data_8I66 # _entry.id 8I66 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8I66 pdb_00008i66 10.2210/pdb8i66/pdb WWPDB D_1300034965 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-07-12 2 'Structure model' 1 1 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.page_last' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8I66 _pdbx_database_status.recvd_initial_deposition_date 2023-01-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email bgopal@iisc.ac.in _pdbx_contact_author.name_first Balasubramanian _pdbx_contact_author.name_last Gopal _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9097-5052 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Raj, P.' 1 0000-0001-5625-0568 'Paul, A.' 2 0000-0003-4414-3444 'Gopal, B.' 3 0000-0001-9097-5052 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? FR ? ? primary Eur.J.Med.Chem. EJMCA5 0493 0223-5234 ? ? 258 ? 115604 115604 ;Crystal structures of non-uracil ring fragments in complex with Mycobacterium tuberculosis uracil DNA glycosylase (MtUng) as a starting point for novel inhibitor design: A case study with the barbituric acid fragment. ; 2023 ? 10.1016/j.ejmech.2023.115604 37399710 ? ? ? ? ? ? ? ? ? US ? ? 1 'Acta Crystallogr D Biol Crystallogr' ABCRE6 ? 1399-0047 ? ? 71 ? 1514 1527 'Structural plasticity in Mycobacterium tuberculosis uracil-DNA glycosylase (MtUng) and its functional implications.' 2015 ? 10.1107/S1399004715009311 26143923 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kesharwani, S.' 1 ? primary 'Raj, P.' 2 ? primary 'Paul, A.' 3 ? primary 'Roy, K.' 4 ? primary 'Bhanot, A.' 5 ? primary 'Mehta, A.' 6 ? primary 'Gopal, A.' 7 ? primary 'Varshney, U.' 8 ? primary 'Gopal, B.' 9 ? primary 'Sundriyal, S.' 10 ? 1 'Arif, S.M.' 11 ? 1 'Geethanandan, K.' 12 ? 1 'Mishra, P.' 13 ? 1 'Surolia, A.' 14 ? 1 'Varshney, U.' 15 ? 1 'Vijayan, M.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uracil-DNA glycosylase' 25813.543 1 3.2.2.27 ? ? ? 2 non-polymer syn '2,4-dioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylic acid' 156.096 1 ? ? ? ? 3 non-polymer syn 'CITRIC ACID' 192.124 1 ? ? ? ? 4 water nat water 18.015 36 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name UDG # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHGMASMTARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDP YPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVT ECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHGMASMTARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDP YPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVT ECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2,4-dioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylic acid' 5CU 3 'CITRIC ACID' CIT 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 GLY n 1 9 MET n 1 10 ALA n 1 11 SER n 1 12 MET n 1 13 THR n 1 14 ALA n 1 15 ARG n 1 16 PRO n 1 17 LEU n 1 18 SER n 1 19 GLU n 1 20 LEU n 1 21 VAL n 1 22 GLU n 1 23 ARG n 1 24 GLY n 1 25 TRP n 1 26 ALA n 1 27 ALA n 1 28 ALA n 1 29 LEU n 1 30 GLU n 1 31 PRO n 1 32 VAL n 1 33 ALA n 1 34 ASP n 1 35 GLN n 1 36 VAL n 1 37 ALA n 1 38 HIS n 1 39 MET n 1 40 GLY n 1 41 GLN n 1 42 PHE n 1 43 LEU n 1 44 ARG n 1 45 ALA n 1 46 GLU n 1 47 ILE n 1 48 ALA n 1 49 ALA n 1 50 GLY n 1 51 ARG n 1 52 ARG n 1 53 TYR n 1 54 LEU n 1 55 PRO n 1 56 ALA n 1 57 GLY n 1 58 SER n 1 59 ASN n 1 60 VAL n 1 61 LEU n 1 62 ARG n 1 63 ALA n 1 64 PHE n 1 65 THR n 1 66 PHE n 1 67 PRO n 1 68 PHE n 1 69 ASP n 1 70 ASN n 1 71 VAL n 1 72 ARG n 1 73 VAL n 1 74 LEU n 1 75 ILE n 1 76 VAL n 1 77 GLY n 1 78 GLN n 1 79 ASP n 1 80 PRO n 1 81 TYR n 1 82 PRO n 1 83 THR n 1 84 PRO n 1 85 GLY n 1 86 HIS n 1 87 ALA n 1 88 VAL n 1 89 GLY n 1 90 LEU n 1 91 SER n 1 92 PHE n 1 93 SER n 1 94 VAL n 1 95 ALA n 1 96 PRO n 1 97 ASP n 1 98 VAL n 1 99 ARG n 1 100 PRO n 1 101 TRP n 1 102 PRO n 1 103 ARG n 1 104 SER n 1 105 LEU n 1 106 ALA n 1 107 ASN n 1 108 ILE n 1 109 PHE n 1 110 ASP n 1 111 GLU n 1 112 TYR n 1 113 THR n 1 114 ALA n 1 115 ASP n 1 116 LEU n 1 117 GLY n 1 118 TYR n 1 119 PRO n 1 120 LEU n 1 121 PRO n 1 122 SER n 1 123 ASN n 1 124 GLY n 1 125 ASP n 1 126 LEU n 1 127 THR n 1 128 PRO n 1 129 TRP n 1 130 ALA n 1 131 GLN n 1 132 ARG n 1 133 GLY n 1 134 VAL n 1 135 LEU n 1 136 LEU n 1 137 LEU n 1 138 ASN n 1 139 ARG n 1 140 VAL n 1 141 LEU n 1 142 THR n 1 143 VAL n 1 144 ARG n 1 145 PRO n 1 146 SER n 1 147 ASN n 1 148 PRO n 1 149 ALA n 1 150 SER n 1 151 HIS n 1 152 ARG n 1 153 GLY n 1 154 LYS n 1 155 GLY n 1 156 TRP n 1 157 GLU n 1 158 ALA n 1 159 VAL n 1 160 THR n 1 161 GLU n 1 162 CYS n 1 163 ALA n 1 164 ILE n 1 165 ARG n 1 166 ALA n 1 167 LEU n 1 168 ALA n 1 169 ALA n 1 170 ARG n 1 171 ALA n 1 172 ALA n 1 173 PRO n 1 174 LEU n 1 175 VAL n 1 176 ALA n 1 177 ILE n 1 178 LEU n 1 179 TRP n 1 180 GLY n 1 181 ARG n 1 182 ASP n 1 183 ALA n 1 184 SER n 1 185 THR n 1 186 LEU n 1 187 LYS n 1 188 PRO n 1 189 MET n 1 190 LEU n 1 191 ALA n 1 192 ALA n 1 193 GLY n 1 194 ASN n 1 195 CYS n 1 196 VAL n 1 197 ALA n 1 198 ILE n 1 199 GLU n 1 200 SER n 1 201 PRO n 1 202 HIS n 1 203 PRO n 1 204 SER n 1 205 PRO n 1 206 LEU n 1 207 SER n 1 208 ALA n 1 209 SER n 1 210 ARG n 1 211 GLY n 1 212 PHE n 1 213 PHE n 1 214 GLY n 1 215 SER n 1 216 ARG n 1 217 PRO n 1 218 PHE n 1 219 SER n 1 220 ARG n 1 221 ALA n 1 222 ASN n 1 223 GLU n 1 224 LEU n 1 225 LEU n 1 226 VAL n 1 227 GLY n 1 228 MET n 1 229 GLY n 1 230 ALA n 1 231 GLU n 1 232 PRO n 1 233 ILE n 1 234 ASP n 1 235 TRP n 1 236 ARG n 1 237 LEU n 1 238 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 238 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ung, Rv2976c, MTCY349.11' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis H37Rv' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 5CU non-polymer . '2,4-dioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylic acid' ? 'C5 H4 N2 O4' 156.096 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CIT non-polymer . 'CITRIC ACID' ? 'C6 H8 O7' 192.124 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -10 ? ? ? A . n A 1 2 HIS 2 -9 ? ? ? A . n A 1 3 HIS 3 -8 ? ? ? A . n A 1 4 HIS 4 -7 ? ? ? A . n A 1 5 HIS 5 -6 ? ? ? A . n A 1 6 HIS 6 -5 ? ? ? A . n A 1 7 HIS 7 -4 ? ? ? A . n A 1 8 GLY 8 -3 ? ? ? A . n A 1 9 MET 9 -2 ? ? ? A . n A 1 10 ALA 10 -1 ? ? ? A . n A 1 11 SER 11 0 0 SER SER A . n A 1 12 MET 12 1 1 MET MET A . n A 1 13 THR 13 2 2 THR THR A . n A 1 14 ALA 14 3 3 ALA ALA A . n A 1 15 ARG 15 4 4 ARG ARG A . n A 1 16 PRO 16 5 5 PRO PRO A . n A 1 17 LEU 17 6 6 LEU LEU A . n A 1 18 SER 18 7 7 SER SER A . n A 1 19 GLU 19 8 8 GLU GLU A . n A 1 20 LEU 20 9 9 LEU LEU A . n A 1 21 VAL 21 10 10 VAL VAL A . n A 1 22 GLU 22 11 11 GLU GLU A . n A 1 23 ARG 23 12 12 ARG ARG A . n A 1 24 GLY 24 13 13 GLY GLY A . n A 1 25 TRP 25 14 14 TRP TRP A . n A 1 26 ALA 26 15 15 ALA ALA A . n A 1 27 ALA 27 16 16 ALA ALA A . n A 1 28 ALA 28 17 17 ALA ALA A . n A 1 29 LEU 29 18 18 LEU LEU A . n A 1 30 GLU 30 19 19 GLU GLU A . n A 1 31 PRO 31 20 20 PRO PRO A . n A 1 32 VAL 32 21 21 VAL VAL A . n A 1 33 ALA 33 22 22 ALA ALA A . n A 1 34 ASP 34 23 23 ASP ASP A . n A 1 35 GLN 35 24 24 GLN GLN A . n A 1 36 VAL 36 25 25 VAL VAL A . n A 1 37 ALA 37 26 26 ALA ALA A . n A 1 38 HIS 38 27 27 HIS HIS A . n A 1 39 MET 39 28 28 MET MET A . n A 1 40 GLY 40 29 29 GLY GLY A . n A 1 41 GLN 41 30 30 GLN GLN A . n A 1 42 PHE 42 31 31 PHE PHE A . n A 1 43 LEU 43 32 32 LEU LEU A . n A 1 44 ARG 44 33 33 ARG ARG A . n A 1 45 ALA 45 34 34 ALA ALA A . n A 1 46 GLU 46 35 35 GLU GLU A . n A 1 47 ILE 47 36 36 ILE ILE A . n A 1 48 ALA 48 37 37 ALA ALA A . n A 1 49 ALA 49 38 38 ALA ALA A . n A 1 50 GLY 50 39 39 GLY GLY A . n A 1 51 ARG 51 40 40 ARG ARG A . n A 1 52 ARG 52 41 41 ARG ARG A . n A 1 53 TYR 53 42 42 TYR TYR A . n A 1 54 LEU 54 43 43 LEU LEU A . n A 1 55 PRO 55 44 44 PRO PRO A . n A 1 56 ALA 56 45 45 ALA ALA A . n A 1 57 GLY 57 46 46 GLY GLY A . n A 1 58 SER 58 47 47 SER SER A . n A 1 59 ASN 59 48 48 ASN ASN A . n A 1 60 VAL 60 49 49 VAL VAL A . n A 1 61 LEU 61 50 50 LEU LEU A . n A 1 62 ARG 62 51 51 ARG ARG A . n A 1 63 ALA 63 52 52 ALA ALA A . n A 1 64 PHE 64 53 53 PHE PHE A . n A 1 65 THR 65 54 54 THR THR A . n A 1 66 PHE 66 55 55 PHE PHE A . n A 1 67 PRO 67 56 56 PRO PRO A . n A 1 68 PHE 68 57 57 PHE PHE A . n A 1 69 ASP 69 58 58 ASP ASP A . n A 1 70 ASN 70 59 59 ASN ASN A . n A 1 71 VAL 71 60 60 VAL VAL A . n A 1 72 ARG 72 61 61 ARG ARG A . n A 1 73 VAL 73 62 62 VAL VAL A . n A 1 74 LEU 74 63 63 LEU LEU A . n A 1 75 ILE 75 64 64 ILE ILE A . n A 1 76 VAL 76 65 65 VAL VAL A . n A 1 77 GLY 77 66 66 GLY GLY A . n A 1 78 GLN 78 67 67 GLN GLN A . n A 1 79 ASP 79 68 68 ASP ASP A . n A 1 80 PRO 80 69 69 PRO PRO A . n A 1 81 TYR 81 70 70 TYR TYR A . n A 1 82 PRO 82 71 71 PRO PRO A . n A 1 83 THR 83 72 72 THR THR A . n A 1 84 PRO 84 73 73 PRO PRO A . n A 1 85 GLY 85 74 74 GLY GLY A . n A 1 86 HIS 86 75 75 HIS HIS A . n A 1 87 ALA 87 76 76 ALA ALA A . n A 1 88 VAL 88 77 77 VAL VAL A . n A 1 89 GLY 89 78 78 GLY GLY A . n A 1 90 LEU 90 79 79 LEU LEU A . n A 1 91 SER 91 80 80 SER SER A . n A 1 92 PHE 92 81 81 PHE PHE A . n A 1 93 SER 93 82 82 SER SER A . n A 1 94 VAL 94 83 83 VAL VAL A . n A 1 95 ALA 95 84 84 ALA ALA A . n A 1 96 PRO 96 85 85 PRO PRO A . n A 1 97 ASP 97 86 86 ASP ASP A . n A 1 98 VAL 98 87 87 VAL VAL A . n A 1 99 ARG 99 88 88 ARG ARG A . n A 1 100 PRO 100 89 89 PRO PRO A . n A 1 101 TRP 101 90 90 TRP TRP A . n A 1 102 PRO 102 91 91 PRO PRO A . n A 1 103 ARG 103 92 92 ARG ARG A . n A 1 104 SER 104 93 93 SER SER A . n A 1 105 LEU 105 94 94 LEU LEU A . n A 1 106 ALA 106 95 95 ALA ALA A . n A 1 107 ASN 107 96 96 ASN ASN A . n A 1 108 ILE 108 97 97 ILE ILE A . n A 1 109 PHE 109 98 98 PHE PHE A . n A 1 110 ASP 110 99 99 ASP ASP A . n A 1 111 GLU 111 100 100 GLU GLU A . n A 1 112 TYR 112 101 101 TYR TYR A . n A 1 113 THR 113 102 102 THR THR A . n A 1 114 ALA 114 103 103 ALA ALA A . n A 1 115 ASP 115 104 104 ASP ASP A . n A 1 116 LEU 116 105 105 LEU LEU A . n A 1 117 GLY 117 106 106 GLY GLY A . n A 1 118 TYR 118 107 107 TYR TYR A . n A 1 119 PRO 119 108 108 PRO PRO A . n A 1 120 LEU 120 109 109 LEU LEU A . n A 1 121 PRO 121 110 110 PRO PRO A . n A 1 122 SER 122 111 111 SER SER A . n A 1 123 ASN 123 112 112 ASN ASN A . n A 1 124 GLY 124 113 113 GLY GLY A . n A 1 125 ASP 125 114 114 ASP ASP A . n A 1 126 LEU 126 115 115 LEU LEU A . n A 1 127 THR 127 116 116 THR THR A . n A 1 128 PRO 128 117 117 PRO PRO A . n A 1 129 TRP 129 118 118 TRP TRP A . n A 1 130 ALA 130 119 119 ALA ALA A . n A 1 131 GLN 131 120 120 GLN GLN A . n A 1 132 ARG 132 121 121 ARG ARG A . n A 1 133 GLY 133 122 122 GLY GLY A . n A 1 134 VAL 134 123 123 VAL VAL A . n A 1 135 LEU 135 124 124 LEU LEU A . n A 1 136 LEU 136 125 125 LEU LEU A . n A 1 137 LEU 137 126 126 LEU LEU A . n A 1 138 ASN 138 127 127 ASN ASN A . n A 1 139 ARG 139 128 128 ARG ARG A . n A 1 140 VAL 140 129 129 VAL VAL A . n A 1 141 LEU 141 130 130 LEU LEU A . n A 1 142 THR 142 131 131 THR THR A . n A 1 143 VAL 143 132 132 VAL VAL A . n A 1 144 ARG 144 133 133 ARG ARG A . n A 1 145 PRO 145 134 134 PRO PRO A . n A 1 146 SER 146 135 135 SER SER A . n A 1 147 ASN 147 136 136 ASN ASN A . n A 1 148 PRO 148 137 137 PRO PRO A . n A 1 149 ALA 149 138 138 ALA ALA A . n A 1 150 SER 150 139 139 SER SER A . n A 1 151 HIS 151 140 140 HIS HIS A . n A 1 152 ARG 152 141 141 ARG ARG A . n A 1 153 GLY 153 142 142 GLY GLY A . n A 1 154 LYS 154 143 143 LYS LYS A . n A 1 155 GLY 155 144 144 GLY GLY A . n A 1 156 TRP 156 145 145 TRP TRP A . n A 1 157 GLU 157 146 146 GLU GLU A . n A 1 158 ALA 158 147 147 ALA ALA A . n A 1 159 VAL 159 148 148 VAL VAL A . n A 1 160 THR 160 149 149 THR THR A . n A 1 161 GLU 161 150 150 GLU GLU A . n A 1 162 CYS 162 151 151 CYS CYS A . n A 1 163 ALA 163 152 152 ALA ALA A . n A 1 164 ILE 164 153 153 ILE ILE A . n A 1 165 ARG 165 154 154 ARG ARG A . n A 1 166 ALA 166 155 155 ALA ALA A . n A 1 167 LEU 167 156 156 LEU LEU A . n A 1 168 ALA 168 157 157 ALA ALA A . n A 1 169 ALA 169 158 158 ALA ALA A . n A 1 170 ARG 170 159 159 ARG ARG A . n A 1 171 ALA 171 160 160 ALA ALA A . n A 1 172 ALA 172 161 161 ALA ALA A . n A 1 173 PRO 173 162 162 PRO PRO A . n A 1 174 LEU 174 163 163 LEU LEU A . n A 1 175 VAL 175 164 164 VAL VAL A . n A 1 176 ALA 176 165 165 ALA ALA A . n A 1 177 ILE 177 166 166 ILE ILE A . n A 1 178 LEU 178 167 167 LEU LEU A . n A 1 179 TRP 179 168 168 TRP TRP A . n A 1 180 GLY 180 169 169 GLY GLY A . n A 1 181 ARG 181 170 170 ARG ARG A . n A 1 182 ASP 182 171 171 ASP ASP A . n A 1 183 ALA 183 172 172 ALA ALA A . n A 1 184 SER 184 173 173 SER SER A . n A 1 185 THR 185 174 174 THR THR A . n A 1 186 LEU 186 175 175 LEU LEU A . n A 1 187 LYS 187 176 176 LYS LYS A . n A 1 188 PRO 188 177 177 PRO PRO A . n A 1 189 MET 189 178 178 MET MET A . n A 1 190 LEU 190 179 179 LEU LEU A . n A 1 191 ALA 191 180 180 ALA ALA A . n A 1 192 ALA 192 181 181 ALA ALA A . n A 1 193 GLY 193 182 182 GLY GLY A . n A 1 194 ASN 194 183 183 ASN ASN A . n A 1 195 CYS 195 184 184 CYS CYS A . n A 1 196 VAL 196 185 185 VAL VAL A . n A 1 197 ALA 197 186 186 ALA ALA A . n A 1 198 ILE 198 187 187 ILE ILE A . n A 1 199 GLU 199 188 188 GLU GLU A . n A 1 200 SER 200 189 189 SER SER A . n A 1 201 PRO 201 190 190 PRO PRO A . n A 1 202 HIS 202 191 191 HIS HIS A . n A 1 203 PRO 203 192 192 PRO PRO A . n A 1 204 SER 204 193 193 SER SER A . n A 1 205 PRO 205 194 194 PRO PRO A . n A 1 206 LEU 206 195 195 LEU LEU A . n A 1 207 SER 207 196 196 SER SER A . n A 1 208 ALA 208 197 197 ALA ALA A . n A 1 209 SER 209 198 198 SER SER A . n A 1 210 ARG 210 199 199 ARG ARG A . n A 1 211 GLY 211 200 200 GLY GLY A . n A 1 212 PHE 212 201 201 PHE PHE A . n A 1 213 PHE 213 202 202 PHE PHE A . n A 1 214 GLY 214 203 203 GLY GLY A . n A 1 215 SER 215 204 204 SER SER A . n A 1 216 ARG 216 205 205 ARG ARG A . n A 1 217 PRO 217 206 206 PRO PRO A . n A 1 218 PHE 218 207 207 PHE PHE A . n A 1 219 SER 219 208 208 SER SER A . n A 1 220 ARG 220 209 209 ARG ARG A . n A 1 221 ALA 221 210 210 ALA ALA A . n A 1 222 ASN 222 211 211 ASN ASN A . n A 1 223 GLU 223 212 212 GLU GLU A . n A 1 224 LEU 224 213 213 LEU LEU A . n A 1 225 LEU 225 214 214 LEU LEU A . n A 1 226 VAL 226 215 215 VAL VAL A . n A 1 227 GLY 227 216 216 GLY GLY A . n A 1 228 MET 228 217 217 MET MET A . n A 1 229 GLY 229 218 218 GLY GLY A . n A 1 230 ALA 230 219 219 ALA ALA A . n A 1 231 GLU 231 220 220 GLU GLU A . n A 1 232 PRO 232 221 221 PRO PRO A . n A 1 233 ILE 233 222 222 ILE ILE A . n A 1 234 ASP 234 223 223 ASP ASP A . n A 1 235 TRP 235 224 224 TRP TRP A . n A 1 236 ARG 236 225 225 ARG ARG A . n A 1 237 LEU 237 226 226 LEU LEU A . n A 1 238 PRO 238 227 227 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 5CU 1 301 301 5CU 5CU A . C 3 CIT 1 302 401 CIT CIT A . D 4 HOH 1 401 21 HOH HOH A . D 4 HOH 2 402 15 HOH HOH A . D 4 HOH 3 403 22 HOH HOH A . D 4 HOH 4 404 34 HOH HOH A . D 4 HOH 5 405 13 HOH HOH A . D 4 HOH 6 406 3 HOH HOH A . D 4 HOH 7 407 1 HOH HOH A . D 4 HOH 8 408 2 HOH HOH A . D 4 HOH 9 409 35 HOH HOH A . D 4 HOH 10 410 20 HOH HOH A . D 4 HOH 11 411 14 HOH HOH A . D 4 HOH 12 412 26 HOH HOH A . D 4 HOH 13 413 4 HOH HOH A . D 4 HOH 14 414 10 HOH HOH A . D 4 HOH 15 415 8 HOH HOH A . D 4 HOH 16 416 16 HOH HOH A . D 4 HOH 17 417 7 HOH HOH A . D 4 HOH 18 418 33 HOH HOH A . D 4 HOH 19 419 23 HOH HOH A . D 4 HOH 20 420 30 HOH HOH A . D 4 HOH 21 421 17 HOH HOH A . D 4 HOH 22 422 36 HOH HOH A . D 4 HOH 23 423 27 HOH HOH A . D 4 HOH 24 424 9 HOH HOH A . D 4 HOH 25 425 6 HOH HOH A . D 4 HOH 26 426 18 HOH HOH A . D 4 HOH 27 427 5 HOH HOH A . D 4 HOH 28 428 28 HOH HOH A . D 4 HOH 29 429 32 HOH HOH A . D 4 HOH 30 430 24 HOH HOH A . D 4 HOH 31 431 31 HOH HOH A . D 4 HOH 32 432 25 HOH HOH A . D 4 HOH 33 433 12 HOH HOH A . D 4 HOH 34 434 19 HOH HOH A . D 4 HOH 35 435 29 HOH HOH A . D 4 HOH 36 436 11 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 2 ? OG1 ? A THR 13 OG1 2 1 Y 1 A THR 2 ? CG2 ? A THR 13 CG2 3 1 Y 1 A ARG 199 ? CG ? A ARG 210 CG 4 1 Y 1 A ARG 199 ? CD ? A ARG 210 CD 5 1 Y 1 A ARG 199 ? NE ? A ARG 210 NE 6 1 Y 1 A ARG 199 ? CZ ? A ARG 210 CZ 7 1 Y 1 A ARG 199 ? NH1 ? A ARG 210 NH1 8 1 Y 1 A ARG 199 ? NH2 ? A ARG 210 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 112.29 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8I66 _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.120 _cell.length_a_esd ? _cell.length_b 63.970 _cell.length_b_esd ? _cell.length_c 45.390 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8I66 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8I66 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.04 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method MICROBATCH _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Bis-Tris pH 5.5, 0.5 M Sodium citrate, 25% PEG (w/v) 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54179 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU ULTRAX 18' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54179 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8I66 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.60 _reflns.d_resolution_low 42.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6291 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.976 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.176 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.74 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 893 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.647 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.653 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.22 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 1.22 _refine.aniso_B[2][2] -0.58 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -0.48 _refine.B_iso_max ? _refine.B_iso_mean 33.867 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.946 _refine.correlation_coeff_Fo_to_Fc_free 0.903 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8I66 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.60 _refine.ls_d_res_low 36.22 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5956 _refine.ls_number_reflns_R_free 324 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.26 _refine.ls_percent_reflns_R_free 5.2 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.18138 _refine.ls_R_factor_R_free 0.23415 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.17820 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4WS4 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.343 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 14.677 _refine.overall_SU_ML 0.304 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 36.22 _refine_hist.number_atoms_solvent 36 _refine_hist.number_atoms_total 1788 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1728 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.013 1802 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1666 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.496 1.642 2468 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.174 1.565 3839 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.048 5.000 227 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.535 19.239 92 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.382 15.000 251 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 23.643 15.000 19 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.055 0.200 224 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 2062 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 407 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.340 3.600 911 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.340 3.600 910 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.824 5.391 1137 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.822 5.391 1138 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.312 3.693 891 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.280 3.685 888 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.679 5.462 1332 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.924 41.687 2023 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 5.923 41.709 2024 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.600 _refine_ls_shell.d_res_low 2.668 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 25 _refine_ls_shell.number_reflns_R_work 428 _refine_ls_shell.percent_reflns_obs 94.18 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.263 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.411 # _struct.entry_id 8I66 _struct.title ;Crystal structure of Mycobacterium tuberculosis Uracil-DNA glycosylase in complex with isoorotic acid (2,4-Dihydroxypyrimidine-5-carboxylic Acid) and citric acid, Form I ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8I66 _struct_keywords.text 'DNA repair, Base excision repair, Inhibitor-complex, HYDROLASE, HYDROLASE-INHIBITOR complex' _struct_keywords.pdbx_keywords HYDROLASE/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UNG_MYCTU _struct_ref.pdbx_db_accession P9WFQ9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLS FSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARA APLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8I66 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 12 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 238 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P9WFQ9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 227 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 227 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8I66 MET A 1 ? UNP P9WFQ9 ? ? 'expression tag' -10 1 1 8I66 HIS A 2 ? UNP P9WFQ9 ? ? 'expression tag' -9 2 1 8I66 HIS A 3 ? UNP P9WFQ9 ? ? 'expression tag' -8 3 1 8I66 HIS A 4 ? UNP P9WFQ9 ? ? 'expression tag' -7 4 1 8I66 HIS A 5 ? UNP P9WFQ9 ? ? 'expression tag' -6 5 1 8I66 HIS A 6 ? UNP P9WFQ9 ? ? 'expression tag' -5 6 1 8I66 HIS A 7 ? UNP P9WFQ9 ? ? 'expression tag' -4 7 1 8I66 GLY A 8 ? UNP P9WFQ9 ? ? 'expression tag' -3 8 1 8I66 MET A 9 ? UNP P9WFQ9 ? ? 'expression tag' -2 9 1 8I66 ALA A 10 ? UNP P9WFQ9 ? ? 'expression tag' -1 10 1 8I66 SER A 11 ? UNP P9WFQ9 ? ? 'expression tag' 0 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 16 ? VAL A 21 ? PRO A 5 VAL A 10 1 ? 6 HELX_P HELX_P2 AA2 GLU A 22 ? LEU A 29 ? GLU A 11 LEU A 18 1 ? 8 HELX_P HELX_P3 AA3 VAL A 32 ? GLY A 50 ? VAL A 21 GLY A 39 1 ? 19 HELX_P HELX_P4 AA4 ALA A 56 ? VAL A 60 ? ALA A 45 VAL A 49 5 ? 5 HELX_P HELX_P5 AA5 LEU A 61 ? PHE A 66 ? LEU A 50 PHE A 55 5 ? 6 HELX_P HELX_P6 AA6 PRO A 67 ? VAL A 71 ? PRO A 56 VAL A 60 5 ? 5 HELX_P HELX_P7 AA7 PRO A 102 ? GLY A 117 ? PRO A 91 GLY A 106 1 ? 16 HELX_P HELX_P8 AA8 LEU A 126 ? GLN A 131 ? LEU A 115 GLN A 120 1 ? 6 HELX_P HELX_P9 AA9 GLY A 155 ? ARG A 170 ? GLY A 144 ARG A 159 1 ? 16 HELX_P HELX_P10 AB1 GLY A 180 ? THR A 185 ? GLY A 169 THR A 174 1 ? 6 HELX_P HELX_P11 AB2 LEU A 186 ? ALA A 191 ? LEU A 175 ALA A 180 5 ? 6 HELX_P HELX_P12 AB3 SER A 204 ? SER A 209 ? SER A 193 SER A 198 1 ? 6 HELX_P HELX_P13 AB4 ARG A 216 ? MET A 228 ? ARG A 205 MET A 217 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 54 A . ? LEU 43 A PRO 55 A ? PRO 44 A 1 -6.56 2 ARG 99 A . ? ARG 88 A PRO 100 A ? PRO 89 A 1 -7.81 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 134 ? ASN A 138 ? VAL A 123 ASN A 127 AA1 2 VAL A 73 ? GLY A 77 ? VAL A 62 GLY A 66 AA1 3 LEU A 174 ? TRP A 179 ? LEU A 163 TRP A 168 AA1 4 CYS A 195 ? SER A 200 ? CYS A 184 SER A 189 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 135 ? O LEU A 124 N ILE A 75 ? N ILE A 64 AA1 2 3 N LEU A 74 ? N LEU A 63 O ILE A 177 ? O ILE A 166 AA1 3 4 N ALA A 176 ? N ALA A 165 O ILE A 198 ? O ILE A 187 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 75 ? ? -107.62 -69.99 2 1 PHE A 81 ? ? 83.65 -20.72 3 1 TYR A 107 ? ? -43.90 155.72 4 1 PRO A 110 ? ? -49.65 152.00 5 1 ALA A 138 ? ? 81.85 9.34 6 1 CYS A 184 ? ? -152.70 82.90 7 1 PRO A 190 ? ? -49.18 161.85 # _pdbx_entry_details.entry_id 8I66 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -10 ? A MET 1 2 1 Y 1 A HIS -9 ? A HIS 2 3 1 Y 1 A HIS -8 ? A HIS 3 4 1 Y 1 A HIS -7 ? A HIS 4 5 1 Y 1 A HIS -6 ? A HIS 5 6 1 Y 1 A HIS -5 ? A HIS 6 7 1 Y 1 A HIS -4 ? A HIS 7 8 1 Y 1 A GLY -3 ? A GLY 8 9 1 Y 1 A MET -2 ? A MET 9 10 1 Y 1 A ALA -1 ? A ALA 10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 5CU O53 O N N 1 5CU C51 C N N 2 5CU O52 O N N 3 5CU C5 C N N 4 5CU C4 C N N 5 5CU O4 O N N 6 5CU N3 N N N 7 5CU C2 C N N 8 5CU O2 O N N 9 5CU N1 N N N 10 5CU C6 C N N 11 5CU H1 H N N 12 5CU H3 H N N 13 5CU H4 H N N 14 5CU H2 H N N 15 ALA N N N N 16 ALA CA C N S 17 ALA C C N N 18 ALA O O N N 19 ALA CB C N N 20 ALA OXT O N N 21 ALA H H N N 22 ALA H2 H N N 23 ALA HA H N N 24 ALA HB1 H N N 25 ALA HB2 H N N 26 ALA HB3 H N N 27 ALA HXT H N N 28 ARG N N N N 29 ARG CA C N S 30 ARG C C N N 31 ARG O O N N 32 ARG CB C N N 33 ARG CG C N N 34 ARG CD C N N 35 ARG NE N N N 36 ARG CZ C N N 37 ARG NH1 N N N 38 ARG NH2 N N N 39 ARG OXT O N N 40 ARG H H N N 41 ARG H2 H N N 42 ARG HA H N N 43 ARG HB2 H N N 44 ARG HB3 H N N 45 ARG HG2 H N N 46 ARG HG3 H N N 47 ARG HD2 H N N 48 ARG HD3 H N N 49 ARG HE H N N 50 ARG HH11 H N N 51 ARG HH12 H N N 52 ARG HH21 H N N 53 ARG HH22 H N N 54 ARG HXT H N N 55 ASN N N N N 56 ASN CA C N S 57 ASN C C N N 58 ASN O O N N 59 ASN CB C N N 60 ASN CG C N N 61 ASN OD1 O N N 62 ASN ND2 N N N 63 ASN OXT O N N 64 ASN H H N N 65 ASN H2 H N N 66 ASN HA H N N 67 ASN HB2 H N N 68 ASN HB3 H N N 69 ASN HD21 H N N 70 ASN HD22 H N N 71 ASN HXT H N N 72 ASP N N N N 73 ASP CA C N S 74 ASP C C N N 75 ASP O O N N 76 ASP CB C N N 77 ASP CG C N N 78 ASP OD1 O N N 79 ASP OD2 O N N 80 ASP OXT O N N 81 ASP H H N N 82 ASP H2 H N N 83 ASP HA H N N 84 ASP HB2 H N N 85 ASP HB3 H N N 86 ASP HD2 H N N 87 ASP HXT H N N 88 CIT C1 C N N 89 CIT O1 O N N 90 CIT O2 O N N 91 CIT C2 C N N 92 CIT C3 C N N 93 CIT O7 O N N 94 CIT C4 C N N 95 CIT C5 C N N 96 CIT O3 O N N 97 CIT O4 O N N 98 CIT C6 C N N 99 CIT O5 O N N 100 CIT O6 O N N 101 CIT HO2 H N N 102 CIT H21 H N N 103 CIT H22 H N N 104 CIT HO7 H N N 105 CIT H41 H N N 106 CIT H42 H N N 107 CIT HO4 H N N 108 CIT HO6 H N N 109 CYS N N N N 110 CYS CA C N R 111 CYS C C N N 112 CYS O O N N 113 CYS CB C N N 114 CYS SG S N N 115 CYS OXT O N N 116 CYS H H N N 117 CYS H2 H N N 118 CYS HA H N N 119 CYS HB2 H N N 120 CYS HB3 H N N 121 CYS HG H N N 122 CYS HXT H N N 123 GLN N N N N 124 GLN CA C N S 125 GLN C C N N 126 GLN O O N N 127 GLN CB C N N 128 GLN CG C N N 129 GLN CD C N N 130 GLN OE1 O N N 131 GLN NE2 N N N 132 GLN OXT O N N 133 GLN H H N N 134 GLN H2 H N N 135 GLN HA H N N 136 GLN HB2 H N N 137 GLN HB3 H N N 138 GLN HG2 H N N 139 GLN HG3 H N N 140 GLN HE21 H N N 141 GLN HE22 H N N 142 GLN HXT H N N 143 GLU N N N N 144 GLU CA C N S 145 GLU C C N N 146 GLU O O N N 147 GLU CB C N N 148 GLU CG C N N 149 GLU CD C N N 150 GLU OE1 O N N 151 GLU OE2 O N N 152 GLU OXT O N N 153 GLU H H N N 154 GLU H2 H N N 155 GLU HA H N N 156 GLU HB2 H N N 157 GLU HB3 H N N 158 GLU HG2 H N N 159 GLU HG3 H N N 160 GLU HE2 H N N 161 GLU HXT H N N 162 GLY N N N N 163 GLY CA C N N 164 GLY C C N N 165 GLY O O N N 166 GLY OXT O N N 167 GLY H H N N 168 GLY H2 H N N 169 GLY HA2 H N N 170 GLY HA3 H N N 171 GLY HXT H N N 172 HIS N N N N 173 HIS CA C N S 174 HIS C C N N 175 HIS O O N N 176 HIS CB C N N 177 HIS CG C Y N 178 HIS ND1 N Y N 179 HIS CD2 C Y N 180 HIS CE1 C Y N 181 HIS NE2 N Y N 182 HIS OXT O N N 183 HIS H H N N 184 HIS H2 H N N 185 HIS HA H N N 186 HIS HB2 H N N 187 HIS HB3 H N N 188 HIS HD1 H N N 189 HIS HD2 H N N 190 HIS HE1 H N N 191 HIS HE2 H N N 192 HIS HXT H N N 193 HOH O O N N 194 HOH H1 H N N 195 HOH H2 H N N 196 ILE N N N N 197 ILE CA C N S 198 ILE C C N N 199 ILE O O N N 200 ILE CB C N S 201 ILE CG1 C N N 202 ILE CG2 C N N 203 ILE CD1 C N N 204 ILE OXT O N N 205 ILE H H N N 206 ILE H2 H N N 207 ILE HA H N N 208 ILE HB H N N 209 ILE HG12 H N N 210 ILE HG13 H N N 211 ILE HG21 H N N 212 ILE HG22 H N N 213 ILE HG23 H N N 214 ILE HD11 H N N 215 ILE HD12 H N N 216 ILE HD13 H N N 217 ILE HXT H N N 218 LEU N N N N 219 LEU CA C N S 220 LEU C C N N 221 LEU O O N N 222 LEU CB C N N 223 LEU CG C N N 224 LEU CD1 C N N 225 LEU CD2 C N N 226 LEU OXT O N N 227 LEU H H N N 228 LEU H2 H N N 229 LEU HA H N N 230 LEU HB2 H N N 231 LEU HB3 H N N 232 LEU HG H N N 233 LEU HD11 H N N 234 LEU HD12 H N N 235 LEU HD13 H N N 236 LEU HD21 H N N 237 LEU HD22 H N N 238 LEU HD23 H N N 239 LEU HXT H N N 240 LYS N N N N 241 LYS CA C N S 242 LYS C C N N 243 LYS O O N N 244 LYS CB C N N 245 LYS CG C N N 246 LYS CD C N N 247 LYS CE C N N 248 LYS NZ N N N 249 LYS OXT O N N 250 LYS H H N N 251 LYS H2 H N N 252 LYS HA H N N 253 LYS HB2 H N N 254 LYS HB3 H N N 255 LYS HG2 H N N 256 LYS HG3 H N N 257 LYS HD2 H N N 258 LYS HD3 H N N 259 LYS HE2 H N N 260 LYS HE3 H N N 261 LYS HZ1 H N N 262 LYS HZ2 H N N 263 LYS HZ3 H N N 264 LYS HXT H N N 265 MET N N N N 266 MET CA C N S 267 MET C C N N 268 MET O O N N 269 MET CB C N N 270 MET CG C N N 271 MET SD S N N 272 MET CE C N N 273 MET OXT O N N 274 MET H H N N 275 MET H2 H N N 276 MET HA H N N 277 MET HB2 H N N 278 MET HB3 H N N 279 MET HG2 H N N 280 MET HG3 H N N 281 MET HE1 H N N 282 MET HE2 H N N 283 MET HE3 H N N 284 MET HXT H N N 285 PHE N N N N 286 PHE CA C N S 287 PHE C C N N 288 PHE O O N N 289 PHE CB C N N 290 PHE CG C Y N 291 PHE CD1 C Y N 292 PHE CD2 C Y N 293 PHE CE1 C Y N 294 PHE CE2 C Y N 295 PHE CZ C Y N 296 PHE OXT O N N 297 PHE H H N N 298 PHE H2 H N N 299 PHE HA H N N 300 PHE HB2 H N N 301 PHE HB3 H N N 302 PHE HD1 H N N 303 PHE HD2 H N N 304 PHE HE1 H N N 305 PHE HE2 H N N 306 PHE HZ H N N 307 PHE HXT H N N 308 PRO N N N N 309 PRO CA C N S 310 PRO C C N N 311 PRO O O N N 312 PRO CB C N N 313 PRO CG C N N 314 PRO CD C N N 315 PRO OXT O N N 316 PRO H H N N 317 PRO HA H N N 318 PRO HB2 H N N 319 PRO HB3 H N N 320 PRO HG2 H N N 321 PRO HG3 H N N 322 PRO HD2 H N N 323 PRO HD3 H N N 324 PRO HXT H N N 325 SER N N N N 326 SER CA C N S 327 SER C C N N 328 SER O O N N 329 SER CB C N N 330 SER OG O N N 331 SER OXT O N N 332 SER H H N N 333 SER H2 H N N 334 SER HA H N N 335 SER HB2 H N N 336 SER HB3 H N N 337 SER HG H N N 338 SER HXT H N N 339 THR N N N N 340 THR CA C N S 341 THR C C N N 342 THR O O N N 343 THR CB C N R 344 THR OG1 O N N 345 THR CG2 C N N 346 THR OXT O N N 347 THR H H N N 348 THR H2 H N N 349 THR HA H N N 350 THR HB H N N 351 THR HG1 H N N 352 THR HG21 H N N 353 THR HG22 H N N 354 THR HG23 H N N 355 THR HXT H N N 356 TRP N N N N 357 TRP CA C N S 358 TRP C C N N 359 TRP O O N N 360 TRP CB C N N 361 TRP CG C Y N 362 TRP CD1 C Y N 363 TRP CD2 C Y N 364 TRP NE1 N Y N 365 TRP CE2 C Y N 366 TRP CE3 C Y N 367 TRP CZ2 C Y N 368 TRP CZ3 C Y N 369 TRP CH2 C Y N 370 TRP OXT O N N 371 TRP H H N N 372 TRP H2 H N N 373 TRP HA H N N 374 TRP HB2 H N N 375 TRP HB3 H N N 376 TRP HD1 H N N 377 TRP HE1 H N N 378 TRP HE3 H N N 379 TRP HZ2 H N N 380 TRP HZ3 H N N 381 TRP HH2 H N N 382 TRP HXT H N N 383 TYR N N N N 384 TYR CA C N S 385 TYR C C N N 386 TYR O O N N 387 TYR CB C N N 388 TYR CG C Y N 389 TYR CD1 C Y N 390 TYR CD2 C Y N 391 TYR CE1 C Y N 392 TYR CE2 C Y N 393 TYR CZ C Y N 394 TYR OH O N N 395 TYR OXT O N N 396 TYR H H N N 397 TYR H2 H N N 398 TYR HA H N N 399 TYR HB2 H N N 400 TYR HB3 H N N 401 TYR HD1 H N N 402 TYR HD2 H N N 403 TYR HE1 H N N 404 TYR HE2 H N N 405 TYR HH H N N 406 TYR HXT H N N 407 VAL N N N N 408 VAL CA C N S 409 VAL C C N N 410 VAL O O N N 411 VAL CB C N N 412 VAL CG1 C N N 413 VAL CG2 C N N 414 VAL OXT O N N 415 VAL H H N N 416 VAL H2 H N N 417 VAL HA H N N 418 VAL HB H N N 419 VAL HG11 H N N 420 VAL HG12 H N N 421 VAL HG13 H N N 422 VAL HG21 H N N 423 VAL HG22 H N N 424 VAL HG23 H N N 425 VAL HXT H N N 426 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 5CU N1 C6 sing N N 1 5CU N1 C2 sing N N 2 5CU O2 C2 doub N N 3 5CU C6 C5 doub N N 4 5CU C2 N3 sing N N 5 5CU O53 C51 doub N N 6 5CU C5 C51 sing N N 7 5CU C5 C4 sing N N 8 5CU N3 C4 sing N N 9 5CU C51 O52 sing N N 10 5CU C4 O4 doub N N 11 5CU O52 H1 sing N N 12 5CU N3 H3 sing N N 13 5CU C6 H4 sing N N 14 5CU N1 H2 sing N N 15 ALA N CA sing N N 16 ALA N H sing N N 17 ALA N H2 sing N N 18 ALA CA C sing N N 19 ALA CA CB sing N N 20 ALA CA HA sing N N 21 ALA C O doub N N 22 ALA C OXT sing N N 23 ALA CB HB1 sing N N 24 ALA CB HB2 sing N N 25 ALA CB HB3 sing N N 26 ALA OXT HXT sing N N 27 ARG N CA sing N N 28 ARG N H sing N N 29 ARG N H2 sing N N 30 ARG CA C sing N N 31 ARG CA CB sing N N 32 ARG CA HA sing N N 33 ARG C O doub N N 34 ARG C OXT sing N N 35 ARG CB CG sing N N 36 ARG CB HB2 sing N N 37 ARG CB HB3 sing N N 38 ARG CG CD sing N N 39 ARG CG HG2 sing N N 40 ARG CG HG3 sing N N 41 ARG CD NE sing N N 42 ARG CD HD2 sing N N 43 ARG CD HD3 sing N N 44 ARG NE CZ sing N N 45 ARG NE HE sing N N 46 ARG CZ NH1 sing N N 47 ARG CZ NH2 doub N N 48 ARG NH1 HH11 sing N N 49 ARG NH1 HH12 sing N N 50 ARG NH2 HH21 sing N N 51 ARG NH2 HH22 sing N N 52 ARG OXT HXT sing N N 53 ASN N CA sing N N 54 ASN N H sing N N 55 ASN N H2 sing N N 56 ASN CA C sing N N 57 ASN CA CB sing N N 58 ASN CA HA sing N N 59 ASN C O doub N N 60 ASN C OXT sing N N 61 ASN CB CG sing N N 62 ASN CB HB2 sing N N 63 ASN CB HB3 sing N N 64 ASN CG OD1 doub N N 65 ASN CG ND2 sing N N 66 ASN ND2 HD21 sing N N 67 ASN ND2 HD22 sing N N 68 ASN OXT HXT sing N N 69 ASP N CA sing N N 70 ASP N H sing N N 71 ASP N H2 sing N N 72 ASP CA C sing N N 73 ASP CA CB sing N N 74 ASP CA HA sing N N 75 ASP C O doub N N 76 ASP C OXT sing N N 77 ASP CB CG sing N N 78 ASP CB HB2 sing N N 79 ASP CB HB3 sing N N 80 ASP CG OD1 doub N N 81 ASP CG OD2 sing N N 82 ASP OD2 HD2 sing N N 83 ASP OXT HXT sing N N 84 CIT C1 O1 doub N N 85 CIT C1 O2 sing N N 86 CIT C1 C2 sing N N 87 CIT O2 HO2 sing N N 88 CIT C2 C3 sing N N 89 CIT C2 H21 sing N N 90 CIT C2 H22 sing N N 91 CIT C3 O7 sing N N 92 CIT C3 C4 sing N N 93 CIT C3 C6 sing N N 94 CIT O7 HO7 sing N N 95 CIT C4 C5 sing N N 96 CIT C4 H41 sing N N 97 CIT C4 H42 sing N N 98 CIT C5 O3 doub N N 99 CIT C5 O4 sing N N 100 CIT O4 HO4 sing N N 101 CIT C6 O5 doub N N 102 CIT C6 O6 sing N N 103 CIT O6 HO6 sing N N 104 CYS N CA sing N N 105 CYS N H sing N N 106 CYS N H2 sing N N 107 CYS CA C sing N N 108 CYS CA CB sing N N 109 CYS CA HA sing N N 110 CYS C O doub N N 111 CYS C OXT sing N N 112 CYS CB SG sing N N 113 CYS CB HB2 sing N N 114 CYS CB HB3 sing N N 115 CYS SG HG sing N N 116 CYS OXT HXT sing N N 117 GLN N CA sing N N 118 GLN N H sing N N 119 GLN N H2 sing N N 120 GLN CA C sing N N 121 GLN CA CB sing N N 122 GLN CA HA sing N N 123 GLN C O doub N N 124 GLN C OXT sing N N 125 GLN CB CG sing N N 126 GLN CB HB2 sing N N 127 GLN CB HB3 sing N N 128 GLN CG CD sing N N 129 GLN CG HG2 sing N N 130 GLN CG HG3 sing N N 131 GLN CD OE1 doub N N 132 GLN CD NE2 sing N N 133 GLN NE2 HE21 sing N N 134 GLN NE2 HE22 sing N N 135 GLN OXT HXT sing N N 136 GLU N CA sing N N 137 GLU N H sing N N 138 GLU N H2 sing N N 139 GLU CA C sing N N 140 GLU CA CB sing N N 141 GLU CA HA sing N N 142 GLU C O doub N N 143 GLU C OXT sing N N 144 GLU CB CG sing N N 145 GLU CB HB2 sing N N 146 GLU CB HB3 sing N N 147 GLU CG CD sing N N 148 GLU CG HG2 sing N N 149 GLU CG HG3 sing N N 150 GLU CD OE1 doub N N 151 GLU CD OE2 sing N N 152 GLU OE2 HE2 sing N N 153 GLU OXT HXT sing N N 154 GLY N CA sing N N 155 GLY N H sing N N 156 GLY N H2 sing N N 157 GLY CA C sing N N 158 GLY CA HA2 sing N N 159 GLY CA HA3 sing N N 160 GLY C O doub N N 161 GLY C OXT sing N N 162 GLY OXT HXT sing N N 163 HIS N CA sing N N 164 HIS N H sing N N 165 HIS N H2 sing N N 166 HIS CA C sing N N 167 HIS CA CB sing N N 168 HIS CA HA sing N N 169 HIS C O doub N N 170 HIS C OXT sing N N 171 HIS CB CG sing N N 172 HIS CB HB2 sing N N 173 HIS CB HB3 sing N N 174 HIS CG ND1 sing Y N 175 HIS CG CD2 doub Y N 176 HIS ND1 CE1 doub Y N 177 HIS ND1 HD1 sing N N 178 HIS CD2 NE2 sing Y N 179 HIS CD2 HD2 sing N N 180 HIS CE1 NE2 sing Y N 181 HIS CE1 HE1 sing N N 182 HIS NE2 HE2 sing N N 183 HIS OXT HXT sing N N 184 HOH O H1 sing N N 185 HOH O H2 sing N N 186 ILE N CA sing N N 187 ILE N H sing N N 188 ILE N H2 sing N N 189 ILE CA C sing N N 190 ILE CA CB sing N N 191 ILE CA HA sing N N 192 ILE C O doub N N 193 ILE C OXT sing N N 194 ILE CB CG1 sing N N 195 ILE CB CG2 sing N N 196 ILE CB HB sing N N 197 ILE CG1 CD1 sing N N 198 ILE CG1 HG12 sing N N 199 ILE CG1 HG13 sing N N 200 ILE CG2 HG21 sing N N 201 ILE CG2 HG22 sing N N 202 ILE CG2 HG23 sing N N 203 ILE CD1 HD11 sing N N 204 ILE CD1 HD12 sing N N 205 ILE CD1 HD13 sing N N 206 ILE OXT HXT sing N N 207 LEU N CA sing N N 208 LEU N H sing N N 209 LEU N H2 sing N N 210 LEU CA C sing N N 211 LEU CA CB sing N N 212 LEU CA HA sing N N 213 LEU C O doub N N 214 LEU C OXT sing N N 215 LEU CB CG sing N N 216 LEU CB HB2 sing N N 217 LEU CB HB3 sing N N 218 LEU CG CD1 sing N N 219 LEU CG CD2 sing N N 220 LEU CG HG sing N N 221 LEU CD1 HD11 sing N N 222 LEU CD1 HD12 sing N N 223 LEU CD1 HD13 sing N N 224 LEU CD2 HD21 sing N N 225 LEU CD2 HD22 sing N N 226 LEU CD2 HD23 sing N N 227 LEU OXT HXT sing N N 228 LYS N CA sing N N 229 LYS N H sing N N 230 LYS N H2 sing N N 231 LYS CA C sing N N 232 LYS CA CB sing N N 233 LYS CA HA sing N N 234 LYS C O doub N N 235 LYS C OXT sing N N 236 LYS CB CG sing N N 237 LYS CB HB2 sing N N 238 LYS CB HB3 sing N N 239 LYS CG CD sing N N 240 LYS CG HG2 sing N N 241 LYS CG HG3 sing N N 242 LYS CD CE sing N N 243 LYS CD HD2 sing N N 244 LYS CD HD3 sing N N 245 LYS CE NZ sing N N 246 LYS CE HE2 sing N N 247 LYS CE HE3 sing N N 248 LYS NZ HZ1 sing N N 249 LYS NZ HZ2 sing N N 250 LYS NZ HZ3 sing N N 251 LYS OXT HXT sing N N 252 MET N CA sing N N 253 MET N H sing N N 254 MET N H2 sing N N 255 MET CA C sing N N 256 MET CA CB sing N N 257 MET CA HA sing N N 258 MET C O doub N N 259 MET C OXT sing N N 260 MET CB CG sing N N 261 MET CB HB2 sing N N 262 MET CB HB3 sing N N 263 MET CG SD sing N N 264 MET CG HG2 sing N N 265 MET CG HG3 sing N N 266 MET SD CE sing N N 267 MET CE HE1 sing N N 268 MET CE HE2 sing N N 269 MET CE HE3 sing N N 270 MET OXT HXT sing N N 271 PHE N CA sing N N 272 PHE N H sing N N 273 PHE N H2 sing N N 274 PHE CA C sing N N 275 PHE CA CB sing N N 276 PHE CA HA sing N N 277 PHE C O doub N N 278 PHE C OXT sing N N 279 PHE CB CG sing N N 280 PHE CB HB2 sing N N 281 PHE CB HB3 sing N N 282 PHE CG CD1 doub Y N 283 PHE CG CD2 sing Y N 284 PHE CD1 CE1 sing Y N 285 PHE CD1 HD1 sing N N 286 PHE CD2 CE2 doub Y N 287 PHE CD2 HD2 sing N N 288 PHE CE1 CZ doub Y N 289 PHE CE1 HE1 sing N N 290 PHE CE2 CZ sing Y N 291 PHE CE2 HE2 sing N N 292 PHE CZ HZ sing N N 293 PHE OXT HXT sing N N 294 PRO N CA sing N N 295 PRO N CD sing N N 296 PRO N H sing N N 297 PRO CA C sing N N 298 PRO CA CB sing N N 299 PRO CA HA sing N N 300 PRO C O doub N N 301 PRO C OXT sing N N 302 PRO CB CG sing N N 303 PRO CB HB2 sing N N 304 PRO CB HB3 sing N N 305 PRO CG CD sing N N 306 PRO CG HG2 sing N N 307 PRO CG HG3 sing N N 308 PRO CD HD2 sing N N 309 PRO CD HD3 sing N N 310 PRO OXT HXT sing N N 311 SER N CA sing N N 312 SER N H sing N N 313 SER N H2 sing N N 314 SER CA C sing N N 315 SER CA CB sing N N 316 SER CA HA sing N N 317 SER C O doub N N 318 SER C OXT sing N N 319 SER CB OG sing N N 320 SER CB HB2 sing N N 321 SER CB HB3 sing N N 322 SER OG HG sing N N 323 SER OXT HXT sing N N 324 THR N CA sing N N 325 THR N H sing N N 326 THR N H2 sing N N 327 THR CA C sing N N 328 THR CA CB sing N N 329 THR CA HA sing N N 330 THR C O doub N N 331 THR C OXT sing N N 332 THR CB OG1 sing N N 333 THR CB CG2 sing N N 334 THR CB HB sing N N 335 THR OG1 HG1 sing N N 336 THR CG2 HG21 sing N N 337 THR CG2 HG22 sing N N 338 THR CG2 HG23 sing N N 339 THR OXT HXT sing N N 340 TRP N CA sing N N 341 TRP N H sing N N 342 TRP N H2 sing N N 343 TRP CA C sing N N 344 TRP CA CB sing N N 345 TRP CA HA sing N N 346 TRP C O doub N N 347 TRP C OXT sing N N 348 TRP CB CG sing N N 349 TRP CB HB2 sing N N 350 TRP CB HB3 sing N N 351 TRP CG CD1 doub Y N 352 TRP CG CD2 sing Y N 353 TRP CD1 NE1 sing Y N 354 TRP CD1 HD1 sing N N 355 TRP CD2 CE2 doub Y N 356 TRP CD2 CE3 sing Y N 357 TRP NE1 CE2 sing Y N 358 TRP NE1 HE1 sing N N 359 TRP CE2 CZ2 sing Y N 360 TRP CE3 CZ3 doub Y N 361 TRP CE3 HE3 sing N N 362 TRP CZ2 CH2 doub Y N 363 TRP CZ2 HZ2 sing N N 364 TRP CZ3 CH2 sing Y N 365 TRP CZ3 HZ3 sing N N 366 TRP CH2 HH2 sing N N 367 TRP OXT HXT sing N N 368 TYR N CA sing N N 369 TYR N H sing N N 370 TYR N H2 sing N N 371 TYR CA C sing N N 372 TYR CA CB sing N N 373 TYR CA HA sing N N 374 TYR C O doub N N 375 TYR C OXT sing N N 376 TYR CB CG sing N N 377 TYR CB HB2 sing N N 378 TYR CB HB3 sing N N 379 TYR CG CD1 doub Y N 380 TYR CG CD2 sing Y N 381 TYR CD1 CE1 sing Y N 382 TYR CD1 HD1 sing N N 383 TYR CD2 CE2 doub Y N 384 TYR CD2 HD2 sing N N 385 TYR CE1 CZ doub Y N 386 TYR CE1 HE1 sing N N 387 TYR CE2 CZ sing Y N 388 TYR CE2 HE2 sing N N 389 TYR CZ OH sing N N 390 TYR OH HH sing N N 391 TYR OXT HXT sing N N 392 VAL N CA sing N N 393 VAL N H sing N N 394 VAL N H2 sing N N 395 VAL CA C sing N N 396 VAL CA CB sing N N 397 VAL CA HA sing N N 398 VAL C O doub N N 399 VAL C OXT sing N N 400 VAL CB CG1 sing N N 401 VAL CB CG2 sing N N 402 VAL CB HB sing N N 403 VAL CG1 HG11 sing N N 404 VAL CG1 HG12 sing N N 405 VAL CG1 HG13 sing N N 406 VAL CG2 HG21 sing N N 407 VAL CG2 HG22 sing N N 408 VAL CG2 HG23 sing N N 409 VAL OXT HXT sing N N 410 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country India _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 5CU _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 5CU _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4WS4 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8I66 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.025562 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.010479 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015632 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023811 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_