data_8HTR # _entry.id 8HTR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8HTR pdb_00008htr 10.2210/pdb8htr/pdb WWPDB D_1300034307 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-05-15 2 'Structure model' 1 1 2024-06-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8HTR _pdbx_database_status.recvd_initial_deposition_date 2022-12-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 4 _pdbx_contact_author.email ye.liu@beigene.com _pdbx_contact_author.name_first Ye _pdbx_contact_author.name_last Liu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1716-7037 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, J.' 1 ? 'Xu, M.' 2 ? 'Feng, Y.' 3 ? 'Liu, Y.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 67 _citation.language ? _citation.page_first 7836 _citation.page_last 7858 _citation.title ;Discovery of the Clinical Candidate Sonrotoclax (BGB-11417), a Highly Potent and Selective Inhibitor for Both WT and G101V Mutant Bcl-2. ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.4c00027 _citation.pdbx_database_id_PubMed 38695063 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guo, Y.' 1 ? primary 'Xue, H.' 2 ? primary 'Hu, N.' 3 ? primary 'Liu, Y.' 4 ? primary 'Sun, H.' 5 ? primary 'Yu, D.' 6 ? primary 'Qin, L.' 7 ? primary 'Shi, G.' 8 ? primary 'Wang, F.' 9 ? primary 'Xin, L.' 10 ? primary 'Sun, W.' 11 ? primary 'Zhang, F.' 12 ? primary 'Song, X.' 13 ? primary 'Li, S.' 14 ? primary 'Wei, Q.' 15 ? primary 'Guo, Y.' 16 ? primary 'Li, Y.' 17 ? primary 'Liu, X.' 18 ? primary 'Chen, S.' 19 ? primary 'Zhang, T.' 20 ? primary 'Wu, Y.' 21 ? primary 'Su, D.' 22 ? primary 'Zhu, Y.' 23 ? primary 'Xu, A.' 24 ? primary 'Xu, H.' 25 ? primary 'Yang, S.' 26 ? primary 'Zheng, Z.' 27 ? primary 'Liu, J.' 28 ? primary 'Yang, X.' 29 ? primary 'Yuan, X.' 30 ? primary 'Hong, Y.' 31 ? primary 'Sun, X.' 32 ? primary 'Guo, Y.' 33 ? primary 'Zhou, C.' 34 ? primary 'Liu, X.' 35 ? primary 'Wang, L.' 36 ? primary 'Wang, Z.' 37 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Apoptosis regulator Bcl-2' 19769.012 1 ? ? ? ? 2 non-polymer syn ;4-[4-[(2~{S})-2-(2-chlorophenyl)pyrrolidin-1-yl]phenyl]-~{N}-[3-nitro-4-(oxan-4-ylmethylamino)phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide ; 807.313 1 ? ? ? ? 3 water nat water 18.015 60 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSMAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDDVEENRTEAPEGTESEVVHLTLRQAGDDFSRRYRRDFAEMS SQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWD AFVELYGPSMR ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSMAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDDVEENRTEAPEGTESEVVHLTLRQAGDDFSRRYRRDFAEMS SQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWD AFVELYGPSMR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;4-[4-[(2~{S})-2-(2-chlorophenyl)pyrrolidin-1-yl]phenyl]-~{N}-[3-nitro-4-(oxan-4-ylmethylamino)phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide ; MWH 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 ALA n 1 8 HIS n 1 9 ALA n 1 10 GLY n 1 11 ARG n 1 12 THR n 1 13 GLY n 1 14 TYR n 1 15 ASP n 1 16 ASN n 1 17 ARG n 1 18 GLU n 1 19 ILE n 1 20 VAL n 1 21 MET n 1 22 LYS n 1 23 TYR n 1 24 ILE n 1 25 HIS n 1 26 TYR n 1 27 LYS n 1 28 LEU n 1 29 SER n 1 30 GLN n 1 31 ARG n 1 32 GLY n 1 33 TYR n 1 34 GLU n 1 35 TRP n 1 36 ASP n 1 37 ALA n 1 38 GLY n 1 39 ASP n 1 40 ASP n 1 41 VAL n 1 42 GLU n 1 43 GLU n 1 44 ASN n 1 45 ARG n 1 46 THR n 1 47 GLU n 1 48 ALA n 1 49 PRO n 1 50 GLU n 1 51 GLY n 1 52 THR n 1 53 GLU n 1 54 SER n 1 55 GLU n 1 56 VAL n 1 57 VAL n 1 58 HIS n 1 59 LEU n 1 60 THR n 1 61 LEU n 1 62 ARG n 1 63 GLN n 1 64 ALA n 1 65 GLY n 1 66 ASP n 1 67 ASP n 1 68 PHE n 1 69 SER n 1 70 ARG n 1 71 ARG n 1 72 TYR n 1 73 ARG n 1 74 ARG n 1 75 ASP n 1 76 PHE n 1 77 ALA n 1 78 GLU n 1 79 MET n 1 80 SER n 1 81 SER n 1 82 GLN n 1 83 LEU n 1 84 HIS n 1 85 LEU n 1 86 THR n 1 87 PRO n 1 88 PHE n 1 89 THR n 1 90 ALA n 1 91 ARG n 1 92 GLY n 1 93 ARG n 1 94 PHE n 1 95 ALA n 1 96 THR n 1 97 VAL n 1 98 VAL n 1 99 GLU n 1 100 GLU n 1 101 LEU n 1 102 PHE n 1 103 ARG n 1 104 ASP n 1 105 GLY n 1 106 VAL n 1 107 ASN n 1 108 TRP n 1 109 GLY n 1 110 ARG n 1 111 ILE n 1 112 VAL n 1 113 ALA n 1 114 PHE n 1 115 PHE n 1 116 GLU n 1 117 PHE n 1 118 GLY n 1 119 GLY n 1 120 VAL n 1 121 MET n 1 122 CYS n 1 123 VAL n 1 124 GLU n 1 125 SER n 1 126 VAL n 1 127 ASN n 1 128 ARG n 1 129 GLU n 1 130 MET n 1 131 SER n 1 132 PRO n 1 133 LEU n 1 134 VAL n 1 135 ASP n 1 136 ASN n 1 137 ILE n 1 138 ALA n 1 139 LEU n 1 140 TRP n 1 141 MET n 1 142 THR n 1 143 GLU n 1 144 TYR n 1 145 LEU n 1 146 ASN n 1 147 ARG n 1 148 HIS n 1 149 LEU n 1 150 HIS n 1 151 THR n 1 152 TRP n 1 153 ILE n 1 154 GLN n 1 155 ASP n 1 156 ASN n 1 157 GLY n 1 158 GLY n 1 159 TRP n 1 160 ASP n 1 161 ALA n 1 162 PHE n 1 163 VAL n 1 164 GLU n 1 165 LEU n 1 166 TYR n 1 167 GLY n 1 168 PRO n 1 169 SER n 1 170 MET n 1 171 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 171 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MWH non-polymer . ;4-[4-[(2~{S})-2-(2-chlorophenyl)pyrrolidin-1-yl]phenyl]-~{N}-[3-nitro-4-(oxan-4-ylmethylamino)phenyl]sulfonyl-2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide ; ? 'C42 H39 Cl N6 O7 S' 807.313 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 ? ? ? A . n A 1 2 PRO 2 -3 ? ? ? A . n A 1 3 LEU 3 -2 ? ? ? A . n A 1 4 GLY 4 -1 ? ? ? A . n A 1 5 SER 5 0 ? ? ? A . n A 1 6 MET 6 1 ? ? ? A . n A 1 7 ALA 7 2 ? ? ? A . n A 1 8 HIS 8 3 ? ? ? A . n A 1 9 ALA 9 4 ? ? ? A . n A 1 10 GLY 10 5 ? ? ? A . n A 1 11 ARG 11 6 6 ARG ARG A . n A 1 12 THR 12 7 7 THR THR A . n A 1 13 GLY 13 8 8 GLY GLY A . n A 1 14 TYR 14 9 9 TYR TYR A . n A 1 15 ASP 15 10 10 ASP ASP A . n A 1 16 ASN 16 11 11 ASN ASN A . n A 1 17 ARG 17 12 12 ARG ARG A . n A 1 18 GLU 18 13 13 GLU GLU A . n A 1 19 ILE 19 14 14 ILE ILE A . n A 1 20 VAL 20 15 15 VAL VAL A . n A 1 21 MET 21 16 16 MET MET A . n A 1 22 LYS 22 17 17 LYS LYS A . n A 1 23 TYR 23 18 18 TYR TYR A . n A 1 24 ILE 24 19 19 ILE ILE A . n A 1 25 HIS 25 20 20 HIS HIS A . n A 1 26 TYR 26 21 21 TYR TYR A . n A 1 27 LYS 27 22 22 LYS LYS A . n A 1 28 LEU 28 23 23 LEU LEU A . n A 1 29 SER 29 24 24 SER SER A . n A 1 30 GLN 30 25 25 GLN GLN A . n A 1 31 ARG 31 26 26 ARG ARG A . n A 1 32 GLY 32 27 27 GLY GLY A . n A 1 33 TYR 33 28 28 TYR TYR A . n A 1 34 GLU 34 29 29 GLU GLU A . n A 1 35 TRP 35 30 30 TRP TRP A . n A 1 36 ASP 36 31 ? ? ? A . n A 1 37 ALA 37 32 ? ? ? A . n A 1 38 GLY 38 33 ? ? ? A . n A 1 39 ASP 39 34 ? ? ? A . n A 1 40 ASP 40 35 ? ? ? A . n A 1 41 VAL 41 36 ? ? ? A . n A 1 42 GLU 42 37 ? ? ? A . n A 1 43 GLU 43 38 ? ? ? A . n A 1 44 ASN 44 39 ? ? ? A . n A 1 45 ARG 45 40 ? ? ? A . n A 1 46 THR 46 41 ? ? ? A . n A 1 47 GLU 47 42 ? ? ? A . n A 1 48 ALA 48 43 ? ? ? A . n A 1 49 PRO 49 44 ? ? ? A . n A 1 50 GLU 50 45 ? ? ? A . n A 1 51 GLY 51 46 ? ? ? A . n A 1 52 THR 52 47 ? ? ? A . n A 1 53 GLU 53 48 ? ? ? A . n A 1 54 SER 54 49 49 SER SER A . n A 1 55 GLU 55 50 50 GLU GLU A . n A 1 56 VAL 56 92 92 VAL VAL A . n A 1 57 VAL 57 93 93 VAL VAL A . n A 1 58 HIS 58 94 94 HIS HIS A . n A 1 59 LEU 59 95 95 LEU LEU A . n A 1 60 THR 60 96 96 THR THR A . n A 1 61 LEU 61 97 97 LEU LEU A . n A 1 62 ARG 62 98 98 ARG ARG A . n A 1 63 GLN 63 99 99 GLN GLN A . n A 1 64 ALA 64 100 100 ALA ALA A . n A 1 65 GLY 65 101 101 GLY GLY A . n A 1 66 ASP 66 102 102 ASP ASP A . n A 1 67 ASP 67 103 103 ASP ASP A . n A 1 68 PHE 68 104 104 PHE PHE A . n A 1 69 SER 69 105 105 SER SER A . n A 1 70 ARG 70 106 106 ARG ARG A . n A 1 71 ARG 71 107 107 ARG ARG A . n A 1 72 TYR 72 108 108 TYR TYR A . n A 1 73 ARG 73 109 109 ARG ARG A . n A 1 74 ARG 74 110 110 ARG ARG A . n A 1 75 ASP 75 111 111 ASP ASP A . n A 1 76 PHE 76 112 112 PHE PHE A . n A 1 77 ALA 77 113 113 ALA ALA A . n A 1 78 GLU 78 114 114 GLU GLU A . n A 1 79 MET 79 115 115 MET MET A . n A 1 80 SER 80 116 116 SER SER A . n A 1 81 SER 81 117 117 SER SER A . n A 1 82 GLN 82 118 118 GLN GLN A . n A 1 83 LEU 83 119 119 LEU LEU A . n A 1 84 HIS 84 120 120 HIS HIS A . n A 1 85 LEU 85 121 121 LEU LEU A . n A 1 86 THR 86 122 122 THR THR A . n A 1 87 PRO 87 123 123 PRO PRO A . n A 1 88 PHE 88 124 124 PHE PHE A . n A 1 89 THR 89 125 125 THR THR A . n A 1 90 ALA 90 126 126 ALA ALA A . n A 1 91 ARG 91 127 127 ARG ARG A . n A 1 92 GLY 92 128 128 GLY GLY A . n A 1 93 ARG 93 129 129 ARG ARG A . n A 1 94 PHE 94 130 130 PHE PHE A . n A 1 95 ALA 95 131 131 ALA ALA A . n A 1 96 THR 96 132 132 THR THR A . n A 1 97 VAL 97 133 133 VAL VAL A . n A 1 98 VAL 98 134 134 VAL VAL A . n A 1 99 GLU 99 135 135 GLU GLU A . n A 1 100 GLU 100 136 136 GLU GLU A . n A 1 101 LEU 101 137 137 LEU LEU A . n A 1 102 PHE 102 138 138 PHE PHE A . n A 1 103 ARG 103 139 139 ARG ARG A . n A 1 104 ASP 104 140 140 ASP ASP A . n A 1 105 GLY 105 141 141 GLY GLY A . n A 1 106 VAL 106 142 142 VAL VAL A . n A 1 107 ASN 107 143 143 ASN ASN A . n A 1 108 TRP 108 144 144 TRP TRP A . n A 1 109 GLY 109 145 145 GLY GLY A . n A 1 110 ARG 110 146 146 ARG ARG A . n A 1 111 ILE 111 147 147 ILE ILE A . n A 1 112 VAL 112 148 148 VAL VAL A . n A 1 113 ALA 113 149 149 ALA ALA A . n A 1 114 PHE 114 150 150 PHE PHE A . n A 1 115 PHE 115 151 151 PHE PHE A . n A 1 116 GLU 116 152 152 GLU GLU A . n A 1 117 PHE 117 153 153 PHE PHE A . n A 1 118 GLY 118 154 154 GLY GLY A . n A 1 119 GLY 119 155 155 GLY GLY A . n A 1 120 VAL 120 156 156 VAL VAL A . n A 1 121 MET 121 157 157 MET MET A . n A 1 122 CYS 122 158 158 CYS CYS A . n A 1 123 VAL 123 159 159 VAL VAL A . n A 1 124 GLU 124 160 160 GLU GLU A . n A 1 125 SER 125 161 161 SER SER A . n A 1 126 VAL 126 162 162 VAL VAL A . n A 1 127 ASN 127 163 163 ASN ASN A . n A 1 128 ARG 128 164 164 ARG ARG A . n A 1 129 GLU 129 165 165 GLU GLU A . n A 1 130 MET 130 166 166 MET MET A . n A 1 131 SER 131 167 167 SER SER A . n A 1 132 PRO 132 168 168 PRO PRO A . n A 1 133 LEU 133 169 169 LEU LEU A . n A 1 134 VAL 134 170 170 VAL VAL A . n A 1 135 ASP 135 171 171 ASP ASP A . n A 1 136 ASN 136 172 172 ASN ASN A . n A 1 137 ILE 137 173 173 ILE ILE A . n A 1 138 ALA 138 174 174 ALA ALA A . n A 1 139 LEU 139 175 175 LEU LEU A . n A 1 140 TRP 140 176 176 TRP TRP A . n A 1 141 MET 141 177 177 MET MET A . n A 1 142 THR 142 178 178 THR THR A . n A 1 143 GLU 143 179 179 GLU GLU A . n A 1 144 TYR 144 180 180 TYR TYR A . n A 1 145 LEU 145 181 181 LEU LEU A . n A 1 146 ASN 146 182 182 ASN ASN A . n A 1 147 ARG 147 183 183 ARG ARG A . n A 1 148 HIS 148 184 184 HIS HIS A . n A 1 149 LEU 149 185 185 LEU LEU A . n A 1 150 HIS 150 186 186 HIS HIS A . n A 1 151 THR 151 187 187 THR THR A . n A 1 152 TRP 152 188 188 TRP TRP A . n A 1 153 ILE 153 189 189 ILE ILE A . n A 1 154 GLN 154 190 190 GLN GLN A . n A 1 155 ASP 155 191 191 ASP ASP A . n A 1 156 ASN 156 192 192 ASN ASN A . n A 1 157 GLY 157 193 193 GLY GLY A . n A 1 158 GLY 158 194 194 GLY GLY A . n A 1 159 TRP 159 195 195 TRP TRP A . n A 1 160 ASP 160 196 196 ASP ASP A . n A 1 161 ALA 161 197 197 ALA ALA A . n A 1 162 PHE 162 198 198 PHE PHE A . n A 1 163 VAL 163 199 199 VAL VAL A . n A 1 164 GLU 164 200 200 GLU GLU A . n A 1 165 LEU 165 201 201 LEU LEU A . n A 1 166 TYR 166 202 202 TYR TYR A . n A 1 167 GLY 167 203 203 GLY GLY A . n A 1 168 PRO 168 204 204 PRO PRO A . n A 1 169 SER 169 205 ? ? ? A . n A 1 170 MET 170 206 ? ? ? A . n A 1 171 ARG 171 207 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MWH 1 301 301 MWH LIG A . C 3 HOH 1 401 56 HOH HOH A . C 3 HOH 2 402 47 HOH HOH A . C 3 HOH 3 403 45 HOH HOH A . C 3 HOH 4 404 35 HOH HOH A . C 3 HOH 5 405 15 HOH HOH A . C 3 HOH 6 406 20 HOH HOH A . C 3 HOH 7 407 38 HOH HOH A . C 3 HOH 8 408 13 HOH HOH A . C 3 HOH 9 409 6 HOH HOH A . C 3 HOH 10 410 1 HOH HOH A . C 3 HOH 11 411 43 HOH HOH A . C 3 HOH 12 412 8 HOH HOH A . C 3 HOH 13 413 22 HOH HOH A . C 3 HOH 14 414 37 HOH HOH A . C 3 HOH 15 415 62 HOH HOH A . C 3 HOH 16 416 4 HOH HOH A . C 3 HOH 17 417 25 HOH HOH A . C 3 HOH 18 418 14 HOH HOH A . C 3 HOH 19 419 7 HOH HOH A . C 3 HOH 20 420 24 HOH HOH A . C 3 HOH 21 421 18 HOH HOH A . C 3 HOH 22 422 44 HOH HOH A . C 3 HOH 23 423 29 HOH HOH A . C 3 HOH 24 424 54 HOH HOH A . C 3 HOH 25 425 12 HOH HOH A . C 3 HOH 26 426 9 HOH HOH A . C 3 HOH 27 427 10 HOH HOH A . C 3 HOH 28 428 5 HOH HOH A . C 3 HOH 29 429 3 HOH HOH A . C 3 HOH 30 430 23 HOH HOH A . C 3 HOH 31 431 49 HOH HOH A . C 3 HOH 32 432 30 HOH HOH A . C 3 HOH 33 433 2 HOH HOH A . C 3 HOH 34 434 34 HOH HOH A . C 3 HOH 35 435 50 HOH HOH A . C 3 HOH 36 436 42 HOH HOH A . C 3 HOH 37 437 28 HOH HOH A . C 3 HOH 38 438 17 HOH HOH A . C 3 HOH 39 439 55 HOH HOH A . C 3 HOH 40 440 59 HOH HOH A . C 3 HOH 41 441 21 HOH HOH A . C 3 HOH 42 442 36 HOH HOH A . C 3 HOH 43 443 26 HOH HOH A . C 3 HOH 44 444 11 HOH HOH A . C 3 HOH 45 445 31 HOH HOH A . C 3 HOH 46 446 27 HOH HOH A . C 3 HOH 47 447 46 HOH HOH A . C 3 HOH 48 448 52 HOH HOH A . C 3 HOH 49 449 39 HOH HOH A . C 3 HOH 50 450 19 HOH HOH A . C 3 HOH 51 451 53 HOH HOH A . C 3 HOH 52 452 57 HOH HOH A . C 3 HOH 53 453 61 HOH HOH A . C 3 HOH 54 454 58 HOH HOH A . C 3 HOH 55 455 60 HOH HOH A . C 3 HOH 56 456 48 HOH HOH A . C 3 HOH 57 457 51 HOH HOH A . C 3 HOH 58 458 41 HOH HOH A . C 3 HOH 59 459 16 HOH HOH A . C 3 HOH 60 460 33 HOH HOH A . # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 0 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id SER _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 105 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id OG _pdbx_unobs_or_zero_occ_atoms.label_alt_id B _pdbx_unobs_or_zero_occ_atoms.label_asym_id A _pdbx_unobs_or_zero_occ_atoms.label_comp_id SER _pdbx_unobs_or_zero_occ_atoms.label_seq_id 69 _pdbx_unobs_or_zero_occ_atoms.label_atom_id OG # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 103.66 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8HTR _cell.details ? _cell.formula_units_Z ? _cell.length_a 31.902 _cell.length_a_esd ? _cell.length_b 40.597 _cell.length_b_esd ? _cell.length_c 53.808 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8HTR _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8HTR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.71 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 28.18 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M ammonium acetate, 0.1 M bis-tris pH 5.5, 17% PEG 10000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-03-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8HTR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.60 _reflns.d_resolution_low 32.07 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17216 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.086 _reflns.pdbx_Rpim_I_all 0.033 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 111450 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.080 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.63 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 3130 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 709 _reflns_shell.percent_possible_obs 82.3 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.4 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.9 _reflns_shell.pdbx_Rrim_I_all 0.779 _reflns_shell.pdbx_Rpim_I_all 0.367 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.681 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.683 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8HTR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.60 _refine.ls_d_res_low 31.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17202 _refine.ls_number_reflns_R_free 1782 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.52 _refine.ls_percent_reflns_R_free 10.36 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1986 _refine.ls_R_factor_R_free 0.2331 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1948 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5VAU _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.01 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.17 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1171 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 57 _refine_hist.number_atoms_solvent 60 _refine_hist.number_atoms_total 1288 _refine_hist.d_res_high 1.60 _refine_hist.d_res_low 31.00 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1269 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.873 ? 1720 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 8.963 ? 217 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.052 ? 167 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.011 ? 217 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.60 1.64 . . 103 1009 82.00 . . . . 0.2706 . . . . . . . . . . . 0.3525 'X-RAY DIFFRACTION' 1.64 1.69 . . 145 1087 90.00 . . . . 0.2589 . . . . . . . . . . . 0.2872 'X-RAY DIFFRACTION' 1.69 1.75 . . 143 1193 98.00 . . . . 0.2231 . . . . . . . . . . . 0.2577 'X-RAY DIFFRACTION' 1.75 1.81 . . 130 1209 99.00 . . . . 0.2167 . . . . . . . . . . . 0.3258 'X-RAY DIFFRACTION' 1.81 1.88 . . 128 1224 99.00 . . . . 0.2059 . . . . . . . . . . . 0.2201 'X-RAY DIFFRACTION' 1.88 1.97 . . 144 1199 99.00 . . . . 0.2008 . . . . . . . . . . . 0.2570 'X-RAY DIFFRACTION' 1.97 2.07 . . 151 1204 99.00 . . . . 0.1957 . . . . . . . . . . . 0.2268 'X-RAY DIFFRACTION' 2.07 2.20 . . 124 1199 97.00 . . . . 0.1962 . . . . . . . . . . . 0.2520 'X-RAY DIFFRACTION' 2.20 2.37 . . 158 1214 99.00 . . . . 0.1905 . . . . . . . . . . . 0.2361 'X-RAY DIFFRACTION' 2.37 2.61 . . 154 1192 99.00 . . . . 0.2061 . . . . . . . . . . . 0.2243 'X-RAY DIFFRACTION' 2.61 2.99 . . 135 1217 98.00 . . . . 0.2049 . . . . . . . . . . . 0.2542 'X-RAY DIFFRACTION' 2.99 3.76 . . 140 1213 98.00 . . . . 0.1827 . . . . . . . . . . . 0.2110 'X-RAY DIFFRACTION' 3.76 31.00 . . 127 1260 97.00 . . . . 0.1834 . . . . . . . . . . . 0.2179 # _struct.entry_id 8HTR _struct.title 'Crystal structure of Bcl2 in complex with S-9c' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8HTR _struct_keywords.text 'Inhibitor, APOPTOSIS' _struct_keywords.pdbx_keywords APOPTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8HTR _struct_ref.pdbx_db_accession 8HTR _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8HTR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 171 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8HTR _struct_ref_seq.db_align_beg -4 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 207 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -4 _struct_ref_seq.pdbx_auth_seq_align_end 207 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 11 ? ARG A 31 ? ARG A 6 ARG A 26 1 ? 21 HELX_P HELX_P2 AA2 GLU A 55 ? TYR A 72 ? GLU A 50 TYR A 108 1 ? 18 HELX_P HELX_P3 AA3 TYR A 72 ? HIS A 84 ? TYR A 108 HIS A 120 1 ? 13 HELX_P HELX_P4 AA4 THR A 89 ? PHE A 102 ? THR A 125 PHE A 138 1 ? 14 HELX_P HELX_P5 AA5 ASN A 107 ? ARG A 128 ? ASN A 143 ARG A 164 1 ? 22 HELX_P HELX_P6 AA6 PRO A 132 ? LEU A 149 ? PRO A 168 LEU A 185 1 ? 18 HELX_P HELX_P7 AA7 LEU A 149 ? ASN A 156 ? LEU A 185 ASN A 192 1 ? 8 HELX_P HELX_P8 AA8 GLY A 157 ? GLY A 167 ? GLY A 193 GLY A 203 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 8HTR _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -4 ? A GLY 1 2 1 Y 1 A PRO -3 ? A PRO 2 3 1 Y 1 A LEU -2 ? A LEU 3 4 1 Y 1 A GLY -1 ? A GLY 4 5 1 Y 1 A SER 0 ? A SER 5 6 1 Y 1 A MET 1 ? A MET 6 7 1 Y 1 A ALA 2 ? A ALA 7 8 1 Y 1 A HIS 3 ? A HIS 8 9 1 Y 1 A ALA 4 ? A ALA 9 10 1 Y 1 A GLY 5 ? A GLY 10 11 1 Y 1 A ASP 31 ? A ASP 36 12 1 Y 1 A ALA 32 ? A ALA 37 13 1 Y 1 A GLY 33 ? A GLY 38 14 1 Y 1 A ASP 34 ? A ASP 39 15 1 Y 1 A ASP 35 ? A ASP 40 16 1 Y 1 A VAL 36 ? A VAL 41 17 1 Y 1 A GLU 37 ? A GLU 42 18 1 Y 1 A GLU 38 ? A GLU 43 19 1 Y 1 A ASN 39 ? A ASN 44 20 1 Y 1 A ARG 40 ? A ARG 45 21 1 Y 1 A THR 41 ? A THR 46 22 1 Y 1 A GLU 42 ? A GLU 47 23 1 Y 1 A ALA 43 ? A ALA 48 24 1 Y 1 A PRO 44 ? A PRO 49 25 1 Y 1 A GLU 45 ? A GLU 50 26 1 Y 1 A GLY 46 ? A GLY 51 27 1 Y 1 A THR 47 ? A THR 52 28 1 Y 1 A GLU 48 ? A GLU 53 29 1 Y 1 A SER 205 ? A SER 169 30 1 Y 1 A MET 206 ? A MET 170 31 1 Y 1 A ARG 207 ? A ARG 171 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MWH N1 N N N 250 MWH N3 N N N 251 MWH C4 C Y N 252 MWH C5 C Y N 253 MWH C6 C Y N 254 MWH C7 C N N 255 MWH C8 C N N 256 MWH C10 C N N 257 MWH C13 C N N 258 MWH C15 C Y N 259 MWH C17 C Y N 260 MWH C20 C Y N 261 MWH C21 C Y N 262 MWH C22 C Y N 263 MWH C24 C Y N 264 MWH C26 C Y N 265 MWH C28 C Y N 266 MWH C1 C Y N 267 MWH C11 C N N 268 MWH C12 C N N 269 MWH C14 C Y N 270 MWH C16 C Y N 271 MWH C18 C Y N 272 MWH C19 C Y N 273 MWH C2 C Y N 274 MWH C23 C Y N 275 MWH C25 C Y N 276 MWH C27 C Y N 277 MWH C29 C Y N 278 MWH C3 C Y N 279 MWH C30 C Y N 280 MWH C31 C Y N 281 MWH C32 C Y N 282 MWH C33 C N N 283 MWH C34 C N N 284 MWH C35 C N N 285 MWH C36 C N S 286 MWH C37 C Y N 287 MWH C38 C Y N 288 MWH C39 C Y N 289 MWH C40 C Y N 290 MWH C41 C Y N 291 MWH C42 C Y N 292 MWH C9 C N N 293 MWH N2 N N N 294 MWH N4 N Y N 295 MWH N5 N Y N 296 MWH N6 N N N 297 MWH O1 O N N 298 MWH O2 O N N 299 MWH O3 O N N 300 MWH O4 O N N 301 MWH O5 O N N 302 MWH O6 O N N 303 MWH O7 O N N 304 MWH S1 S N N 305 MWH CL1 CL N N 306 MWH H1 H N N 307 MWH H2 H N N 308 MWH H3 H N N 309 MWH H4 H N N 310 MWH H5 H N N 311 MWH H6 H N N 312 MWH H7 H N N 313 MWH H8 H N N 314 MWH H9 H N N 315 MWH H10 H N N 316 MWH H11 H N N 317 MWH H12 H N N 318 MWH H13 H N N 319 MWH H14 H N N 320 MWH H15 H N N 321 MWH H16 H N N 322 MWH H17 H N N 323 MWH H18 H N N 324 MWH H19 H N N 325 MWH H20 H N N 326 MWH H21 H N N 327 MWH H22 H N N 328 MWH H23 H N N 329 MWH H24 H N N 330 MWH H25 H N N 331 MWH H26 H N N 332 MWH H27 H N N 333 MWH H28 H N N 334 MWH H29 H N N 335 MWH H30 H N N 336 MWH H31 H N N 337 MWH H32 H N N 338 MWH H33 H N N 339 MWH H34 H N N 340 MWH H35 H N N 341 MWH H36 H N N 342 MWH H37 H N N 343 MWH H38 H N N 344 MWH H39 H N N 345 PHE N N N N 346 PHE CA C N S 347 PHE C C N N 348 PHE O O N N 349 PHE CB C N N 350 PHE CG C Y N 351 PHE CD1 C Y N 352 PHE CD2 C Y N 353 PHE CE1 C Y N 354 PHE CE2 C Y N 355 PHE CZ C Y N 356 PHE OXT O N N 357 PHE H H N N 358 PHE H2 H N N 359 PHE HA H N N 360 PHE HB2 H N N 361 PHE HB3 H N N 362 PHE HD1 H N N 363 PHE HD2 H N N 364 PHE HE1 H N N 365 PHE HE2 H N N 366 PHE HZ H N N 367 PHE HXT H N N 368 PRO N N N N 369 PRO CA C N S 370 PRO C C N N 371 PRO O O N N 372 PRO CB C N N 373 PRO CG C N N 374 PRO CD C N N 375 PRO OXT O N N 376 PRO H H N N 377 PRO HA H N N 378 PRO HB2 H N N 379 PRO HB3 H N N 380 PRO HG2 H N N 381 PRO HG3 H N N 382 PRO HD2 H N N 383 PRO HD3 H N N 384 PRO HXT H N N 385 SER N N N N 386 SER CA C N S 387 SER C C N N 388 SER O O N N 389 SER CB C N N 390 SER OG O N N 391 SER OXT O N N 392 SER H H N N 393 SER H2 H N N 394 SER HA H N N 395 SER HB2 H N N 396 SER HB3 H N N 397 SER HG H N N 398 SER HXT H N N 399 THR N N N N 400 THR CA C N S 401 THR C C N N 402 THR O O N N 403 THR CB C N R 404 THR OG1 O N N 405 THR CG2 C N N 406 THR OXT O N N 407 THR H H N N 408 THR H2 H N N 409 THR HA H N N 410 THR HB H N N 411 THR HG1 H N N 412 THR HG21 H N N 413 THR HG22 H N N 414 THR HG23 H N N 415 THR HXT H N N 416 TRP N N N N 417 TRP CA C N S 418 TRP C C N N 419 TRP O O N N 420 TRP CB C N N 421 TRP CG C Y N 422 TRP CD1 C Y N 423 TRP CD2 C Y N 424 TRP NE1 N Y N 425 TRP CE2 C Y N 426 TRP CE3 C Y N 427 TRP CZ2 C Y N 428 TRP CZ3 C Y N 429 TRP CH2 C Y N 430 TRP OXT O N N 431 TRP H H N N 432 TRP H2 H N N 433 TRP HA H N N 434 TRP HB2 H N N 435 TRP HB3 H N N 436 TRP HD1 H N N 437 TRP HE1 H N N 438 TRP HE3 H N N 439 TRP HZ2 H N N 440 TRP HZ3 H N N 441 TRP HH2 H N N 442 TRP HXT H N N 443 TYR N N N N 444 TYR CA C N S 445 TYR C C N N 446 TYR O O N N 447 TYR CB C N N 448 TYR CG C Y N 449 TYR CD1 C Y N 450 TYR CD2 C Y N 451 TYR CE1 C Y N 452 TYR CE2 C Y N 453 TYR CZ C Y N 454 TYR OH O N N 455 TYR OXT O N N 456 TYR H H N N 457 TYR H2 H N N 458 TYR HA H N N 459 TYR HB2 H N N 460 TYR HB3 H N N 461 TYR HD1 H N N 462 TYR HD2 H N N 463 TYR HE1 H N N 464 TYR HE2 H N N 465 TYR HH H N N 466 TYR HXT H N N 467 VAL N N N N 468 VAL CA C N S 469 VAL C C N N 470 VAL O O N N 471 VAL CB C N N 472 VAL CG1 C N N 473 VAL CG2 C N N 474 VAL OXT O N N 475 VAL H H N N 476 VAL H2 H N N 477 VAL HA H N N 478 VAL HB H N N 479 VAL HG11 H N N 480 VAL HG12 H N N 481 VAL HG13 H N N 482 VAL HG21 H N N 483 VAL HG22 H N N 484 VAL HG23 H N N 485 VAL HXT H N N 486 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 MWH O1 N1 doub N N 237 MWH N1 O2 sing N N 238 MWH N1 C1 sing N N 239 MWH O5 S1 doub N N 240 MWH C2 C1 doub Y N 241 MWH C2 C3 sing Y N 242 MWH C1 C6 sing Y N 243 MWH S1 C3 sing N N 244 MWH S1 O4 doub N N 245 MWH S1 N3 sing N N 246 MWH C3 C4 doub Y N 247 MWH C11 C12 sing N N 248 MWH C11 O3 sing N N 249 MWH C6 N2 sing N N 250 MWH C6 C5 doub Y N 251 MWH N2 C7 sing N N 252 MWH C12 C8 sing N N 253 MWH N3 C13 sing N N 254 MWH O6 C13 doub N N 255 MWH C4 C5 sing Y N 256 MWH C24 C23 doub Y N 257 MWH C24 C25 sing Y N 258 MWH C13 C14 sing N N 259 MWH C8 C7 sing N N 260 MWH C8 C9 sing N N 261 MWH O3 C10 sing N N 262 MWH C15 C14 doub Y N 263 MWH C15 C16 sing Y N 264 MWH C23 N5 sing Y N 265 MWH CL1 C42 sing N N 266 MWH C14 C19 sing Y N 267 MWH C16 C17 doub Y N 268 MWH C25 C26 sing Y N 269 MWH C25 C22 doub Y N 270 MWH C26 C20 doub Y N 271 MWH C10 C9 sing N N 272 MWH C41 C42 doub Y N 273 MWH C41 C40 sing Y N 274 MWH C42 C37 sing Y N 275 MWH N5 C22 sing Y N 276 MWH C28 C29 doub Y N 277 MWH C28 C27 sing Y N 278 MWH C19 O7 sing N N 279 MWH C19 C18 doub Y N 280 MWH C22 N4 sing Y N 281 MWH C17 C18 sing Y N 282 MWH C17 C27 sing N N 283 MWH C40 C39 doub Y N 284 MWH C20 O7 sing N N 285 MWH C20 C21 sing Y N 286 MWH C29 C30 sing Y N 287 MWH C27 C32 doub Y N 288 MWH C37 C36 sing N N 289 MWH C37 C38 doub Y N 290 MWH N4 C21 doub Y N 291 MWH C36 C35 sing N N 292 MWH C36 N6 sing N N 293 MWH C39 C38 sing Y N 294 MWH C30 N6 sing N N 295 MWH C30 C31 doub Y N 296 MWH C32 C31 sing Y N 297 MWH C35 C34 sing N N 298 MWH N6 C33 sing N N 299 MWH C33 C34 sing N N 300 MWH N3 H1 sing N N 301 MWH C4 H2 sing N N 302 MWH C5 H3 sing N N 303 MWH C7 H4 sing N N 304 MWH C7 H5 sing N N 305 MWH C8 H6 sing N N 306 MWH C10 H7 sing N N 307 MWH C10 H8 sing N N 308 MWH C15 H9 sing N N 309 MWH C21 H10 sing N N 310 MWH C24 H11 sing N N 311 MWH C26 H12 sing N N 312 MWH C28 H13 sing N N 313 MWH C11 H14 sing N N 314 MWH C11 H15 sing N N 315 MWH C12 H16 sing N N 316 MWH C12 H17 sing N N 317 MWH C16 H18 sing N N 318 MWH C18 H19 sing N N 319 MWH C2 H20 sing N N 320 MWH C23 H21 sing N N 321 MWH C29 H22 sing N N 322 MWH C31 H23 sing N N 323 MWH C32 H24 sing N N 324 MWH C33 H25 sing N N 325 MWH C33 H26 sing N N 326 MWH C34 H27 sing N N 327 MWH C34 H28 sing N N 328 MWH C35 H29 sing N N 329 MWH C35 H30 sing N N 330 MWH C36 H31 sing N N 331 MWH C38 H32 sing N N 332 MWH C39 H33 sing N N 333 MWH C40 H34 sing N N 334 MWH C41 H35 sing N N 335 MWH C9 H36 sing N N 336 MWH C9 H37 sing N N 337 MWH N2 H38 sing N N 338 MWH N5 H39 sing N N 339 PHE N CA sing N N 340 PHE N H sing N N 341 PHE N H2 sing N N 342 PHE CA C sing N N 343 PHE CA CB sing N N 344 PHE CA HA sing N N 345 PHE C O doub N N 346 PHE C OXT sing N N 347 PHE CB CG sing N N 348 PHE CB HB2 sing N N 349 PHE CB HB3 sing N N 350 PHE CG CD1 doub Y N 351 PHE CG CD2 sing Y N 352 PHE CD1 CE1 sing Y N 353 PHE CD1 HD1 sing N N 354 PHE CD2 CE2 doub Y N 355 PHE CD2 HD2 sing N N 356 PHE CE1 CZ doub Y N 357 PHE CE1 HE1 sing N N 358 PHE CE2 CZ sing Y N 359 PHE CE2 HE2 sing N N 360 PHE CZ HZ sing N N 361 PHE OXT HXT sing N N 362 PRO N CA sing N N 363 PRO N CD sing N N 364 PRO N H sing N N 365 PRO CA C sing N N 366 PRO CA CB sing N N 367 PRO CA HA sing N N 368 PRO C O doub N N 369 PRO C OXT sing N N 370 PRO CB CG sing N N 371 PRO CB HB2 sing N N 372 PRO CB HB3 sing N N 373 PRO CG CD sing N N 374 PRO CG HG2 sing N N 375 PRO CG HG3 sing N N 376 PRO CD HD2 sing N N 377 PRO CD HD3 sing N N 378 PRO OXT HXT sing N N 379 SER N CA sing N N 380 SER N H sing N N 381 SER N H2 sing N N 382 SER CA C sing N N 383 SER CA CB sing N N 384 SER CA HA sing N N 385 SER C O doub N N 386 SER C OXT sing N N 387 SER CB OG sing N N 388 SER CB HB2 sing N N 389 SER CB HB3 sing N N 390 SER OG HG sing N N 391 SER OXT HXT sing N N 392 THR N CA sing N N 393 THR N H sing N N 394 THR N H2 sing N N 395 THR CA C sing N N 396 THR CA CB sing N N 397 THR CA HA sing N N 398 THR C O doub N N 399 THR C OXT sing N N 400 THR CB OG1 sing N N 401 THR CB CG2 sing N N 402 THR CB HB sing N N 403 THR OG1 HG1 sing N N 404 THR CG2 HG21 sing N N 405 THR CG2 HG22 sing N N 406 THR CG2 HG23 sing N N 407 THR OXT HXT sing N N 408 TRP N CA sing N N 409 TRP N H sing N N 410 TRP N H2 sing N N 411 TRP CA C sing N N 412 TRP CA CB sing N N 413 TRP CA HA sing N N 414 TRP C O doub N N 415 TRP C OXT sing N N 416 TRP CB CG sing N N 417 TRP CB HB2 sing N N 418 TRP CB HB3 sing N N 419 TRP CG CD1 doub Y N 420 TRP CG CD2 sing Y N 421 TRP CD1 NE1 sing Y N 422 TRP CD1 HD1 sing N N 423 TRP CD2 CE2 doub Y N 424 TRP CD2 CE3 sing Y N 425 TRP NE1 CE2 sing Y N 426 TRP NE1 HE1 sing N N 427 TRP CE2 CZ2 sing Y N 428 TRP CE3 CZ3 doub Y N 429 TRP CE3 HE3 sing N N 430 TRP CZ2 CH2 doub Y N 431 TRP CZ2 HZ2 sing N N 432 TRP CZ3 CH2 sing Y N 433 TRP CZ3 HZ3 sing N N 434 TRP CH2 HH2 sing N N 435 TRP OXT HXT sing N N 436 TYR N CA sing N N 437 TYR N H sing N N 438 TYR N H2 sing N N 439 TYR CA C sing N N 440 TYR CA CB sing N N 441 TYR CA HA sing N N 442 TYR C O doub N N 443 TYR C OXT sing N N 444 TYR CB CG sing N N 445 TYR CB HB2 sing N N 446 TYR CB HB3 sing N N 447 TYR CG CD1 doub Y N 448 TYR CG CD2 sing Y N 449 TYR CD1 CE1 sing Y N 450 TYR CD1 HD1 sing N N 451 TYR CD2 CE2 doub Y N 452 TYR CD2 HD2 sing N N 453 TYR CE1 CZ doub Y N 454 TYR CE1 HE1 sing N N 455 TYR CE2 CZ sing Y N 456 TYR CE2 HE2 sing N N 457 TYR CZ OH sing N N 458 TYR OH HH sing N N 459 TYR OXT HXT sing N N 460 VAL N CA sing N N 461 VAL N H sing N N 462 VAL N H2 sing N N 463 VAL CA C sing N N 464 VAL CA CB sing N N 465 VAL CA HA sing N N 466 VAL C O doub N N 467 VAL C OXT sing N N 468 VAL CB CG1 sing N N 469 VAL CB CG2 sing N N 470 VAL CB HB sing N N 471 VAL CG1 HG11 sing N N 472 VAL CG1 HG12 sing N N 473 VAL CG1 HG13 sing N N 474 VAL CG2 HG21 sing N N 475 VAL CG2 HG22 sing N N 476 VAL CG2 HG23 sing N N 477 VAL OXT HXT sing N N 478 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id MWH _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id MWH _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5VAU _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8HTR _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.031346 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.007619 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.024632 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019126 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O S # loop_