data_8IIR # _entry.id 8IIR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8IIR pdb_00008iir 10.2210/pdb8iir/pdb WWPDB D_1300035724 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-06-21 2 'Structure model' 1 1 2023-08-02 3 'Structure model' 1 2 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8IIR _pdbx_database_status.recvd_initial_deposition_date 2023-02-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 varshney@iisc.ac.in Umesh Varshney ? 'principal investigator/group leader' 0000-0003-3196-5908 3 bgopal@iisc.ac.in Balasubramanian Gopal ? 'principal investigator/group leader' 0000-0001-9097-5052 # _audit_author.name 'Aroli, S.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-9834-2134 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 51 _citation.language ? _citation.page_first 6554 _citation.page_last 6565 _citation.title 'Mutational and structural analyses of UdgX: insights into the active site pocket architecture and its evolution.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkad486 _citation.pdbx_database_id_PubMed 37283083 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Aroli, S.' 1 0000-0002-9834-2134 primary 'Woo, E.J.' 2 0000-0001-6983-0270 primary 'Gopal, B.' 3 0000-0001-9097-5052 primary 'Varshney, U.' 4 0000-0003-3196-5908 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Type-4 uracil-DNA glycosylase' 21707.656 1 3.2.2.27 Q53A,H109S ? ? 2 non-polymer syn 'IRON/SULFUR CLUSTER' 351.640 1 ? ? ? ? 3 non-polymer syn BETA-MERCAPTOETHANOL 78.133 1 ? ? ? ? 4 water nat water 18.015 79 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AGAQDFVPHTADLAELAAAAGECRGCGLYRDATQAVFGAGGRSARIMMIGEAPGDKEDLAGLPFVGPAGRLLDRALEAAD IDRDALYVTNAVKHFKFTRAAGGKRRISKTPSRTEVVACRPWLIAEMTSVEPDVVVLLGATAAKALLGNDFRVTQHRGEV LHVDDVPGDPALVATVHPSSLLRGPKEERESAFAGLVDDLRVAADV ; _entity_poly.pdbx_seq_one_letter_code_can ;AGAQDFVPHTADLAELAAAAGECRGCGLYRDATQAVFGAGGRSARIMMIGEAPGDKEDLAGLPFVGPAGRLLDRALEAAD IDRDALYVTNAVKHFKFTRAAGGKRRISKTPSRTEVVACRPWLIAEMTSVEPDVVVLLGATAAKALLGNDFRVTQHRGEV LHVDDVPGDPALVATVHPSSLLRGPKEERESAFAGLVDDLRVAADV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'IRON/SULFUR CLUSTER' SF4 3 BETA-MERCAPTOETHANOL BME 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLY n 1 3 ALA n 1 4 GLN n 1 5 ASP n 1 6 PHE n 1 7 VAL n 1 8 PRO n 1 9 HIS n 1 10 THR n 1 11 ALA n 1 12 ASP n 1 13 LEU n 1 14 ALA n 1 15 GLU n 1 16 LEU n 1 17 ALA n 1 18 ALA n 1 19 ALA n 1 20 ALA n 1 21 GLY n 1 22 GLU n 1 23 CYS n 1 24 ARG n 1 25 GLY n 1 26 CYS n 1 27 GLY n 1 28 LEU n 1 29 TYR n 1 30 ARG n 1 31 ASP n 1 32 ALA n 1 33 THR n 1 34 GLN n 1 35 ALA n 1 36 VAL n 1 37 PHE n 1 38 GLY n 1 39 ALA n 1 40 GLY n 1 41 GLY n 1 42 ARG n 1 43 SER n 1 44 ALA n 1 45 ARG n 1 46 ILE n 1 47 MET n 1 48 MET n 1 49 ILE n 1 50 GLY n 1 51 GLU n 1 52 ALA n 1 53 PRO n 1 54 GLY n 1 55 ASP n 1 56 LYS n 1 57 GLU n 1 58 ASP n 1 59 LEU n 1 60 ALA n 1 61 GLY n 1 62 LEU n 1 63 PRO n 1 64 PHE n 1 65 VAL n 1 66 GLY n 1 67 PRO n 1 68 ALA n 1 69 GLY n 1 70 ARG n 1 71 LEU n 1 72 LEU n 1 73 ASP n 1 74 ARG n 1 75 ALA n 1 76 LEU n 1 77 GLU n 1 78 ALA n 1 79 ALA n 1 80 ASP n 1 81 ILE n 1 82 ASP n 1 83 ARG n 1 84 ASP n 1 85 ALA n 1 86 LEU n 1 87 TYR n 1 88 VAL n 1 89 THR n 1 90 ASN n 1 91 ALA n 1 92 VAL n 1 93 LYS n 1 94 HIS n 1 95 PHE n 1 96 LYS n 1 97 PHE n 1 98 THR n 1 99 ARG n 1 100 ALA n 1 101 ALA n 1 102 GLY n 1 103 GLY n 1 104 LYS n 1 105 ARG n 1 106 ARG n 1 107 ILE n 1 108 SER n 1 109 LYS n 1 110 THR n 1 111 PRO n 1 112 SER n 1 113 ARG n 1 114 THR n 1 115 GLU n 1 116 VAL n 1 117 VAL n 1 118 ALA n 1 119 CYS n 1 120 ARG n 1 121 PRO n 1 122 TRP n 1 123 LEU n 1 124 ILE n 1 125 ALA n 1 126 GLU n 1 127 MET n 1 128 THR n 1 129 SER n 1 130 VAL n 1 131 GLU n 1 132 PRO n 1 133 ASP n 1 134 VAL n 1 135 VAL n 1 136 VAL n 1 137 LEU n 1 138 LEU n 1 139 GLY n 1 140 ALA n 1 141 THR n 1 142 ALA n 1 143 ALA n 1 144 LYS n 1 145 ALA n 1 146 LEU n 1 147 LEU n 1 148 GLY n 1 149 ASN n 1 150 ASP n 1 151 PHE n 1 152 ARG n 1 153 VAL n 1 154 THR n 1 155 GLN n 1 156 HIS n 1 157 ARG n 1 158 GLY n 1 159 GLU n 1 160 VAL n 1 161 LEU n 1 162 HIS n 1 163 VAL n 1 164 ASP n 1 165 ASP n 1 166 VAL n 1 167 PRO n 1 168 GLY n 1 169 ASP n 1 170 PRO n 1 171 ALA n 1 172 LEU n 1 173 VAL n 1 174 ALA n 1 175 THR n 1 176 VAL n 1 177 HIS n 1 178 PRO n 1 179 SER n 1 180 SER n 1 181 LEU n 1 182 LEU n 1 183 ARG n 1 184 GLY n 1 185 PRO n 1 186 LYS n 1 187 GLU n 1 188 GLU n 1 189 ARG n 1 190 GLU n 1 191 SER n 1 192 ALA n 1 193 PHE n 1 194 ALA n 1 195 GLY n 1 196 LEU n 1 197 VAL n 1 198 ASP n 1 199 ASP n 1 200 LEU n 1 201 ARG n 1 202 VAL n 1 203 ALA n 1 204 ALA n 1 205 ASP n 1 206 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 206 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MSMEG_0265 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'MC2 155' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycolicibacterium smegmatis MC2 155' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 246196 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 700084 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant Rosetta _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET14b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BME non-polymer . BETA-MERCAPTOETHANOL ? 'C2 H6 O S' 78.133 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SF4 non-polymer . 'IRON/SULFUR CLUSTER' ? 'Fe4 S4' 351.640 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 2 2 ALA ALA A . n A 1 2 GLY 2 3 3 GLY GLY A . n A 1 3 ALA 3 4 4 ALA ALA A . n A 1 4 GLN 4 5 5 GLN GLN A . n A 1 5 ASP 5 6 6 ASP ASP A . n A 1 6 PHE 6 7 7 PHE PHE A . n A 1 7 VAL 7 8 8 VAL VAL A . n A 1 8 PRO 8 9 9 PRO PRO A . n A 1 9 HIS 9 10 10 HIS HIS A . n A 1 10 THR 10 11 11 THR THR A . n A 1 11 ALA 11 12 12 ALA ALA A . n A 1 12 ASP 12 13 13 ASP ASP A . n A 1 13 LEU 13 14 14 LEU LEU A . n A 1 14 ALA 14 15 15 ALA ALA A . n A 1 15 GLU 15 16 16 GLU GLU A . n A 1 16 LEU 16 17 17 LEU LEU A . n A 1 17 ALA 17 18 18 ALA ALA A . n A 1 18 ALA 18 19 19 ALA ALA A . n A 1 19 ALA 19 20 20 ALA ALA A . n A 1 20 ALA 20 21 21 ALA ALA A . n A 1 21 GLY 21 22 22 GLY GLY A . n A 1 22 GLU 22 23 23 GLU GLU A . n A 1 23 CYS 23 24 24 CYS CYS A . n A 1 24 ARG 24 25 25 ARG ARG A . n A 1 25 GLY 25 26 26 GLY GLY A . n A 1 26 CYS 26 27 27 CYS CYS A . n A 1 27 GLY 27 28 28 GLY GLY A . n A 1 28 LEU 28 29 29 LEU LEU A . n A 1 29 TYR 29 30 30 TYR TYR A . n A 1 30 ARG 30 31 31 ARG ARG A . n A 1 31 ASP 31 32 32 ASP ASP A . n A 1 32 ALA 32 33 33 ALA ALA A . n A 1 33 THR 33 34 34 THR THR A . n A 1 34 GLN 34 35 35 GLN GLN A . n A 1 35 ALA 35 36 36 ALA ALA A . n A 1 36 VAL 36 37 37 VAL VAL A . n A 1 37 PHE 37 38 38 PHE PHE A . n A 1 38 GLY 38 39 39 GLY GLY A . n A 1 39 ALA 39 40 40 ALA ALA A . n A 1 40 GLY 40 41 41 GLY GLY A . n A 1 41 GLY 41 42 42 GLY GLY A . n A 1 42 ARG 42 43 43 ARG ARG A . n A 1 43 SER 43 44 44 SER SER A . n A 1 44 ALA 44 45 45 ALA ALA A . n A 1 45 ARG 45 46 46 ARG ARG A . n A 1 46 ILE 46 47 47 ILE ILE A . n A 1 47 MET 47 48 48 MET MET A . n A 1 48 MET 48 49 49 MET MET A . n A 1 49 ILE 49 50 50 ILE ILE A . n A 1 50 GLY 50 51 51 GLY GLY A . n A 1 51 GLU 51 52 52 GLU GLU A . n A 1 52 ALA 52 53 53 ALA ALA A . n A 1 53 PRO 53 54 54 PRO PRO A . n A 1 54 GLY 54 55 55 GLY GLY A . n A 1 55 ASP 55 56 56 ASP ASP A . n A 1 56 LYS 56 57 57 LYS LYS A . n A 1 57 GLU 57 58 58 GLU GLU A . n A 1 58 ASP 58 59 59 ASP ASP A . n A 1 59 LEU 59 60 60 LEU LEU A . n A 1 60 ALA 60 61 61 ALA ALA A . n A 1 61 GLY 61 62 62 GLY GLY A . n A 1 62 LEU 62 63 63 LEU LEU A . n A 1 63 PRO 63 64 64 PRO PRO A . n A 1 64 PHE 64 65 65 PHE PHE A . n A 1 65 VAL 65 66 66 VAL VAL A . n A 1 66 GLY 66 67 67 GLY GLY A . n A 1 67 PRO 67 68 68 PRO PRO A . n A 1 68 ALA 68 69 69 ALA ALA A . n A 1 69 GLY 69 70 70 GLY GLY A . n A 1 70 ARG 70 71 71 ARG ARG A . n A 1 71 LEU 71 72 72 LEU LEU A . n A 1 72 LEU 72 73 73 LEU LEU A . n A 1 73 ASP 73 74 74 ASP ASP A . n A 1 74 ARG 74 75 75 ARG ARG A . n A 1 75 ALA 75 76 76 ALA ALA A . n A 1 76 LEU 76 77 77 LEU LEU A . n A 1 77 GLU 77 78 78 GLU GLU A . n A 1 78 ALA 78 79 79 ALA ALA A . n A 1 79 ALA 79 80 80 ALA ALA A . n A 1 80 ASP 80 81 81 ASP ASP A . n A 1 81 ILE 81 82 82 ILE ILE A . n A 1 82 ASP 82 83 83 ASP ASP A . n A 1 83 ARG 83 84 84 ARG ARG A . n A 1 84 ASP 84 85 85 ASP ASP A . n A 1 85 ALA 85 86 86 ALA ALA A . n A 1 86 LEU 86 87 87 LEU LEU A . n A 1 87 TYR 87 88 88 TYR TYR A . n A 1 88 VAL 88 89 89 VAL VAL A . n A 1 89 THR 89 90 90 THR THR A . n A 1 90 ASN 90 91 91 ASN ASN A . n A 1 91 ALA 91 92 92 ALA ALA A . n A 1 92 VAL 92 93 93 VAL VAL A . n A 1 93 LYS 93 94 94 LYS LYS A . n A 1 94 HIS 94 95 95 HIS HIS A . n A 1 95 PHE 95 96 96 PHE PHE A . n A 1 96 LYS 96 97 97 LYS LYS A . n A 1 97 PHE 97 98 98 PHE PHE A . n A 1 98 THR 98 99 99 THR THR A . n A 1 99 ARG 99 100 100 ARG ARG A . n A 1 100 ALA 100 101 101 ALA ALA A . n A 1 101 ALA 101 102 102 ALA ALA A . n A 1 102 GLY 102 103 103 GLY GLY A . n A 1 103 GLY 103 104 104 GLY GLY A . n A 1 104 LYS 104 105 105 LYS LYS A . n A 1 105 ARG 105 106 106 ARG ARG A . n A 1 106 ARG 106 107 107 ARG ARG A . n A 1 107 ILE 107 108 108 ILE ILE A . n A 1 108 SER 108 109 109 SER SER A . n A 1 109 LYS 109 110 110 LYS LYS A . n A 1 110 THR 110 111 111 THR THR A . n A 1 111 PRO 111 112 112 PRO PRO A . n A 1 112 SER 112 113 113 SER SER A . n A 1 113 ARG 113 114 114 ARG ARG A . n A 1 114 THR 114 115 115 THR THR A . n A 1 115 GLU 115 116 116 GLU GLU A . n A 1 116 VAL 116 117 117 VAL VAL A . n A 1 117 VAL 117 118 118 VAL VAL A . n A 1 118 ALA 118 119 119 ALA ALA A . n A 1 119 CYS 119 120 120 CYS CYS A . n A 1 120 ARG 120 121 121 ARG ARG A . n A 1 121 PRO 121 122 122 PRO PRO A . n A 1 122 TRP 122 123 123 TRP TRP A . n A 1 123 LEU 123 124 124 LEU LEU A . n A 1 124 ILE 124 125 125 ILE ILE A . n A 1 125 ALA 125 126 126 ALA ALA A . n A 1 126 GLU 126 127 127 GLU GLU A . n A 1 127 MET 127 128 128 MET MET A . n A 1 128 THR 128 129 129 THR THR A . n A 1 129 SER 129 130 130 SER SER A . n A 1 130 VAL 130 131 131 VAL VAL A . n A 1 131 GLU 131 132 132 GLU GLU A . n A 1 132 PRO 132 133 133 PRO PRO A . n A 1 133 ASP 133 134 134 ASP ASP A . n A 1 134 VAL 134 135 135 VAL VAL A . n A 1 135 VAL 135 136 136 VAL VAL A . n A 1 136 VAL 136 137 137 VAL VAL A . n A 1 137 LEU 137 138 138 LEU LEU A . n A 1 138 LEU 138 139 139 LEU LEU A . n A 1 139 GLY 139 140 140 GLY GLY A . n A 1 140 ALA 140 141 141 ALA ALA A . n A 1 141 THR 141 142 142 THR THR A . n A 1 142 ALA 142 143 143 ALA ALA A . n A 1 143 ALA 143 144 144 ALA ALA A . n A 1 144 LYS 144 145 145 LYS LYS A . n A 1 145 ALA 145 146 146 ALA ALA A . n A 1 146 LEU 146 147 147 LEU LEU A . n A 1 147 LEU 147 148 148 LEU LEU A . n A 1 148 GLY 148 149 149 GLY GLY A . n A 1 149 ASN 149 150 150 ASN ASN A . n A 1 150 ASP 150 151 151 ASP ASP A . n A 1 151 PHE 151 152 152 PHE PHE A . n A 1 152 ARG 152 153 153 ARG ARG A . n A 1 153 VAL 153 154 154 VAL VAL A . n A 1 154 THR 154 155 155 THR THR A . n A 1 155 GLN 155 156 156 GLN GLN A . n A 1 156 HIS 156 157 157 HIS HIS A . n A 1 157 ARG 157 158 158 ARG ARG A . n A 1 158 GLY 158 159 159 GLY GLY A . n A 1 159 GLU 159 160 160 GLU GLU A . n A 1 160 VAL 160 161 161 VAL VAL A . n A 1 161 LEU 161 162 162 LEU LEU A . n A 1 162 HIS 162 163 163 HIS HIS A . n A 1 163 VAL 163 164 164 VAL VAL A . n A 1 164 ASP 164 165 165 ASP ASP A . n A 1 165 ASP 165 166 166 ASP ASP A . n A 1 166 VAL 166 167 167 VAL VAL A . n A 1 167 PRO 167 168 168 PRO PRO A . n A 1 168 GLY 168 169 169 GLY GLY A . n A 1 169 ASP 169 170 170 ASP ASP A . n A 1 170 PRO 170 171 171 PRO PRO A . n A 1 171 ALA 171 172 172 ALA ALA A . n A 1 172 LEU 172 173 173 LEU LEU A . n A 1 173 VAL 173 174 174 VAL VAL A . n A 1 174 ALA 174 175 175 ALA ALA A . n A 1 175 THR 175 176 176 THR THR A . n A 1 176 VAL 176 177 177 VAL VAL A . n A 1 177 HIS 177 178 178 HIS HIS A . n A 1 178 PRO 178 179 179 PRO PRO A . n A 1 179 SER 179 180 180 SER SER A . n A 1 180 SER 180 181 181 SER SER A . n A 1 181 LEU 181 182 182 LEU LEU A . n A 1 182 LEU 182 183 183 LEU LEU A . n A 1 183 ARG 183 184 184 ARG ARG A . n A 1 184 GLY 184 185 185 GLY GLY A . n A 1 185 PRO 185 186 186 PRO PRO A . n A 1 186 LYS 186 187 187 LYS LYS A . n A 1 187 GLU 187 188 188 GLU GLU A . n A 1 188 GLU 188 189 189 GLU GLU A . n A 1 189 ARG 189 190 190 ARG ARG A . n A 1 190 GLU 190 191 191 GLU GLU A . n A 1 191 SER 191 192 192 SER SER A . n A 1 192 ALA 192 193 193 ALA ALA A . n A 1 193 PHE 193 194 194 PHE PHE A . n A 1 194 ALA 194 195 195 ALA ALA A . n A 1 195 GLY 195 196 196 GLY GLY A . n A 1 196 LEU 196 197 197 LEU LEU A . n A 1 197 VAL 197 198 198 VAL VAL A . n A 1 198 ASP 198 199 199 ASP ASP A . n A 1 199 ASP 199 200 200 ASP ASP A . n A 1 200 LEU 200 201 201 LEU LEU A . n A 1 201 ARG 201 202 202 ARG ARG A . n A 1 202 VAL 202 203 203 VAL VAL A . n A 1 203 ALA 203 204 204 ALA ALA A . n A 1 204 ALA 204 205 205 ALA ALA A . n A 1 205 ASP 205 206 206 ASP ASP A . n A 1 206 VAL 206 207 207 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SF4 1 301 301 SF4 SF4 A . C 3 BME 1 302 302 BME BME A . D 4 HOH 1 401 31 HOH HOH A . D 4 HOH 2 402 30 HOH HOH A . D 4 HOH 3 403 58 HOH HOH A . D 4 HOH 4 404 52 HOH HOH A . D 4 HOH 5 405 13 HOH HOH A . D 4 HOH 6 406 21 HOH HOH A . D 4 HOH 7 407 19 HOH HOH A . D 4 HOH 8 408 54 HOH HOH A . D 4 HOH 9 409 32 HOH HOH A . D 4 HOH 10 410 23 HOH HOH A . D 4 HOH 11 411 60 HOH HOH A . D 4 HOH 12 412 7 HOH HOH A . D 4 HOH 13 413 44 HOH HOH A . D 4 HOH 14 414 4 HOH HOH A . D 4 HOH 15 415 47 HOH HOH A . D 4 HOH 16 416 9 HOH HOH A . D 4 HOH 17 417 29 HOH HOH A . D 4 HOH 18 418 3 HOH HOH A . D 4 HOH 19 419 49 HOH HOH A . D 4 HOH 20 420 24 HOH HOH A . D 4 HOH 21 421 37 HOH HOH A . D 4 HOH 22 422 6 HOH HOH A . D 4 HOH 23 423 35 HOH HOH A . D 4 HOH 24 424 17 HOH HOH A . D 4 HOH 25 425 64 HOH HOH A . D 4 HOH 26 426 48 HOH HOH A . D 4 HOH 27 427 18 HOH HOH A . D 4 HOH 28 428 61 HOH HOH A . D 4 HOH 29 429 87 HOH HOH A . D 4 HOH 30 430 42 HOH HOH A . D 4 HOH 31 431 25 HOH HOH A . D 4 HOH 32 432 15 HOH HOH A . D 4 HOH 33 433 34 HOH HOH A . D 4 HOH 34 434 20 HOH HOH A . D 4 HOH 35 435 27 HOH HOH A . D 4 HOH 36 436 8 HOH HOH A . D 4 HOH 37 437 40 HOH HOH A . D 4 HOH 38 438 57 HOH HOH A . D 4 HOH 39 439 55 HOH HOH A . D 4 HOH 40 440 45 HOH HOH A . D 4 HOH 41 441 41 HOH HOH A . D 4 HOH 42 442 16 HOH HOH A . D 4 HOH 43 443 81 HOH HOH A . D 4 HOH 44 444 39 HOH HOH A . D 4 HOH 45 445 5 HOH HOH A . D 4 HOH 46 446 36 HOH HOH A . D 4 HOH 47 447 33 HOH HOH A . D 4 HOH 48 448 56 HOH HOH A . D 4 HOH 49 449 66 HOH HOH A . D 4 HOH 50 450 50 HOH HOH A . D 4 HOH 51 451 51 HOH HOH A . D 4 HOH 52 452 12 HOH HOH A . D 4 HOH 53 453 14 HOH HOH A . D 4 HOH 54 454 65 HOH HOH A . D 4 HOH 55 455 26 HOH HOH A . D 4 HOH 56 456 53 HOH HOH A . D 4 HOH 57 457 11 HOH HOH A . D 4 HOH 58 458 28 HOH HOH A . D 4 HOH 59 459 2 HOH HOH A . D 4 HOH 60 460 1 HOH HOH A . D 4 HOH 61 461 59 HOH HOH A . D 4 HOH 62 462 46 HOH HOH A . D 4 HOH 63 463 38 HOH HOH A . D 4 HOH 64 464 22 HOH HOH A . D 4 HOH 65 465 78 HOH HOH A . D 4 HOH 66 466 88 HOH HOH A . D 4 HOH 67 467 85 HOH HOH A . D 4 HOH 68 468 83 HOH HOH A . D 4 HOH 69 469 76 HOH HOH A . D 4 HOH 70 470 63 HOH HOH A . D 4 HOH 71 471 10 HOH HOH A . D 4 HOH 72 472 75 HOH HOH A . D 4 HOH 73 473 89 HOH HOH A . D 4 HOH 74 474 86 HOH HOH A . D 4 HOH 75 475 62 HOH HOH A . D 4 HOH 76 476 82 HOH HOH A . D 4 HOH 77 477 90 HOH HOH A . D 4 HOH 78 478 68 HOH HOH A . D 4 HOH 79 479 67 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 85 ? CG ? A ASP 84 CG 2 1 Y 1 A ASP 85 ? OD1 ? A ASP 84 OD1 3 1 Y 1 A ASP 85 ? OD2 ? A ASP 84 OD2 4 1 Y 1 A LYS 105 ? CG ? A LYS 104 CG 5 1 Y 1 A LYS 105 ? CD ? A LYS 104 CD 6 1 Y 1 A LYS 105 ? CE ? A LYS 104 CE 7 1 Y 1 A LYS 105 ? NZ ? A LYS 104 NZ 8 1 Y 1 A GLU 188 ? CG ? A GLU 187 CG 9 1 Y 1 A GLU 188 ? CD ? A GLU 187 CD 10 1 Y 1 A GLU 188 ? OE1 ? A GLU 187 OE1 11 1 Y 1 A GLU 188 ? OE2 ? A GLU 187 OE2 12 1 Y 1 A ARG 202 ? NH1 ? A ARG 201 NH1 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.2 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 104.42 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8IIR _cell.details ? _cell.formula_units_Z ? _cell.length_a 36.500 _cell.length_a_esd ? _cell.length_b 51.150 _cell.length_b_esd ? _cell.length_c 54.960 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8IIR _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8IIR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.10 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.26 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method MICROBATCH _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.0M Ammonium citrate tribasic pH7.0, 0.1M BIS-TRIS propane pH7.0' _exptl_crystal_grow.pdbx_pH_range 6.8-7.2 _exptl_crystal_grow.temp 295 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR scanner 345 mm plate' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-03-22 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator M _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54179 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'BRUKER AXS MICROSTAR' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54179 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8IIR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.28 _reflns.d_resolution_low 53.23 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9050 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.137 _reflns.pdbx_Rpim_I_all 0.096 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.986 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.098 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.28 _reflns_shell.d_res_low 2.37 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 925 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.0 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.436 _reflns_shell.pdbx_Rpim_I_all 0.300 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.822 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.315 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8IIR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.28 _refine.ls_d_res_low 53.23 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9035 _refine.ls_number_reflns_R_free 447 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.83 _refine.ls_percent_reflns_R_free 4.95 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1817 _refine.ls_R_factor_R_free 0.2381 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1789 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.98 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values MLHL _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.75 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.23 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1511 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 79 _refine_hist.number_atoms_total 1602 _refine_hist.d_res_high 2.28 _refine_hist.d_res_low 53.23 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1566 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.551 ? 2130 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 4.905 ? 226 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.041 ? 246 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 282 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.28 2.61 . . 147 2834 100.00 . . . . 0.1927 . . . . . . . . . . . 0.2715 'X-RAY DIFFRACTION' 2.61 3.29 . . 168 2835 100.00 . . . . 0.1850 . . . . . . . . . . . 0.2448 'X-RAY DIFFRACTION' 3.29 53.23 . . 132 2919 100.00 . . . . 0.1695 . . . . . . . . . . . 0.2178 # _struct.entry_id 8IIR _struct.title 'MsmUdgX H109S/Q53A double mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8IIR _struct_keywords.text 'UdgX, H109S, Q53A, mutant, protein, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0QP43_MYCS2 _struct_ref.pdbx_db_accession A0QP43 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AGAQDFVPHTADLAELAAAAGECRGCGLYRDATQAVFGAGGRSARIMMIGEQPGDKEDLAGLPFVGPAGRLLDRALEAAD IDRDALYVTNAVKHFKFTRAAGGKRRIHKTPSRTEVVACRPWLIAEMTSVEPDVVVLLGATAAKALLGNDFRVTQHRGEV LHVDDVPGDPALVATVHPSSLLRGPKEERESAFAGLVDDLRVAADV ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8IIR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 206 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0QP43 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 207 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 207 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8IIR ALA A 52 ? UNP A0QP43 GLN 53 'engineered mutation' 53 1 1 8IIR SER A 108 ? UNP A0QP43 HIS 109 'engineered mutation' 109 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 380 ? 1 MORE -20 ? 1 'SSA (A^2)' 9860 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 3 ? VAL A 7 ? ALA A 4 VAL A 8 5 ? 5 HELX_P HELX_P2 AA2 ASP A 12 ? GLY A 21 ? ASP A 13 GLY A 22 1 ? 10 HELX_P HELX_P3 AA3 CYS A 26 ? ARG A 30 ? CYS A 27 ARG A 31 5 ? 5 HELX_P HELX_P4 AA4 GLY A 54 ? GLY A 61 ? GLY A 55 GLY A 62 1 ? 8 HELX_P HELX_P5 AA5 GLY A 66 ? ALA A 79 ? GLY A 67 ALA A 80 1 ? 14 HELX_P HELX_P6 AA6 ASP A 82 ? ASP A 84 ? ASP A 83 ASP A 85 5 ? 3 HELX_P HELX_P7 AA7 SER A 112 ? GLU A 131 ? SER A 113 GLU A 132 1 ? 20 HELX_P HELX_P8 AA8 GLY A 139 ? GLY A 148 ? GLY A 140 GLY A 149 1 ? 10 HELX_P HELX_P9 AA9 ARG A 152 ? HIS A 156 ? ARG A 153 HIS A 157 5 ? 5 HELX_P HELX_P10 AB1 HIS A 177 ? LEU A 182 ? HIS A 178 LEU A 183 5 ? 6 HELX_P HELX_P11 AB2 PRO A 185 ? VAL A 206 ? PRO A 186 VAL A 207 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 23 SG ? ? ? 1_555 B SF4 . FE3 ? ? A CYS 24 A SF4 301 1_555 ? ? ? ? ? ? ? 2.283 ? ? metalc2 metalc ? ? A CYS 26 SG ? ? ? 1_555 B SF4 . FE2 ? ? A CYS 27 A SF4 301 1_555 ? ? ? ? ? ? ? 2.286 ? ? metalc3 metalc ? ? A HIS 94 ND1 ? ? ? 1_555 B SF4 . FE4 ? ? A HIS 95 A SF4 301 1_555 ? ? ? ? ? ? ? 2.236 ? ? metalc4 metalc ? ? A CYS 119 SG ? ? ? 1_555 B SF4 . FE1 ? ? A CYS 120 A SF4 301 1_555 ? ? ? ? ? ? ? 2.501 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 23 ? A CYS 24 ? 1_555 FE3 ? B SF4 . ? A SF4 301 ? 1_555 S1 ? B SF4 . ? A SF4 301 ? 1_555 123.3 ? 2 SG ? A CYS 23 ? A CYS 24 ? 1_555 FE3 ? B SF4 . ? A SF4 301 ? 1_555 S2 ? B SF4 . ? A SF4 301 ? 1_555 104.5 ? 3 S1 ? B SF4 . ? A SF4 301 ? 1_555 FE3 ? B SF4 . ? A SF4 301 ? 1_555 S2 ? B SF4 . ? A SF4 301 ? 1_555 104.6 ? 4 SG ? A CYS 23 ? A CYS 24 ? 1_555 FE3 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 114.5 ? 5 S1 ? B SF4 . ? A SF4 301 ? 1_555 FE3 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 103.8 ? 6 S2 ? B SF4 . ? A SF4 301 ? 1_555 FE3 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 104.3 ? 7 SG ? A CYS 26 ? A CYS 27 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 S1 ? B SF4 . ? A SF4 301 ? 1_555 119.7 ? 8 SG ? A CYS 26 ? A CYS 27 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 S3 ? B SF4 . ? A SF4 301 ? 1_555 102.5 ? 9 S1 ? B SF4 . ? A SF4 301 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 S3 ? B SF4 . ? A SF4 301 ? 1_555 104.1 ? 10 SG ? A CYS 26 ? A CYS 27 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 120.1 ? 11 S1 ? B SF4 . ? A SF4 301 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 104.1 ? 12 S3 ? B SF4 . ? A SF4 301 ? 1_555 FE2 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 104.1 ? 13 ND1 ? A HIS 94 ? A HIS 95 ? 1_555 FE4 ? B SF4 . ? A SF4 301 ? 1_555 S1 ? B SF4 . ? A SF4 301 ? 1_555 108.5 ? 14 ND1 ? A HIS 94 ? A HIS 95 ? 1_555 FE4 ? B SF4 . ? A SF4 301 ? 1_555 S2 ? B SF4 . ? A SF4 301 ? 1_555 109.9 ? 15 S1 ? B SF4 . ? A SF4 301 ? 1_555 FE4 ? B SF4 . ? A SF4 301 ? 1_555 S2 ? B SF4 . ? A SF4 301 ? 1_555 104.1 ? 16 ND1 ? A HIS 94 ? A HIS 95 ? 1_555 FE4 ? B SF4 . ? A SF4 301 ? 1_555 S3 ? B SF4 . ? A SF4 301 ? 1_555 124.0 ? 17 S1 ? B SF4 . ? A SF4 301 ? 1_555 FE4 ? B SF4 . ? A SF4 301 ? 1_555 S3 ? B SF4 . ? A SF4 301 ? 1_555 104.7 ? 18 S2 ? B SF4 . ? A SF4 301 ? 1_555 FE4 ? B SF4 . ? A SF4 301 ? 1_555 S3 ? B SF4 . ? A SF4 301 ? 1_555 103.9 ? 19 SG ? A CYS 119 ? A CYS 120 ? 1_555 FE1 ? B SF4 . ? A SF4 301 ? 1_555 S2 ? B SF4 . ? A SF4 301 ? 1_555 111.1 ? 20 SG ? A CYS 119 ? A CYS 120 ? 1_555 FE1 ? B SF4 . ? A SF4 301 ? 1_555 S3 ? B SF4 . ? A SF4 301 ? 1_555 115.8 ? 21 S2 ? B SF4 . ? A SF4 301 ? 1_555 FE1 ? B SF4 . ? A SF4 301 ? 1_555 S3 ? B SF4 . ? A SF4 301 ? 1_555 104.1 ? 22 SG ? A CYS 119 ? A CYS 120 ? 1_555 FE1 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 116.3 ? 23 S2 ? B SF4 . ? A SF4 301 ? 1_555 FE1 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 104.0 ? 24 S3 ? B SF4 . ? A SF4 301 ? 1_555 FE1 ? B SF4 . ? A SF4 301 ? 1_555 S4 ? B SF4 . ? A SF4 301 ? 1_555 104.1 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 86 ? ASN A 90 ? LEU A 87 ASN A 91 AA1 2 ILE A 46 ? GLY A 50 ? ILE A 47 GLY A 51 AA1 3 VAL A 134 ? LEU A 138 ? VAL A 135 LEU A 139 AA1 4 ALA A 171 ? THR A 175 ? ALA A 172 THR A 176 AA2 1 PHE A 97 ? THR A 98 ? PHE A 98 THR A 99 AA2 2 ILE A 107 ? SER A 108 ? ILE A 108 SER A 109 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 89 ? O THR A 90 N MET A 48 ? N MET A 49 AA1 2 3 N MET A 47 ? N MET A 48 O VAL A 136 ? O VAL A 137 AA1 3 4 N LEU A 137 ? N LEU A 138 O THR A 175 ? O THR A 176 AA2 1 2 N THR A 98 ? N THR A 99 O ILE A 107 ? O ILE A 108 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 166 ? ? -67.22 10.31 2 1 ASP A 170 ? ? 34.25 56.17 # _pdbx_entry_details.entry_id 8IIR _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BME C1 C N N 74 BME C2 C N N 75 BME O1 O N N 76 BME S2 S N N 77 BME H11 H N N 78 BME H12 H N N 79 BME H21 H N N 80 BME H22 H N N 81 BME HO1 H N N 82 BME HS2 H N N 83 CYS N N N N 84 CYS CA C N R 85 CYS C C N N 86 CYS O O N N 87 CYS CB C N N 88 CYS SG S N N 89 CYS OXT O N N 90 CYS H H N N 91 CYS H2 H N N 92 CYS HA H N N 93 CYS HB2 H N N 94 CYS HB3 H N N 95 CYS HG H N N 96 CYS HXT H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 SER N N N N 300 SER CA C N S 301 SER C C N N 302 SER O O N N 303 SER CB C N N 304 SER OG O N N 305 SER OXT O N N 306 SER H H N N 307 SER H2 H N N 308 SER HA H N N 309 SER HB2 H N N 310 SER HB3 H N N 311 SER HG H N N 312 SER HXT H N N 313 SF4 FE1 FE N N 314 SF4 FE2 FE N N 315 SF4 FE3 FE N N 316 SF4 FE4 FE N N 317 SF4 S1 S N N 318 SF4 S2 S N N 319 SF4 S3 S N N 320 SF4 S4 S N N 321 THR N N N N 322 THR CA C N S 323 THR C C N N 324 THR O O N N 325 THR CB C N R 326 THR OG1 O N N 327 THR CG2 C N N 328 THR OXT O N N 329 THR H H N N 330 THR H2 H N N 331 THR HA H N N 332 THR HB H N N 333 THR HG1 H N N 334 THR HG21 H N N 335 THR HG22 H N N 336 THR HG23 H N N 337 THR HXT H N N 338 TRP N N N N 339 TRP CA C N S 340 TRP C C N N 341 TRP O O N N 342 TRP CB C N N 343 TRP CG C Y N 344 TRP CD1 C Y N 345 TRP CD2 C Y N 346 TRP NE1 N Y N 347 TRP CE2 C Y N 348 TRP CE3 C Y N 349 TRP CZ2 C Y N 350 TRP CZ3 C Y N 351 TRP CH2 C Y N 352 TRP OXT O N N 353 TRP H H N N 354 TRP H2 H N N 355 TRP HA H N N 356 TRP HB2 H N N 357 TRP HB3 H N N 358 TRP HD1 H N N 359 TRP HE1 H N N 360 TRP HE3 H N N 361 TRP HZ2 H N N 362 TRP HZ3 H N N 363 TRP HH2 H N N 364 TRP HXT H N N 365 TYR N N N N 366 TYR CA C N S 367 TYR C C N N 368 TYR O O N N 369 TYR CB C N N 370 TYR CG C Y N 371 TYR CD1 C Y N 372 TYR CD2 C Y N 373 TYR CE1 C Y N 374 TYR CE2 C Y N 375 TYR CZ C Y N 376 TYR OH O N N 377 TYR OXT O N N 378 TYR H H N N 379 TYR H2 H N N 380 TYR HA H N N 381 TYR HB2 H N N 382 TYR HB3 H N N 383 TYR HD1 H N N 384 TYR HD2 H N N 385 TYR HE1 H N N 386 TYR HE2 H N N 387 TYR HH H N N 388 TYR HXT H N N 389 VAL N N N N 390 VAL CA C N S 391 VAL C C N N 392 VAL O O N N 393 VAL CB C N N 394 VAL CG1 C N N 395 VAL CG2 C N N 396 VAL OXT O N N 397 VAL H H N N 398 VAL H2 H N N 399 VAL HA H N N 400 VAL HB H N N 401 VAL HG11 H N N 402 VAL HG12 H N N 403 VAL HG13 H N N 404 VAL HG21 H N N 405 VAL HG22 H N N 406 VAL HG23 H N N 407 VAL HXT H N N 408 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BME C1 C2 sing N N 70 BME C1 O1 sing N N 71 BME C1 H11 sing N N 72 BME C1 H12 sing N N 73 BME C2 S2 sing N N 74 BME C2 H21 sing N N 75 BME C2 H22 sing N N 76 BME O1 HO1 sing N N 77 BME S2 HS2 sing N N 78 CYS N CA sing N N 79 CYS N H sing N N 80 CYS N H2 sing N N 81 CYS CA C sing N N 82 CYS CA CB sing N N 83 CYS CA HA sing N N 84 CYS C O doub N N 85 CYS C OXT sing N N 86 CYS CB SG sing N N 87 CYS CB HB2 sing N N 88 CYS CB HB3 sing N N 89 CYS SG HG sing N N 90 CYS OXT HXT sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 SF4 FE1 S2 sing N N 299 SF4 FE1 S3 sing N N 300 SF4 FE1 S4 sing N N 301 SF4 FE2 S1 sing N N 302 SF4 FE2 S3 sing N N 303 SF4 FE2 S4 sing N N 304 SF4 FE3 S1 sing N N 305 SF4 FE3 S2 sing N N 306 SF4 FE3 S4 sing N N 307 SF4 FE4 S1 sing N N 308 SF4 FE4 S2 sing N N 309 SF4 FE4 S3 sing N N 310 THR N CA sing N N 311 THR N H sing N N 312 THR N H2 sing N N 313 THR CA C sing N N 314 THR CA CB sing N N 315 THR CA HA sing N N 316 THR C O doub N N 317 THR C OXT sing N N 318 THR CB OG1 sing N N 319 THR CB CG2 sing N N 320 THR CB HB sing N N 321 THR OG1 HG1 sing N N 322 THR CG2 HG21 sing N N 323 THR CG2 HG22 sing N N 324 THR CG2 HG23 sing N N 325 THR OXT HXT sing N N 326 TRP N CA sing N N 327 TRP N H sing N N 328 TRP N H2 sing N N 329 TRP CA C sing N N 330 TRP CA CB sing N N 331 TRP CA HA sing N N 332 TRP C O doub N N 333 TRP C OXT sing N N 334 TRP CB CG sing N N 335 TRP CB HB2 sing N N 336 TRP CB HB3 sing N N 337 TRP CG CD1 doub Y N 338 TRP CG CD2 sing Y N 339 TRP CD1 NE1 sing Y N 340 TRP CD1 HD1 sing N N 341 TRP CD2 CE2 doub Y N 342 TRP CD2 CE3 sing Y N 343 TRP NE1 CE2 sing Y N 344 TRP NE1 HE1 sing N N 345 TRP CE2 CZ2 sing Y N 346 TRP CE3 CZ3 doub Y N 347 TRP CE3 HE3 sing N N 348 TRP CZ2 CH2 doub Y N 349 TRP CZ2 HZ2 sing N N 350 TRP CZ3 CH2 sing Y N 351 TRP CZ3 HZ3 sing N N 352 TRP CH2 HH2 sing N N 353 TRP OXT HXT sing N N 354 TYR N CA sing N N 355 TYR N H sing N N 356 TYR N H2 sing N N 357 TYR CA C sing N N 358 TYR CA CB sing N N 359 TYR CA HA sing N N 360 TYR C O doub N N 361 TYR C OXT sing N N 362 TYR CB CG sing N N 363 TYR CB HB2 sing N N 364 TYR CB HB3 sing N N 365 TYR CG CD1 doub Y N 366 TYR CG CD2 sing Y N 367 TYR CD1 CE1 sing Y N 368 TYR CD1 HD1 sing N N 369 TYR CD2 CE2 doub Y N 370 TYR CD2 HD2 sing N N 371 TYR CE1 CZ doub Y N 372 TYR CE1 HE1 sing N N 373 TYR CE2 CZ sing Y N 374 TYR CE2 HE2 sing N N 375 TYR CZ OH sing N N 376 TYR OH HH sing N N 377 TYR OXT HXT sing N N 378 VAL N CA sing N N 379 VAL N H sing N N 380 VAL N H2 sing N N 381 VAL CA C sing N N 382 VAL CA CB sing N N 383 VAL CA HA sing N N 384 VAL C O doub N N 385 VAL C OXT sing N N 386 VAL CB CG1 sing N N 387 VAL CB CG2 sing N N 388 VAL CB HB sing N N 389 VAL CG1 HG11 sing N N 390 VAL CG1 HG12 sing N N 391 VAL CG1 HG13 sing N N 392 VAL CG2 HG21 sing N N 393 VAL CG2 HG22 sing N N 394 VAL CG2 HG23 sing N N 395 VAL OXT HXT sing N N 396 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Department of Biotechnology (DBT, India)' India BT/PR28058 1 'Department of Biotechnology (DBT, India)' India BT/PR13522 2 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 BME ? ? BME ? ? 'SUBJECT OF INVESTIGATION' ? 2 SF4 ? ? SF4 ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6AJS _pdbx_initial_refinement_model.details 'H109S mutant of MsmUdgX' # _atom_sites.entry_id 8IIR _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.027397 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.007045 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019550 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018787 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE N O S # loop_