? ? ? ? ? ? ? 3.260 3.380 ? ? ? ? ? ? 927 ? ? ? ? ? ? ? ? ? ? ? 7.300 1.364 ? ? 0.162 0.059 ? 11 1 0.985 ? ? 100.000 ? 0.150 ? ? ? ? ? ? ? ? ? 3.380 3.510 ? ? ? ? ? ? 945 ? ? ? ? ? ? ? ? ? ? ? 7.300 1.718 ? ? 0.136 0.050 ? 12 1 0.989 ? ? 100.000 ? 0.126 ? ? ? ? ? ? ? ? ? 3.510 3.670 ? ? ? ? ? ? 946 ? ? ? ? ? ? ? ? ? ? ? 7.300 1.880 ? ? 0.119 0.043 ? 13 1 0.992 ? ? 100.000 ? 0.111 ? ? ? ? ? ? ? ? ? 3.670 3.870 ? ? ? ? ? ? 923 ? ? ? ? ? ? ? ? ? ? ? 7.300 2.248 ? ? 0.107 0.039 ? 14 1 0.993 ? ? 99.900 ? 0.099 ? ? ? ? ? ? ? ? ? 3.870 4.110 ? ? ? ? ? ? 944 ? ? ? ? ? ? ? ? ? ? ? 7.200 2.548 ? ? 0.089 0.032 ? 15 1 0.995 ? ? 100.000 ? 0.082 ? ? ? ? ? ? ? ? ? 4.110 4.430 ? ? ? ? ? ? 937 ? ? ? ? ? ? ? ? ? ? ? 7.200 2.893 ? ? 0.081 0.029 ? 16 1 0.996 ? ? 100.000 ? 0.076 ? ? ? ? ? ? ? ? ? 4.430 4.870 ? ? ? ? ? ? 945 ? ? ? ? ? ? ? ? ? ? ? 7.200 2.919 ? ? 0.077 0.027 ? 17 1 0.997 ? ? 100.000 ? 0.072 ? ? ? ? ? ? ? ? ? 4.870 5.580 ? ? ? ? ? ? 949 ? ? ? ? ? ? ? ? ? ? ? 7.300 2.471 ? ? 0.074 0.026 ? 18 1 0.997 ? ? 99.600 ? 0.069 ? ? ? ? ? ? ? ? ? 5.580 7.020 ? ? ? ? ? ? 962 ? ? ? ? ? ? ? ? ? ? ? 7.300 1.797 ? ? 0.061 0.022 ? 19 1 0.998 ? ? 98.900 ? 0.056 ? ? ? ? ? ? ? ? ? 7.020 50.000 ? ? ? ? ? ? 976 ? ? ? ? ? ? ? ? ? ? ? 6.800 1.709 ? ? 0.039 0.015 ? 20 1 0.999 ? ? 96.800 ? 0.036 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8HEW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.59 _refine.ls_d_res_low 50 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18669 _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2653 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2432 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1O9C _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.59 _refine_hist.d_res_low 50 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1881 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1881 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _struct.entry_id 8HEW _struct.title 'Potato 14-3-3 St14f' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8HEW _struct_keywords.text '14-3-3, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP P93785_SOLTU P93785 ? 1 ;MAREENVYMAKLAEQAERYEEMVQFMEKVSTSLGSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEEHV KCIKEYRSKIESELSNICDGILKLLDSNLIPSASNGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQDIA NTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWT ; 1 2 PDB 8HEW 8HEW ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8HEW A 1 ? 233 ? P93785 1 ? 233 ? 1 233 2 2 8HEW B 1 ? 7 ? 8HEW 3 ? 9 ? 3 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4310 ? 1 MORE -30 ? 1 'SSA (A^2)' 23630 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 23.2160000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 4 ? ALA A 16 ? GLU A 4 ALA A 16 1 ? 13 HELX_P HELX_P2 AA2 ARG A 18 ? THR A 31 ? ARG A 18 THR A 31 1 ? 14 HELX_P HELX_P3 AA3 THR A 39 ? SER A 73 ? THR A 39 SER A 73 1 ? 35 HELX_P HELX_P4 AA4 ASN A 76 ? SER A 107 ? ASN A 76 SER A 107 1 ? 32 HELX_P HELX_P5 AA5 ASN A 115 ? LYS A 137 ? ASN A 115 LYS A 137 1 ? 23 HELX_P HELX_P6 AA6 GLY A 139 ? LEU A 164 ? GLY A 139 LEU A 164 1 ? 26 HELX_P HELX_P7 AA7 HIS A 168 ? ILE A 185 ? HIS A 168 ILE A 185 1 ? 18 HELX_P HELX_P8 AA8 SER A 188 ? ALA A 205 ? SER A 188 ALA A 205 1 ? 18 HELX_P HELX_P9 AA9 GLY A 211 ? THR A 233 ? GLY A 211 THR A 233 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B SER 3 C ? ? ? 1_555 B TPO 4 N ? ? B SER 5 B TPO 6 1_555 ? ? ? ? ? ? ? 1.309 ? ? covale2 covale both ? B TPO 4 C ? ? ? 1_555 B ALA 5 N ? ? B TPO 6 B ALA 7 1_555 ? ? ? ? ? ? ? 1.309 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id TPO _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 4 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id TPO _pdbx_modification_feature.auth_asym_id B _pdbx_modification_feature.auth_seq_id 6 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id THR _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id TPO _pdbx_modification_feature.type Phosphorylation _pdbx_modification_feature.category 'Named protein modification' # _pdbx_entry_details.entry_id 8HEW _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 20 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OE1 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 20 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.331 _pdbx_validate_rmsd_bond.bond_target_value 1.252 _pdbx_validate_rmsd_bond.bond_deviation 0.079 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 131 ? ? CZ A ARG 131 ? ? NH1 A ARG 131 ? ? 123.64 120.30 3.34 0.50 N 2 1 NE A ARG 131 ? ? CZ A ARG 131 ? ? NH2 A ARG 131 ? ? 116.06 120.30 -4.24 0.50 N 3 1 CA A THR 138 ? ? CB A THR 138 ? ? OG1 A THR 138 ? ? 95.13 109.00 -13.87 2.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 38 ? ? -35.99 131.38 2 1 ASN A 76 ? ? -62.93 79.13 3 1 ASN A 108 ? ? -160.98 -59.76 4 1 SER A 114 ? ? -122.46 -68.55 5 1 THR A 162 ? ? -60.48 -80.22 6 1 LEU A 207 ? ? -88.78 -72.82 7 1 ASP A 208 ? ? -68.25 61.25 8 1 THR A 209 ? ? -147.28 32.66 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ARG A 3 ? ? GLU A 4 ? ? 147.13 2 1 THR A 162 ? ? GLU A 163 ? ? -147.12 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TPO N N N N 318 TPO CA C N S 319 TPO CB C N R 320 TPO CG2 C N N 321 TPO OG1 O N N 322 TPO P P N N 323 TPO O1P O N N 324 TPO O2P O N N 325 TPO O3P O N N 326 TPO C C N N 327 TPO O O N N 328 TPO OXT O N N 329 TPO H H N N 330 TPO H2 H N N 331 TPO HA H N N 332 TPO HB H N N 333 TPO HG21 H N N 334 TPO HG22 H N N 335 TPO HG23 H N N 336 TPO HOP2 H N N 337 TPO HOP3 H N N 338 TPO HXT H N N 339 TRP N N N N 340 TRP CA C N S 341 TRP C C N N 342 TRP O O N N 343 TRP CB C N N 344 TRP CG C Y N 345 TRP CD1 C Y N 346 TRP CD2 C Y N 347 TRP NE1 N Y N 348 TRP CE2 C Y N 349 TRP CE3 C Y N 350 TRP CZ2 C Y N 351 TRP CZ3 C Y N 352 TRP CH2 C Y N 353 TRP OXT O N N 354 TRP H H N N 355 TRP H2 H N N 356 TRP HA H N N 357 TRP HB2 H N N 358 TRP HB3 H N N 359 TRP HD1 H N N 360 TRP HE1 H N N 361 TRP HE3 H N N 362 TRP HZ2 H N N 363 TRP HZ3 H N N 364 TRP HH2 H N N 365 TRP HXT H N N 366 TYR N N N N 367 TYR CA C N S 368 TYR C C N N 369 TYR O O N N 370 TYR CB C N N 371 TYR CG C Y N 372 TYR CD1 C Y N 373 TYR CD2 C Y N 374 TYR CE1 C Y N 375 TYR CE2 C Y N 376 TYR CZ C Y N 377 TYR OH O N N 378 TYR OXT O N N 379 TYR H H N N 380 TYR H2 H N N 381 TYR HA H N N 382 TYR HB2 H N N 383 TYR HB3 H N N 384 TYR HD1 H N N 385 TYR HD2 H N N 386 TYR HE1 H N N 387 TYR HE2 H N N 388 TYR HH H N N 389 TYR HXT H N N 390 VAL N N N N 391 VAL CA C N S 392 VAL C C N N 393 VAL O O N N 394 VAL CB C N N 395 VAL CG1 C N N 396 VAL CG2 C N N 397 VAL OXT O N N 398 VAL H H N N 399 VAL H2 H N N 400 VAL HA H N N 401 VAL HB H N N 402 VAL HG11 H N N 403 VAL HG12 H N N 404 VAL HG13 H N N 405 VAL HG21 H N N 406 VAL HG22 H N N 407 VAL HG23 H N N 408 VAL HXT H N N 409 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TPO N CA sing N N 304 TPO N H sing N N 305 TPO N H2 sing N N 306 TPO CA CB sing N N 307 TPO CA C sing N N 308 TPO CA HA sing N N 309 TPO CB CG2 sing N N 310 TPO CB OG1 sing N N 311 TPO CB HB sing N N 312 TPO CG2 HG21 sing N N 313 TPO CG2 HG22 sing N N 314 TPO CG2 HG23 sing N N 315 TPO OG1 P sing N N 316 TPO P O1P doub N N 317 TPO P O2P sing N N 318 TPO P O3P sing N N 319 TPO O2P HOP2 sing N N 320 TPO O3P HOP3 sing N N 321 TPO C O doub N N 322 TPO C OXT sing N N 323 TPO OXT HXT sing N N 324 TRP N CA sing N N 325 TRP N H sing N N 326 TRP N H2 sing N N 327 TRP CA C sing N N 328 TRP CA CB sing N N 329 TRP CA HA sing N N 330 TRP C O doub N N 331 TRP C OXT sing N N 332 TRP CB CG sing N N 333 TRP CB HB2 sing N N 334 TRP CB HB3 sing N N 335 TRP CG CD1 doub Y N 336 TRP CG CD2 sing Y N 337 TRP CD1 NE1 sing Y N 338 TRP CD1 HD1 sing N N 339 TRP CD2 CE2 doub Y N 340 TRP CD2 CE3 sing Y N 341 TRP NE1 CE2 sing Y N 342 TRP NE1 HE1 sing N N 343 TRP CE2 CZ2 sing Y N 344 TRP CE3 CZ3 doub Y N 345 TRP CE3 HE3 sing N N 346 TRP CZ2 CH2 doub Y N 347 TRP CZ2 HZ2 sing N N 348 TRP CZ3 CH2 sing Y N 349 TRP CZ3 HZ3 sing N N 350 TRP CH2 HH2 sing N N 351 TRP OXT HXT sing N N 352 TYR N CA sing N N 353 TYR N H sing N N 354 TYR N H2 sing N N 355 TYR CA C sing N N 356 TYR CA CB sing N N 357 TYR CA HA sing N N 358 TYR C O doub N N 359 TYR C OXT sing N N 360 TYR CB CG sing N N 361 TYR CB HB2 sing N N 362 TYR CB HB3 sing N N 363 TYR CG CD1 doub Y N 364 TYR CG CD2 sing Y N 365 TYR CD1 CE1 sing Y N 366 TYR CD1 HD1 sing N N 367 TYR CD2 CE2 doub Y N 368 TYR CD2 HD2 sing N N 369 TYR CE1 CZ doub Y N 370 TYR CE1 HE1 sing N N 371 TYR CE2 CZ sing Y N 372 TYR CE2 HE2 sing N N 373 TYR CZ OH sing N N 374 TYR OH HH sing N N 375 TYR OXT HXT sing N N 376 VAL N CA sing N N 377 VAL N H sing N N 378 VAL N H2 sing N N 379 VAL CA C sing N N 380 VAL CA CB sing N N 381 VAL CA HA sing N N 382 VAL C O doub N N 383 VAL C OXT sing N N 384 VAL CB CG1 sing N N 385 VAL CB CG2 sing N N 386 VAL CB HB sing N N 387 VAL CG1 HG11 sing N N 388 VAL CG1 HG12 sing N N 389 VAL CG1 HG13 sing N N 390 VAL CG2 HG21 sing N N 391 VAL CG2 HG22 sing N N 392 VAL CG2 HG23 sing N N 393 VAL OXT HXT sing N N 394 # _pdbx_audit_support.funding_organization 'Ministry of Education, Culture, Sports, Science and Technology (Japan)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number '17K07609, 16H06464, 16H06466, 17H05836, 19H04856, 20H03191, 16H02532, 21H04728, and 22H04978' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1O9C _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8HEW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008222 _atom_sites.fract_transf_matrix[1][2] 0.004747 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009494 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014358 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_